BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780493|ref|YP_003064906.1|
phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (323 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780493|ref|YP_003064906.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040170|gb|ACT56966.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 323

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT
Sbjct: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK
Sbjct: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY
Sbjct: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE
Sbjct: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE
Sbjct: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300

Query: 301 LPPLERIRNNLRKYTHRHLSSRN 323
           LPPLERIRNNLRKYTHRHLSSRN
Sbjct: 301 LPPLERIRNNLRKYTHRHLSSRN 323


>gi|170749356|ref|YP_001755616.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655878|gb|ACB24933.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 325

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 169/314 (53%), Positives = 227/314 (72%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           ++L  A +PELP +Y GKVR+NY L DG RI I +DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 12  QVLRDATLPELPRHYRGKVRDNYDLPDGRRILITSDRISAFDRALAAIPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T+D+C NH + YPDPNV+VG++L++ P+E++VRGYLAG T TS+LT Y+ G+R +
Sbjct: 72  YWFEQTADLCPNHVIAYPDPNVVVGRRLEILPVEVVVRGYLAGTTSTSILTRYRAGERDM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD M  NQ+LP  +ITPTTK+ +   G D+P++  EI+ RG+LTR QW T+S  A
Sbjct: 132 YGHRFPDEMRPNQRLPEAIITPTTKAFDG--GHDEPLTEAEILERGLLTRAQWRTVSEAA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  LA E GLIL D+KYEFG D +  I+LADEIHTPDSSRYW  ++Y + F  G
Sbjct: 190 LALFARGTALAAERGLILADTKYEFGTDPEGRIVLADEIHTPDSSRYWFAQSYPERFAAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+RNW++ RC+PY+D IP+IP  ++L T+  YI AYE ITG +F+  +   
Sbjct: 250 SAPESFDKDFVRNWVVARCDPYKDPIPEIPAEVVLETAAVYIRAYETITGARFVLPDPAE 309

Query: 302 PPLERIRNNLRKYT 315
            PLERIR N+  Y 
Sbjct: 310 DPLERIRRNIAAYL 323


>gi|221638675|ref|YP_002524937.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides KD131]
 gi|221159456|gb|ACM00436.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides KD131]
          Length = 319

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 171/316 (54%), Positives = 232/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH + YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVISYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVSQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D +  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDGEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ YI A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYIEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|126461701|ref|YP_001042815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126103365|gb|ABN76043.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 319

 Score =  325 bits (832), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 171/316 (54%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLHDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ Y+ A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYVEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|332557696|ref|ZP_08412018.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides WS8N]
 gi|332275408|gb|EGJ20723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides WS8N]
          Length = 319

 Score =  324 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 170/316 (53%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ Y+ A+E ITG  F  D +  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYVEAFETITGRPFEPDLAGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|77462809|ref|YP_352313.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387227|gb|ABA78412.1| SAICAR synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 319

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 172/316 (54%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  TSDIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATSDICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ YI A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYIEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  +  R
Sbjct: 304 TPLERIRANLAPHFTR 319


>gi|146278274|ref|YP_001168433.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556515|gb|ABP71128.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 319

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 167/316 (52%), Positives = 235/316 (74%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELPN Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPNPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH + YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVISYPDPNVVLAKRVTILPVEIVVRGYLAGTTGTSVLTLYKQGAREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++ +EI+ +G+L+  QW+ +S++A
Sbjct: 126 YGHRLPDGLRDNEALPTPIITPTSKAFDG--GHDEPLTASEIVTQGLLSAAQWDEVSAHA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG K+A E GLILVD+KYEFG+D +  I++ADEIHTPDSSRYW    Y+++FR+G
Sbjct: 184 LALFARGQKMAAERGLILVDTKYEFGLDDEGRILIADEIHTPDSSRYWIASGYDEAFRDG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PYRD IP+IP+ +I RTS  Y+ A+E ITG  F  D S  
Sbjct: 244 SRPPSFDKDVIRSWVAARCDPYRDAIPEIPDEMIRRTSDVYVEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PL+RIR NL  +  R
Sbjct: 304 TPLDRIRANLASFFTR 319


>gi|220923609|ref|YP_002498911.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium nodulans ORS 2060]
 gi|219948216|gb|ACL58608.1| SAICAR synthetase [Methylobacterium nodulans ORS 2060]
          Length = 323

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 174/314 (55%), Positives = 228/314 (72%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L++A +PELPN+  GKVR+NY L DG RI I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 12  RVLAEATLPELPNHSRGKVRDNYDLPDGRRILISSDRISAFDRILAAIPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T D+C NH LDYPDPNV+V ++L + P+E++VRGYLAG T TS+LT Y+ G R++
Sbjct: 72  YWFEATRDLCPNHVLDYPDPNVVVARRLDILPVEIVVRGYLAGTTATSILTQYRAGLREM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD M  N++LP  ++TPTTK+ E   G D P++P+ I+ +G+LT+ QWET+S  A
Sbjct: 132 YGHRLPDGMRPNERLPEAILTPTTKAGEG--GHDTPLTPDAILAQGLLTQEQWETVSRAA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG +LA   GLIL D+KYEFG D    I+LADEIHTPDSSRYW   +Y + F  G
Sbjct: 190 LALFARGQELAARRGLILADTKYEFGTDADGRIVLADEIHTPDSSRYWFAASYPERFAAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDFIRNW++ RC+PYRD IP IP  ++L T+  YI A+E ITG  FI  +  L
Sbjct: 250 TAPESFDKDFIRNWVVARCDPYRDAIPAIPPEMVLETASVYIRAFETITGETFILPDLSL 309

Query: 302 PPLERIRNNLRKYT 315
            PLERIR NLR Y 
Sbjct: 310 APLERIRRNLRAYL 323


>gi|116253612|ref|YP_769450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258260|emb|CAK09362.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 314

 Score =  318 bits (814), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 192/315 (60%), Positives = 239/315 (75%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT  QW+T+S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPTEIVTRGLLTNEQWQTLSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A +NGLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKNGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPAELIEQTSAVYIKAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+RNNL +Y 
Sbjct: 299 ETPLARVRNNLARYF 313


>gi|190893228|ref|YP_001979770.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase [Rhizobium
           etli CIAT 652]
 gi|190698507|gb|ACE92592.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CIAT 652]
          Length = 314

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 192/315 (60%), Positives = 236/315 (74%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLLDGHRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT+ QWET+S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPAEIVGRGLLTKEQWETLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG  +A E GLILVD+KYEFG D   NIILADEIHTPDSSRYW   +Y  SF  
Sbjct: 179 ALALFARGQAMAAERGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLSASYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +FI D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPPELIEQTSAVYIRAYEAITGERFIPDDSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+RNNL +Y 
Sbjct: 299 ETPLARVRNNLSRYF 313


>gi|218682337|ref|ZP_03529938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli CIAT 894]
          Length = 314

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 189/315 (60%), Positives = 236/315 (74%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT  QW+ +S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPAEIVTRGLLTAEQWQALSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKRGLILVDTKYEFGTDSDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ DNS 
Sbjct: 239 GRRPESFDKDFVRAWVAERCDPYKDEIPEIPVELIEQTSAVYIKAYEAITGERFVPDNSH 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+R+NL  Y 
Sbjct: 299 DTPLARVRSNLAPYF 313


>gi|327188985|gb|EGE56174.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CNPAF512]
          Length = 331

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 191/314 (60%), Positives = 236/314 (75%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  +
Sbjct: 19  RILSEAHFPELPNYYRGKVRENYDLPDGHRIIISTDRLSAFDRILTCIPYKGQVLTQTAR 78

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R++
Sbjct: 79  YWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGEREM 138

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT+ QWET+S YA
Sbjct: 139 YGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPAEIVGRGLLTKEQWETLSRYA 196

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG D   NIILADEIHTPDSSRYW   +Y  SF  G
Sbjct: 197 LALFARGQAMAAERGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAASYPASFAAG 256

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI+AYE ITG +FI D+S  
Sbjct: 257 KRPESFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYISAYEAITGERFIPDDSGE 316

Query: 302 PPLERIRNNLRKYT 315
            PL R+RNNL +Y 
Sbjct: 317 TPLARVRNNLSRYF 330


>gi|325293919|ref|YP_004279783.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
 gi|325061772|gb|ADY65463.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
          Length = 316

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 184/315 (58%), Positives = 243/315 (77%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A IPELPNYY GKVRENY L DG RI I+TDRLSAFD+ + C+PYKG+VL Q  
Sbjct: 1   MRILDEAVIPELPNYYRGKVRENYDLPDGNRIIISTDRLSAFDRILTCVPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV++G++L++ P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEQTKDICPNHVVSYPDPNVVIGKRLEILPVEVVVRGYLAGTTGTSILTLYKKGQRQ 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K+ +   G D+P++P EI+ + +LT+ QW+T+S Y
Sbjct: 121 MYGMSLPDGMKDNQILPEPVITPTSKAFDG--GHDEPLTPAEIVEKKLLTQEQWDTLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF+RG ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ETYE+SF  
Sbjct: 179 ALALFKRGQEIAAKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWMAETYEESFLN 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D++P+IP+ ++L+TS+ YI AYE+ITG  F+ D+S 
Sbjct: 239 GARPASFDKDFVRAWVAERCDPYKDDVPEIPQELVLQTSRVYIDAYERITGQSFVPDDSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+R NL ++ 
Sbjct: 299 ETPLARVRRNLEQFF 313


>gi|209550729|ref|YP_002282646.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536485|gb|ACI56420.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 190/316 (60%), Positives = 235/316 (74%), Gaps = 2/316 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPD NV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDANVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT+ QWET+S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPAEIVSRGLLTKEQWETLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKRGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYIRAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNLRKYTH 316
             PL RIR NL  +  
Sbjct: 299 ETPLARIRQNLAPHFS 314


>gi|15889807|ref|NP_355488.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
 gi|39931997|sp|Q8UCE7|PUR72_AGRT5 RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
 gi|15157737|gb|AAK88273.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
          Length = 316

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 186/315 (59%), Positives = 242/315 (76%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A IPELPNYY GKVRENY L DG RI I+TDRLSAFDQ + CIPYKG+VL Q  
Sbjct: 1   MRILDEAVIPELPNYYRGKVRENYDLPDGNRIIISTDRLSAFDQILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEQTKDICPNHVVSYPDPNVVIGKRLDILPVEVVVRGYLAGTTGTSILTLYKKGERQ 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K+ +   G D+P++P+EI+ + +LT+ QW+T+S Y
Sbjct: 121 MYGMSLPDGMKDNQILPEPVITPTSKAFDG--GHDEPLTPSEIVEKKLLTQEQWDTLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF  G ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ++Y++SFRE
Sbjct: 179 ALALFRHGQEIAAKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWMADSYDESFRE 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D +P IPE+++L+TSQ YI AYE+ITG +F+ D+S 
Sbjct: 239 GKRPASFDKDFVRAWVGERCDPYKDAVPKIPEDLVLQTSQVYIDAYERITGQRFVPDDSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+R NL  + 
Sbjct: 299 ETPLARVRRNLEPFF 313


>gi|241206132|ref|YP_002977228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860022|gb|ACS57689.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 192/315 (60%), Positives = 237/315 (75%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKGEVL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGEVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT  QW+T+S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPTEIVTRGLLTNEQWQTLSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A  NGLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAANNGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFVA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPAELIEQTSAVYIKAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+R NL +Y 
Sbjct: 299 ETPLARVRTNLTRYF 313


>gi|86359001|ref|YP_470893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli CFN 42]
 gi|86283103|gb|ABC92166.1| phosphoribosylaminoimidazole-succinocarboxamide synthase protein
           [Rhizobium etli CFN 42]
          Length = 314

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 193/315 (61%), Positives = 237/315 (75%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGQRE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  +   G D+P++P EI+ RG+LT  QWE++S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSKEFDG--GHDEPLTPAEIVTRGLLTSQQWESLSKY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A   GLILVD+KYEFG D+  NIILADEIHTPDSSRYW  ETY  SF  
Sbjct: 179 ALALFARGQEMATRRGLILVDTKYEFGTDRDGNIILADEIHTPDSSRYWLAETYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ADNS 
Sbjct: 239 GKRPDSFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYIRAYEAITGERFVADNSG 298

Query: 301 LPPLERIRNNLRKYT 315
             PL R+RNNL  + 
Sbjct: 299 ETPLARVRNNLALFF 313


>gi|296532991|ref|ZP_06895643.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
 gi|296266679|gb|EFH12652.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
          Length = 323

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 175/314 (55%), Positives = 230/314 (73%), Gaps = 3/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           +IL  A IPELPN+Y+GKVR+NY L DG RI IATDRLSAFD+ +  +P+KG+VL Q  +
Sbjct: 12  QILRDATIPELPNHYAGKVRDNYDLPDGRRIIIATDRLSAFDRILCAVPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R++
Sbjct: 72  HWFEQTRDICPNHVLDYPDPNVVIGRRLDILPVEIVVRGYLAGTTGTSILTLYKAGQREM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD M DNQKLP  +ITPT+K+ +   G D+P++P EI+ R +LT  QWE ++ YA
Sbjct: 132 YGTRLPDGMRDNQKLPQAIITPTSKAFDG--GHDEPLTPAEILERKLLTPAQWEQLNHYA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLIL D+KYEFG D +  I+LADEIHTPDSSRYW+  +++  F  G
Sbjct: 190 LALFARGQAMAAERGLILADTKYEFGTDAEGKIVLADEIHTPDSSRYWKAASFQARFEAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+R+W+  RC+PYRD IP+IPE++IL T+  YI A+E ITG +F       
Sbjct: 250 EKPESFDKDFVRSWVAARCDPYRDPIPEIPEDLILATAAVYIEAFEMITGQRFELP-PAQ 308

Query: 302 PPLERIRNNLRKYT 315
           P LERIR NL ++ 
Sbjct: 309 PVLERIRANLARFF 322


>gi|170741807|ref|YP_001770462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium sp. 4-46]
 gi|168196081|gb|ACA18028.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylobacterium sp. 4-46]
          Length = 325

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 162/314 (51%), Positives = 219/314 (69%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           + L++A +P+LPNY  GKVR+NY L DG RI I++DR+SAFD+ +A IP KG+VL Q  +
Sbjct: 12  QALAEAVLPDLPNYVRGKVRDNYDLPDGRRILISSDRISAFDRILAAIPLKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T D+C NH L YPDPNV+V ++L + P+E++VRGYLAG T TS+LT Y+ G+R++
Sbjct: 72  FWFEATRDLCPNHVLAYPDPNVVVARRLTILPVEIVVRGYLAGTTATSILTLYRAGQREM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LP+ +  N+KL   ++TPT+K+ E   G D P++P  I+ +G+LT  QW T+S  A
Sbjct: 132 YGHRLPEGLRPNEKLAQAILTPTSKAGEG--GHDAPLTPEAILAQGLLTEAQWRTVSETA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  LA   GLIL D+KYEFG D +  I+LADEIHTPDSSRYW   +Y   F  G
Sbjct: 190 LALFARGQDLAARRGLILADTKYEFGTDAQGRIVLADEIHTPDSSRYWFAGSYPARFAAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+RNW++ RC+PYRD IP IP  +++ T+  Y+ A+E ITG  F   +   
Sbjct: 250 EAPESFDKDFVRNWVVARCDPYRDPIPAIPPEVVMETALVYVRAFETITGQPFALPDPAE 309

Query: 302 PPLERIRNNLRKYT 315
           PPL RIR NLR Y 
Sbjct: 310 PPLARIRRNLRTYL 323


>gi|222084361|ref|YP_002542890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
 gi|221721809|gb|ACM24965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
          Length = 329

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 179/315 (56%), Positives = 237/315 (75%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           +RILS+A+ PELPNYY GKVRENY L DG+RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 16  LRILSEAHFPELPNYYRGKVRENYDLPDGSRIIISTDRLSAFDRILTCIPYKGQVLTQTA 75

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV+VG++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 76  RYWFEATKDICPNHVIAYPDPNVVVGKRLDILPVEVVVRGYLAGTTGTSILTLYKKGQRE 135

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP P+ITPT+K  +   G D+P++P +I+  G+LT  QW+T+S Y
Sbjct: 136 MYGITLPDGMRDNQILPTPIITPTSKEFDG--GHDEPLTPTQIVEGGLLTSEQWQTLSDY 193

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ++Y+ SF +
Sbjct: 194 ALALFARGQEIASKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWLADSYQDSFDK 253

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP +++ +TS+ YI AYE ITG  F+ D+  
Sbjct: 254 GTRPASFDKDFVRAWVAERCDPYKDEIPEIPLDLVEQTSKVYIRAYEAITGKSFVPDDRG 313

Query: 301 LPPLERIRNNLRKYT 315
             P +R+R +L +Y 
Sbjct: 314 ATPRDRVRASLERYF 328


>gi|83311130|ref|YP_421394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
 gi|82945971|dbj|BAE50835.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
          Length = 325

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 158/314 (50%), Positives = 215/314 (68%), Gaps = 2/314 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L++A  PELPNYY GKVRENY L DG RI I+TDR SAFDQ +A +P+KG+VL Q  ++
Sbjct: 14  VLTEAEFPELPNYYRGKVRENYDLPDGRRILISTDRQSAFDQVLAAVPFKGQVLTQTARF 73

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T DIC NH ++YPDPNV+VG++L M PIE++VR YL G+T TS+ + YK G+R +Y
Sbjct: 74  WFEATKDICPNHVIEYPDPNVVVGRRLDMLPIEMVVRDYLTGSTDTSIWSMYKAGRRTMY 133

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D M  N KLP  ++TPTTK+     G D P+SP E++ RG+L++ QW+ ++  +L
Sbjct: 134 GLDFADGMVKNDKLPATILTPTTKADVG--GHDAPVSPAEVVARGLLSQAQWDELARLSL 191

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A  +GLILVD+K+EFG+D    I LADEI TPDSSRYW+ ++Y     +G 
Sbjct: 192 ALFARGREIAARHGLILVDTKFEFGVDADGRITLADEILTPDSSRYWKADSYGARHAKGE 251

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDK+F+R WI  RC+PY   IP IP++ ++  S  YI+ YE +TG  F A ++   
Sbjct: 252 EPESLDKEFLRIWIAARCDPYTQPIPVIPDDTLVEFSAKYISLYETVTGQTFEAPSAAET 311

Query: 303 PLERIRNNLRKYTH 316
             ERIR NL  Y  
Sbjct: 312 VKERIRRNLAPYMS 325


>gi|13472340|ref|NP_103907.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium loti MAFF303099]
 gi|14023086|dbj|BAB49693.1| 5'-phosphoribosyl-4-(N-succinocarboxamide)-5- aminoimidazole
           synthetase [Mesorhizobium loti MAFF303099]
          Length = 337

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 180/315 (57%), Positives = 230/315 (73%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR LS A+IPELP YY GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 25  MRTLSDAFIPELPGYYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 84

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT Y+ G+R+
Sbjct: 85  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYRRGERE 144

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+ +G+LT+ QW+T+S Y
Sbjct: 145 MYGMRLPDGLRDNEKLAAPVITPTSKAADG--GHDEPLSRAEILAQGLLTQAQWDTVSDY 202

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 203 ALKLFARGQARAAERGLILADTKYEFGTDKNGTIILADEIHTPDSSRYWIAASYEQALAS 262

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D IP IP+ I+ + S+ Y  AYE ITG  F+ D S 
Sbjct: 263 GTRPDSFDKDFIRSWVAARCDPYKDPIPRIPDEIVEQASRIYAQAYEAITGKAFVPDLSG 322

Query: 301 LPPLERIRNNLRKYT 315
              L+RIR+NL ++ 
Sbjct: 323 DTVLDRIRSNLVRFF 337


>gi|222106973|ref|YP_002547764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
 gi|221738152|gb|ACM39048.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
          Length = 316

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 185/317 (58%), Positives = 240/317 (75%), Gaps = 2/317 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A+ PELPNYY GKVRENY L DG+RI I+TDRLSAFD+ +ACIPYKG+VL Q  
Sbjct: 1   MRILKEAFFPELPNYYRGKVRENYDLPDGSRIIISTDRLSAFDRILACIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH + YPDP +++G++L + P+E++VRGYLAG T TS+LT YK G+R 
Sbjct: 61  RYWFEQTADICPNHVIAYPDPAIVIGKRLTILPVEVVVRGYLAGTTGTSILTLYKKGQRT 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQKLP  +ITPT+K  +   G D P++P EII  G+LT +QW+ +S Y
Sbjct: 121 MYGMTLPDGMRDNQKLPQAIITPTSKEFDG--GHDAPLTPAEIIDNGLLTPDQWQQLSQY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG + A E GLILVD+KYEFG D+  NI+LADEIHTPDSSRYW  ETYE++F +
Sbjct: 179 ALALFARGQQKAAERGLILVDTKYEFGTDEAGNILLADEIHTPDSSRYWIAETYEQAFAQ 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R+W+  RC+PY+D+IP+IP++++  TS+ YI AYE ITGL F AD+S 
Sbjct: 239 GTRPASFDKDFVRSWVAERCDPYKDDIPEIPQDLVEATSKVYIQAYEAITGLTFQADDSG 298

Query: 301 LPPLERIRNNLRKYTHR 317
             P +R++ NL  Y  R
Sbjct: 299 ETPFDRVKANLFSYLDR 315


>gi|39932001|sp|Q98I23|PUR72_RHILO RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
          Length = 313

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 180/315 (57%), Positives = 230/315 (73%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR LS A+IPELP YY GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 1   MRTLSDAFIPELPGYYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT Y+ G+R+
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYRRGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+ +G+LT+ QW+T+S Y
Sbjct: 121 MYGMRLPDGLRDNEKLAAPVITPTSKAADG--GHDEPLSRAEILAQGLLTQAQWDTVSDY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 179 ALKLFARGQARAAERGLILADTKYEFGTDKNGTIILADEIHTPDSSRYWIAASYEQALAS 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D IP IP+ I+ + S+ Y  AYE ITG  F+ D S 
Sbjct: 239 GTRPDSFDKDFIRSWVAARCDPYKDPIPRIPDEIVEQASRIYAQAYEAITGKAFVPDLSG 298

Query: 301 LPPLERIRNNLRKYT 315
              L+RIR+NL ++ 
Sbjct: 299 DTVLDRIRSNLVRFF 313


>gi|16127472|ref|NP_422036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|221236286|ref|YP_002518723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
 gi|39932002|sp|Q9A3G2|PUR72_CAUCR RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
 gi|13424928|gb|AAK25204.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|220965459|gb|ACL96815.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
          Length = 320

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 160/314 (50%), Positives = 224/314 (71%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             L+   +P LPN+Y GKVR+NY L DG R+ +A+DRLSAFD+N+  +P KG+VL +  +
Sbjct: 7   NALAVVDLPCLPNHYRGKVRDNYDLPDGRRVIVASDRLSAFDRNLCAVPGKGQVLTETAR 66

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH + YPDPNVL+G++L+M P+EL+VRGYLAG T TS+LT Y  G+R++
Sbjct: 67  FWFDATADICPNHVVAYPDPNVLIGKRLKMLPVELVVRGYLAGTTSTSILTLYNKGERQM 126

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD +  NQ+LP  ++TPT+K+++     D P+SP+E++ +G++T  QWE +S+YA
Sbjct: 127 YGVTLPDGLKANQRLPQAILTPTSKAADG--DHDAPLSPDEVLAQGLVTPAQWEQLSAYA 184

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLIL D+KYEFG+D+   I+LADEIHTPDSSR+W+  TYE  F  G
Sbjct: 185 LALFARGQAMAAERGLILADTKYEFGLDETGAIVLADEIHTPDSSRFWKAATYEARFEAG 244

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+R W+  RC+PY D+IP+IP  +I + S  YI A+E ITG  F A ++  
Sbjct: 245 QRPESFDKDFVRAWVAERCDPYNDSIPEIPAELIAQASAVYIEAFEAITGQTFAAPDASE 304

Query: 302 PPLERIRNNLRKYT 315
           P + R++ NL  Y 
Sbjct: 305 PVMARVKRNLDAYL 318


>gi|83855066|ref|ZP_00948596.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
 gi|83842909|gb|EAP82076.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
          Length = 319

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 170/315 (53%), Positives = 226/315 (71%), Gaps = 2/315 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R L  A I ELPN Y GKVR+ Y L D  RI I++DR+SAFD+ +  IP+KG+VL Q  +
Sbjct: 6   RTLDHARIDELPNPYFGKVRDCYDLPDDRRILISSDRISAFDRILTSIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF +TSDIC NH LDYPDPNV++G+ L + P+E++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDNTSDICPNHVLDYPDPNVVIGKHLTILPVEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DNQ LP P+ITPT+K  +   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNQALPAPIITPTSKEFDG--GHDAPLTAQEIVDQGLLTQAQWDQISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D + NI+LADEIHTPDSSR+W  E Y+ +   G
Sbjct: 184 LKLFARGQEMAAKNGLILVDTKYEFGTDAQGNILLADEIHTPDSSRFWLAEGYDAALENG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI AYE ITG +F+ D    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYHDDIPEIPADLIAATSQVYIDAYEAITGQRFVPDLEGD 303

Query: 302 PPLERIRNNLRKYTH 316
             L+R+R+NLR Y  
Sbjct: 304 TVLDRVRHNLRPYFT 318


>gi|288962273|ref|YP_003452568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
 gi|288914539|dbj|BAI76024.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
          Length = 330

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 164/320 (51%), Positives = 223/320 (69%), Gaps = 6/320 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDG----TRITIATDRLSAFDQNIACIPYKGEVLN 57
            +L  A+IPELPN+Y GKVRENY L D      RI I TDRLSAFD+ +  IP+KG+VL 
Sbjct: 13  NVLRDAFIPELPNHYRGKVRENYDLPDQGDGARRILITTDRLSAFDRILTAIPFKGQVLT 72

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           Q  ++WF  T DIC+NH L+YPDPNV+V ++L + P+E++VR Y+AG T TS+ + YK G
Sbjct: 73  QTARFWFEATKDICANHVLEYPDPNVVVAKRLTIMPVEIVVRDYMAGTTGTSIWSMYKQG 132

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R++Y ++ PD +  NQKL  P+ITPTTK+    +G D+ ++  EI+ R +LT  QW+ +
Sbjct: 133 RREMYGHVFPDGLRQNQKLDAPIITPTTKAF--DAGHDEELTATEIVGRNLLTSAQWDEV 190

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  AL+LF RG K+A E GLILVD+KYEFG D   NI+LADEIHTPDSSRYW   +Y++ 
Sbjct: 191 SEKALALFARGQKMAAERGLILVDTKYEFGFDADGNILLADEIHTPDSSRYWFAGSYQER 250

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIAD 297
           F  G  P   DKDF+RNW++ RC+PY  +IP+IP +++L  ++ YI A E ITG  F   
Sbjct: 251 FESGGKPESFDKDFVRNWVVARCDPYTQDIPEIPGDVVLEAARVYIEAGETITGRPFEVP 310

Query: 298 NSELPPLERIRNNLRKYTHR 317
            + +P L+RIR NL  Y  +
Sbjct: 311 ATAVPVLDRIRANLAPYFSK 330


>gi|319781936|ref|YP_004141412.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167824|gb|ADV11362.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 313

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 178/315 (56%), Positives = 227/315 (72%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR L  A+IPELP +YSGKVRENY L+DG RI IATDRLSAFD  +  IPYKGE+L Q  
Sbjct: 1   MRTLPDAFIPELPGHYSGKVRENYDLADGRRIIIATDRLSAFDIILTSIPYKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT YK G R 
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYKRGDRD 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN++L  P+ITPT+K++    G D+P+S  EI+ +G+LT+ QW+ +S Y
Sbjct: 121 MYGIRLPDGLRDNERLAEPIITPTSKAAHG--GHDEPLSKAEILEQGLLTQAQWDIVSGY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG + A E GLIL D+KYEFG D+   IILADEIHTPDSSRYW   +YE++  +
Sbjct: 179 ALRLFARGQQRATERGLILADTKYEFGTDRNGTIILADEIHTPDSSRYWIASSYEQALAD 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R+W+  RCNPY D +P+IP  I+ + S+ Y  AYE ITG +F  D S 
Sbjct: 239 GCRPESFDKDFVRSWVSARCNPYSDPVPEIPAEIVEQASRVYAQAYEAITGKEFSPDLSG 298

Query: 301 LPPLERIRNNLRKYT 315
              L+RIR NLR+Y 
Sbjct: 299 DSVLDRIRTNLRRYF 313


>gi|83941590|ref|ZP_00954052.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
 gi|83847410|gb|EAP85285.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
          Length = 319

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 226/315 (71%), Gaps = 2/315 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R L  A I ELPN Y GKVR+ Y L D  RI I++DR+SAFD+ +  IP+KG+VL Q  +
Sbjct: 6   RTLDHARIDELPNPYFGKVRDCYDLPDDRRILISSDRISAFDRILTSIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF +TSDIC NH LDYPDPNV++G+ L + P+E++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDNTSDICPNHVLDYPDPNVVIGKHLTILPVEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DNQ LP P+ITPT+K  +   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNQALPAPIITPTSKEFDG--GHDAPLTAQEIVDQGLLTQAQWDQISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D + NI+LADEIHTPDSSR+W  + Y+ +   G
Sbjct: 184 LKLFARGQEMAAKNGLILVDTKYEFGTDAQGNILLADEIHTPDSSRFWLADGYDAALDNG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI A+E ITG +F+ D    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYHDDIPEIPADLIAATSQVYIDAFEAITGQRFVPDLEGD 303

Query: 302 PPLERIRNNLRKYTH 316
             L+R+R+NLR Y  
Sbjct: 304 TVLDRVRHNLRPYFT 318


>gi|163793460|ref|ZP_02187435.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [alpha proteobacterium BAL199]
 gi|159181262|gb|EDP65777.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [alpha proteobacterium BAL199]
          Length = 323

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 170/314 (54%), Positives = 230/314 (73%), Gaps = 2/314 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L  A IPELPN+Y GKVR+NY L DG RI IA+DRLSAFD ++A IP+KGEVL +  +
Sbjct: 12  RVLQDATIPELPNHYRGKVRDNYDLPDGRRIIIASDRLSAFDISLASIPFKGEVLTRTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T DIC NH L+YPDPNV++GQ+L++ P+E++VR YLAG T TS+LT YK G+R +
Sbjct: 72  FWFEATHDICPNHVLEYPDPNVVIGQRLEILPVEMVVRDYLAGTTGTSILTMYKAGRRDM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD++ DN KLP  +ITPT+K++      D+P++P++I+ +G+LT  QW T+S YA
Sbjct: 132 YGVRLPDDLRDNAKLPQTIITPTSKAALG--SHDEPLTPDDIVGKGLLTAEQWRTVSDYA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG ++A E GLILVD+KYEFG D    I+LADEIHTPDSSRYW +++Y+     G
Sbjct: 190 LALFARGREMARERGLILVDTKYEFGTDADGRIVLADEIHTPDSSRYWFLDSYQDRVDRG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+RNW++ RCNPY+D IP IP+ ++L+T++ YI A+E ITG  F       
Sbjct: 250 EKPESFDKDFMRNWVVARCNPYKDAIPPIPDEVVLQTAEVYIRAFETITGQPFEIPAMTG 309

Query: 302 PPLERIRNNLRKYT 315
             L+RIR NL ++ 
Sbjct: 310 SVLDRIRRNLARHF 323


>gi|23013287|ref|ZP_00053200.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 325

 Score =  302 bits (773), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 158/313 (50%), Positives = 217/313 (69%), Gaps = 2/313 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L++A  PELPNYY GKVRENY L DG RI I+TDR SAFDQ +A +P+KG+VL Q  ++
Sbjct: 14  VLTEAEFPELPNYYRGKVRENYDLPDGRRILISTDRQSAFDQVLAAVPFKGQVLTQTARF 73

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T DIC NH ++YPDPNV+VG++L M PIE++VR YL G+T TS+ + YK G+R +Y
Sbjct: 74  WFEATKDICPNHVIEYPDPNVVVGKRLDMLPIEMVVRDYLTGSTDTSIWSMYKAGRRNMY 133

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D M  N KLP  ++TPTTK+     G D PISP +++ RG+LT+ QW+ ++  +L
Sbjct: 134 GLDFADGMVKNDKLPLTILTPTTKADVG--GHDAPISPADVVARGLLTQAQWDELARLSL 191

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A ++GLILVD+K+EFG+D +  I LADEI TPDSSRYW+ ++Y        
Sbjct: 192 ALFARGREIAAKHGLILVDTKFEFGVDGQGRITLADEILTPDSSRYWKADSYAGRHARAE 251

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDK+F+R WI  RC+PY   IP IP++ ++  S  YI+ +E +TGL F A +S   
Sbjct: 252 EPESLDKEFLRIWIAARCDPYTQPIPVIPDDTLVEFSAKYISLFETVTGLPFEAPSSAET 311

Query: 303 PLERIRNNLRKYT 315
             +RIR NL +Y 
Sbjct: 312 VKDRIRRNLARYL 324


>gi|260467484|ref|ZP_05813653.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
 gi|259028766|gb|EEW30073.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
          Length = 313

 Score =  302 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 180/315 (57%), Positives = 229/315 (72%), Gaps = 2/315 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS A+IPELP +Y GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 1   MRILSDAFIPELPGHYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT YK G+R 
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYKRGERD 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+  G+LT  QW+T+S Y
Sbjct: 121 MYGMRLPDGLRDNEKLAEPVITPTSKAADG--GHDEPLSKTEILDHGLLTEPQWDTVSGY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 179 ALKLFARGQARAAERGLILADTKYEFGTDKDGTIILADEIHTPDSSRYWIARSYEQALAN 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D +P IP+ I+ + S+ Y  AY+ ITG +F+ D S 
Sbjct: 239 GTRPESFDKDFIRSWVAARCDPYKDTVPKIPDEIVEQASKVYAQAYQAITGKEFLPDVSG 298

Query: 301 LPPLERIRNNLRKYT 315
              L+RIR+NL +Y 
Sbjct: 299 ETVLDRIRSNLARYF 313


>gi|52841903|ref|YP_095702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52629014|gb|AAU27755.1| phosphoribosylimidazole-succinocarboxamide synthase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 331

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 142/313 (45%), Positives = 204/313 (65%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P     Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +W
Sbjct: 24  LTETSLP-FGKKYKGKVRDTYDLGDQ-LILVTTDRQSAFDRCLAAVPYKGQVLNLTSAWW 81

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F +T  I  NH +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+   
Sbjct: 82  FKNTQSIVPNHLIAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCG 141

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  NQKL  PVITPTTK     +  D+PISP+EI+  G +T+  W+  SSYAL 
Sbjct: 142 ITFPDGLRKNQKLESPVITPTTK----ETLHDRPISPHEIVAEGWMTQEDWDETSSYALK 197

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+ G ++A ++GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  
Sbjct: 198 LFQHGMEVAQQHGLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKE 257

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P
Sbjct: 258 PENIDKEFLRLWFVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGP 317

Query: 303 PLERIRNNLRKYT 315
             +RI +N++++ 
Sbjct: 318 VNDRILHNIQRWL 330


>gi|270294356|ref|ZP_06200558.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D20]
 gi|270275823|gb|EFA21683.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D20]
          Length = 313

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 130/321 (40%), Positives = 189/321 (58%), Gaps = 13/321 (4%)

Query: 1   MRILS--KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+  +   P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTATEFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAQGLATPEEYAVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EQYTMALFKRGTEIAAERGLILVDTKYEFGK-HDGKIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F  G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 234 FANGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTH 316
            +++     ERI  N+ +Y  
Sbjct: 294 KEDTG-NIAERIEKNVTEYLK 313


>gi|160891018|ref|ZP_02072021.1| hypothetical protein BACUNI_03465 [Bacteroides uniformis ATCC 8492]
 gi|317480962|ref|ZP_07940042.1| saicar synthetase [Bacteroides sp. 4_1_36]
 gi|156859239|gb|EDO52670.1| hypothetical protein BACUNI_03465 [Bacteroides uniformis ATCC 8492]
 gi|316902855|gb|EFV24729.1| saicar synthetase [Bacteroides sp. 4_1_36]
          Length = 313

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 130/321 (40%), Positives = 189/321 (58%), Gaps = 13/321 (4%)

Query: 1   MRILS--KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+  +   P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTATEFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAQGLATPEEYAVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EQYTMALFKRGTEIAAERGLILVDTKYEFGK-HDGKIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F  G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 234 FANGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTH 316
            +++     ERI  N+ +Y  
Sbjct: 294 KEDTS-NIAERIEKNVTEYLK 313


>gi|148359212|ref|YP_001250419.1| phosphoribosylimidazole-succinocarboxamidesynthase [Legionella
           pneumophila str. Corby]
 gi|296107256|ref|YP_003618956.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 2300/99 Alcoy]
 gi|148280985|gb|ABQ55073.1| phosphoribosylimidazole-succinocarboxamidesynthase [Legionella
           pneumophila str. Corby]
 gi|295649157|gb|ADG25004.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 326

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 142/313 (45%), Positives = 204/313 (65%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P     Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +W
Sbjct: 19  LTETSLP-FGKKYKGKVRDTYDLGDQ-LILVTTDRQSAFDRCLAAVPYKGQVLNLTSAWW 76

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F +T  I  NH +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+   
Sbjct: 77  FKNTQSIVPNHLIAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCG 136

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  NQKL  PVITPTTK     +  D+PISP+EI+  G +T+  W+  SSYAL 
Sbjct: 137 ITFPDGLRKNQKLESPVITPTTK----ETLHDRPISPHEIVAEGWMTQEDWDETSSYALK 192

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+ G ++A ++GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  
Sbjct: 193 LFQHGMEVAQQHGLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKE 252

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P
Sbjct: 253 PENIDKEFLRLWFVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGP 312

Query: 303 PLERIRNNLRKYT 315
             +RI +N++++ 
Sbjct: 313 VNDRILHNIQRWL 325


>gi|329965267|ref|ZP_08302197.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides fluxus YIT 12057]
 gi|328523287|gb|EGF50387.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides fluxus YIT 12057]
          Length = 314

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILS--KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+  +   P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTATEFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKIATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EKYTMALFNRGSEIAAERGLILVDTKYEFGK-HDGKIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KFI
Sbjct: 234 FAKGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVNSISERYIELYEHITGEKFI 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + ++
Sbjct: 294 KEDTS-NIAERIGKNVEAFLNK 314


>gi|260575349|ref|ZP_05843349.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
 gi|259022609|gb|EEW25905.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
          Length = 325

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 164/322 (50%), Positives = 225/322 (69%), Gaps = 7/322 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSD-----GTRITIATDRLSAFDQNIACIPYKGEVL 56
           R+L  A+I ELPN Y GKVR+ Y L         RI I++DR+SAFD+ +A IP+KG+VL
Sbjct: 6   RVLDHAHIAELPNPYYGKVRDCYDLPADATHGPRRILISSDRISAFDRILAAIPWKGQVL 65

Query: 57  NQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
            Q+ ++WF  T+DIC NH L YPDPNV++G+ L + P+E++VRGYLAG T TS+LT YK 
Sbjct: 66  TQVARFWFDRTADICPNHVLSYPDPNVVIGEHLTILPVEIVVRGYLAGTTGTSVLTLYKQ 125

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G R++Y + LPD + DNQ LP P+ITPT+K+ +   G D+P++  EI+ +G+LT+ QW+ 
Sbjct: 126 GARQMYGHSLPDGLRDNQALPAPIITPTSKAFDG--GHDEPLTATEIVAQGLLTQAQWDE 183

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +++ +L+LF RG ++A + GLILVD+KYEFG D    I LADEIHTPDSSRYW    Y +
Sbjct: 184 VAAVSLALFARGQQIAAKRGLILVDTKYEFGTDAAGTIKLADEIHTPDSSRYWIASGYAE 243

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           +F  G  P   DKD IR+W+  RC+PY D IP+IP  +I  T+Q YI AY+ ITG  F+ 
Sbjct: 244 AFANGSRPPSFDKDVIRSWVAARCDPYHDPIPEIPAEMIAATAQVYIDAYQAITGQTFVP 303

Query: 297 DNSELPPLERIRNNLRKYTHRH 318
           D+S   PL+R+R NL  Y  + 
Sbjct: 304 DSSGATPLDRVRANLAPYFTKA 325


>gi|307610376|emb|CBW99945.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 130b]
          Length = 326

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 141/313 (45%), Positives = 205/313 (65%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P     Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +W
Sbjct: 19  LTETSLP-FGKKYKGKVRDTYDLGDQ-LILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWW 76

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F +T  I  NH +  PDPNV + ++ ++FP+E +VRGY++G+T TSL T Y+ G R+   
Sbjct: 77  FKNTQSIVPNHLIAVPDPNVAIAKKCKIFPVEFVVRGYISGSTSTSLWTQYQKGVREYCG 136

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  NQKL  PVITPTTK     +  D+PISP+EI+  G +T+  W+  SSYAL 
Sbjct: 137 ITFPDGLRKNQKLESPVITPTTK----ETIHDRPISPHEIVAEGWMTQEDWDETSSYALR 192

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+ G ++A ++GLILVD+KYEFG D +  I+L DEIHTPDSSRYW   +Y++ F  G  
Sbjct: 193 LFQHGMEVAQQHGLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNSYQERFDAGKE 252

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P
Sbjct: 253 PENIDKEFLRLWFVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGP 312

Query: 303 PLERIRNNLRKYT 315
             +RI +N++++ 
Sbjct: 313 VNDRILHNIQRWL 325


>gi|329957124|ref|ZP_08297691.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides clarus YIT 12056]
 gi|328523392|gb|EGF50491.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides clarus YIT 12056]
          Length = 314

 Score =  299 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+      P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTATDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EKYTMALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 234 FAKGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+ +Y  +
Sbjct: 294 KEDTS-NIAERIEKNVTEYLKK 314


>gi|218129342|ref|ZP_03458146.1| hypothetical protein BACEGG_00919 [Bacteroides eggerthii DSM 20697]
 gi|317475311|ref|ZP_07934577.1| saicar synthetase [Bacteroides eggerthii 1_2_48FAA]
 gi|217988519|gb|EEC54840.1| hypothetical protein BACEGG_00919 [Bacteroides eggerthii DSM 20697]
 gi|316908565|gb|EFV30253.1| saicar synthetase [Bacteroides eggerthii 1_2_48FAA]
          Length = 314

 Score =  299 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+      P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTATDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EKYTMALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 234 FAKGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+ +Y  +
Sbjct: 294 KEDTS-NIAERIEKNVTEYLKK 314


>gi|54297596|ref|YP_123965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Paris]
 gi|81370473|sp|Q5X4M9|PUR7_LEGPA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53751381|emb|CAH12799.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Paris]
          Length = 312

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 142/313 (45%), Positives = 204/313 (65%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P     Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +W
Sbjct: 5   LTETSLP-FGKKYKGKVRDTYDLGDQ-LILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWW 62

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F +T  I  NH +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+   
Sbjct: 63  FKNTQSIVPNHLIAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCG 122

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  NQKL  PVITPTTK     +  D+PISP+EI+  G +T+  W+  SSYAL 
Sbjct: 123 ITFPDGLRKNQKLESPVITPTTK----ETLHDRPISPHEIVAEGWMTQEDWDETSSYALK 178

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+ G ++A ++GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  
Sbjct: 179 LFQHGMEVAQQHGLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKE 238

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P
Sbjct: 239 PENIDKEFLRLWFVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGP 298

Query: 303 PLERIRNNLRKYT 315
             +RI +N++++ 
Sbjct: 299 VNDRILHNIQRWL 311


>gi|54294564|ref|YP_126979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Lens]
 gi|81368528|sp|Q5WW20|PUR7_LEGPL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53754396|emb|CAH15880.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Lens]
          Length = 312

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 141/313 (45%), Positives = 203/313 (64%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P     Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +W
Sbjct: 5   LTETSLP-FGKKYKGKVRDTYDLGDQ-LILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWW 62

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F +T  I  NH +  PDPNV + ++ ++FP+E +VRGY++G+T TSL T Y+ G R+   
Sbjct: 63  FKNTQSIVPNHLIAVPDPNVAIAKKCKIFPVEFVVRGYISGSTSTSLWTQYQKGVREYCG 122

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  NQKL  PVITPTTK     +  D+PISP+EI+  G +T+  W+  SSYAL 
Sbjct: 123 ITFPDGLRKNQKLESPVITPTTK----ETIHDRPISPHEIVAEGWMTQEDWDETSSYALR 178

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+ G ++A ++GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  
Sbjct: 179 LFQHGMEVAQQHGLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKE 238

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P
Sbjct: 239 PENIDKEFLRLWFVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGP 298

Query: 303 PLERIRNNLRKYT 315
             +RI +N++ + 
Sbjct: 299 VNDRILHNIQHWL 311


>gi|255007730|ref|ZP_05279856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
 gi|313145430|ref|ZP_07807623.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
 gi|313134197|gb|EFR51557.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
          Length = 313

 Score =  298 bits (762), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 129/321 (40%), Positives = 190/321 (59%), Gaps = 13/321 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEQLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKVATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++ T+
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIVTPTTKAEMG--LHDEDISKEEILAQGLATPEEYATL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYADGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S+ YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVESISERYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTH 316
            +++     ERI  N+  +  
Sbjct: 294 KEDTS-NIAERIEKNVMAFLK 313


>gi|254487363|ref|ZP_05100568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
 gi|214044232|gb|EEB84870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
          Length = 319

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 166/316 (52%), Positives = 223/316 (70%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RIL  A I ELPN Y GKVR+ Y L DG RI I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RILDHARIDELPNPYFGKVRDCYDLPDGRRILISSDRISAFDRILASIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF HT+DIC NH LDYPDPNV++G++L + PIE++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDHTTDICPNHVLDYPDPNVVIGKRLDILPIEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DN+ LP  +ITPT+K  +   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNEALPQAIITPTSKEFDG--GHDAPLTATEIVEQGLLTQAQWDEISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D    ++LADEIHTPDSSR+W  + Y+ +   G
Sbjct: 184 LRLFARGQEMAAQNGLILVDTKYEFGTDADGKLMLADEIHTPDSSRFWLADGYQSALENG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI AY+ ITG  F  +    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYVDDIPEIPADLIAATSQVYIDAYQAITGQIFEPNMDGD 303

Query: 302 PPLERIRNNLRKYTHR 317
             L+R+R NL  Y   
Sbjct: 304 TVLDRVRANLAPYFTT 319


>gi|53712211|ref|YP_098203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis YCH46]
 gi|60680391|ref|YP_210535.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis NCTC 9343]
 gi|253563750|ref|ZP_04841207.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_2_5]
 gi|265765544|ref|ZP_06093819.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_16]
 gi|81316539|sp|Q5LH03|PUR7_BACFN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81383425|sp|Q64XV7|PUR7_BACFR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|52215076|dbj|BAD47669.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis YCH46]
 gi|60491825|emb|CAH06583.1| putative succinoaminoimidazolecarboximide ribonucleotide (SAICAR)
           synthetase [Bacteroides fragilis NCTC 9343]
 gi|251947526|gb|EES87808.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_2_5]
 gi|263254928|gb|EEZ26362.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_16]
 gi|301161925|emb|CBW21469.1| putative succinoaminoimidazolecarboximide ribonucleotide (SAICAR)
           synthetase [Bacteroides fragilis 638R]
          Length = 314

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 131/322 (40%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEQLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G+        YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIVTPTTKAEMG--LHDEDISKEEILAQGLATPEEYAIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S+ YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVESISERYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  +  +
Sbjct: 294 KEDTS-NIAERIEKNVMAFLAK 314


>gi|153807538|ref|ZP_01960206.1| hypothetical protein BACCAC_01818 [Bacteroides caccae ATCC 43185]
 gi|149129900|gb|EDM21112.1| hypothetical protein BACCAC_01818 [Bacteroides caccae ATCC 43185]
          Length = 314

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 133/322 (41%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMG--LHDEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  +  +
Sbjct: 294 KEDTS-NIAERIEKNVMDFLTK 314


>gi|189467978|ref|ZP_03016763.1| hypothetical protein BACINT_04372 [Bacteroides intestinalis DSM
           17393]
 gi|189436242|gb|EDV05227.1| hypothetical protein BACINT_04372 [Bacteroides intestinalis DSM
           17393]
          Length = 314

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 189/322 (58%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N     PDP V VG   + FPIE+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKTATPDPMVTVGVMCEGFPIEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTMALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +    +P++ + I+   S+ YI  YE ITG +F+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMDNSFQGKAGQQVPEMTDEIVASISERYIELYEHITGEQFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++      RI  N+ +Y ++
Sbjct: 294 KEDTS-NIASRIEKNVTEYLNK 314


>gi|29349625|ref|NP_813128.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570006|ref|ZP_04847415.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 1_1_6]
 gi|298383886|ref|ZP_06993447.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 1_1_14]
 gi|39931940|sp|Q8A004|PUR7_BACTN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|29341535|gb|AAO79322.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840387|gb|EES68469.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 1_1_6]
 gi|298263490|gb|EFI06353.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 1_1_14]
          Length = 314

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 131/322 (40%), Positives = 192/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+   +    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCGSAWRT----YKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N+K P P++TPTTK+       D+ IS  EI+ +G+ T  ++ET+
Sbjct: 117 VREICGVKLPDGMRENEKFPEPIVTPTTKAEMG--LHDEDISKEEILKQGLATPEEYETL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSDGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  +  +
Sbjct: 294 KEDTS-NIAERIEKNVMNFLSK 314


>gi|224538322|ref|ZP_03678861.1| hypothetical protein BACCELL_03213 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520065|gb|EEF89170.1| hypothetical protein BACCELL_03213 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 329

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 190/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 16  MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 75

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N     PDP V VG   + FPIE+IVRGYL G+   +    YK+G
Sbjct: 76  QIAAKFLDATTDICPNWKTATPDPMVTVGVMCEGFPIEMIVRGYLCGSAWRT----YKSG 131

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 132 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAIL 189

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 190 EKYTMALFNRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYQER 248

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG +F+
Sbjct: 249 FEKGEAQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVASISERYIELYEHITGEQFV 308

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++      RI  N+ +Y ++
Sbjct: 309 KEDTS-NIASRIEKNVTEYLNK 329


>gi|160887054|ref|ZP_02068057.1| hypothetical protein BACOVA_05068 [Bacteroides ovatus ATCC 8483]
 gi|237721325|ref|ZP_04551806.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_2_4]
 gi|260171634|ref|ZP_05758046.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
 gi|293369407|ref|ZP_06615992.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CMC 3f]
 gi|299148553|ref|ZP_07041615.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_23]
 gi|315919948|ref|ZP_07916188.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
 gi|156107465|gb|EDO09210.1| hypothetical protein BACOVA_05068 [Bacteroides ovatus ATCC 8483]
 gi|229449121|gb|EEO54912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_2_4]
 gi|292635574|gb|EFF54081.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CMC 3f]
 gi|298513314|gb|EFI37201.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_23]
 gi|313693823|gb|EFS30658.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
          Length = 314

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 132/322 (40%), Positives = 191/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+   +    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCGSAWRT----YKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMG--LHDEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + + 
Sbjct: 294 KEDTS-NIAERIFKNVETFLNS 314


>gi|255693614|ref|ZP_05417289.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides finegoldii DSM 17565]
 gi|260620590|gb|EEX43461.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides finegoldii DSM 17565]
          Length = 314

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 132/322 (40%), Positives = 189/322 (58%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N+K P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENEKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  +   
Sbjct: 294 KEDTS-NIAERIEKNVMNFLTE 314


>gi|258647802|ref|ZP_05735271.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           tannerae ATCC 51259]
 gi|260851616|gb|EEX71485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           tannerae ATCC 51259]
          Length = 314

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 132/322 (40%), Positives = 189/322 (58%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L+K     P     Y+GKVR+ Y +     I +A+DR+SAFD  +   IP+KG+VLN
Sbjct: 1   MATLTKTTYQFPGQIGVYNGKVRDVYSIEGDKLIMVASDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G+        YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGITCKGFPVEMIVRGYLCGSAW----RAYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N+K P P++TPTTK+       D  IS  EI+ +G  T  ++  +
Sbjct: 117 VREICGIKLPDGMRENEKFPEPIVTPTTKAEIGE--HDAEISKEEILAQGFATPEEYALL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L LF+RG ++A + GLILVD+KYEFG+     I L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EKYTLQLFKRGTEIAAQRGLILVDTKYEFGL-HDGKIYLMDEIHTPDSSRYFYSDGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S  YI  YE ITG KF+
Sbjct: 234 FEKGEPQRQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVKSISDRYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
           A++S+    ERI  N+ ++  +
Sbjct: 294 AEDSDK-LEERIERNVLQFLQQ 314


>gi|237711193|ref|ZP_04541674.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 9_1_42FAA]
 gi|237727558|ref|ZP_04558039.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D4]
 gi|265750785|ref|ZP_06086848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_33FAA]
 gi|229434414|gb|EEO44491.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides dorei 5_1_36/D4]
 gi|229455037|gb|EEO60758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 9_1_42FAA]
 gi|263237681|gb|EEZ23131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_33FAA]
          Length = 314

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 188/315 (59%), Gaps = 11/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 8   TDFNFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG   Q FP+E+IVRGYL G+        YKNG R+I  
Sbjct: 68  LDATTDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKNGVREICG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+
Sbjct: 124 VQLPEGMKENQKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEILEKYTLA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G  
Sbjct: 182 LFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEP 240

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E 
Sbjct: 241 QKQLSKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE- 299

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+ +Y  
Sbjct: 300 NIAARIEKNVTEYLK 314


>gi|237715536|ref|ZP_04546017.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D1]
 gi|262408544|ref|ZP_06085090.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_22]
 gi|294646495|ref|ZP_06724132.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CC 2a]
 gi|294807523|ref|ZP_06766320.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides xylanisolvens SD CC 1b]
 gi|298482191|ref|ZP_07000379.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. D22]
 gi|229444245|gb|EEO50036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D1]
 gi|262353409|gb|EEZ02503.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_22]
 gi|292638114|gb|EFF56495.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CC 2a]
 gi|294445224|gb|EFG13894.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides xylanisolvens SD CC 1b]
 gi|298271748|gb|EFI13321.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. D22]
          Length = 314

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 133/322 (41%), Positives = 191/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMG--LHDEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + +R
Sbjct: 294 KEDT-TNIAERIFKNVETFLNR 314


>gi|319901279|ref|YP_004161007.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides helcogenes P 36-108]
 gi|319416310|gb|ADV43421.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides helcogenes P 36-108]
          Length = 315

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 131/321 (40%), Positives = 188/321 (58%), Gaps = 13/321 (4%)

Query: 1   MRILS--KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+  +   P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 3   MKALTATEFNFPGQQSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 62

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK G
Sbjct: 63  QIAAKFLDATTDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKGG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++ T+
Sbjct: 119 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYATL 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 177 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYEER 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +    +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 236 FLKGEPQKQLSKEFVREWLMDNGFQGQAGQQVPEMTDEIVTGISERYIELYEHITGEKFV 295

Query: 296 ADNSELPPLERIRNNLRKYTH 316
            +++      RI  N+ +Y  
Sbjct: 296 KEDTS-NITARIEKNVTEYLK 315


>gi|302854742|ref|XP_002958876.1| hypothetical protein VOLCADRAFT_84670 [Volvox carteri f.
           nagariensis]
 gi|300255778|gb|EFJ40064.1| hypothetical protein VOLCADRAFT_84670 [Volvox carteri f.
           nagariensis]
          Length = 368

 Score =  294 bits (753), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 138/313 (44%), Positives = 193/313 (61%), Gaps = 7/313 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             L+   +P LPN   GKVR+ Y L D   + + TDR SAFD+ +A +P+KG+VLNQ   
Sbjct: 58  NCLTATDLP-LPNRRQGKVRDTYDLGD-RVVIVTTDRQSAFDRLLASVPFKGQVLNQTAA 115

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  TS I  +  L  PDPNV V ++ ++FP+E + RG++ G+T TSL T YK G R+ 
Sbjct: 116 WWFSATSHIVPSALLTLPDPNVAVMKKCRVFPVEFVCRGFMTGSTDTSLWTHYKAGARQY 175

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
                PD M  N +L   VITPTTK+       D PISP EI+ +G++T+ +W+T+S+ A
Sbjct: 176 CGNSFPDGMRKNDRLVANVITPTTKAE----DHDVPISPKEIVEQGLMTQEEWDTVSAAA 231

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L +F+ G + A   GL+LVD+KYEFG D    I + DE+HTPDSSRYW  +TY      G
Sbjct: 232 LRIFQFGQEEAARRGLLLVDTKYEFGKDADGTIRIIDEVHTPDSSRYWLADTYAARHAAG 291

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W   RC+PY+D + P+ P  ++   S+ Y+  YE+ITG  F   +  
Sbjct: 292 LEPENIDKEFLRLWFRQRCDPYKDAVLPEAPAELVCELSKRYVYLYERITGQPFQVPDLA 351

Query: 301 LPPLERIRNNLRK 313
            P  ERI  NLRK
Sbjct: 352 TPVNERIVANLRK 364


>gi|150005078|ref|YP_001299822.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides vulgatus ATCC 8482]
 gi|149933502|gb|ABR40200.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides vulgatus ATCC 8482]
          Length = 314

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 188/315 (59%), Gaps = 11/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 8   TDFNFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG   Q FP+E+IVRGYL G+        YKNG R+I  
Sbjct: 68  LDATTDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKNGVREICG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+
Sbjct: 124 VKLPEGMKENQKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEILEKYTLA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G  
Sbjct: 182 LFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEP 240

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E 
Sbjct: 241 QKQLSKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE- 299

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+ +Y  
Sbjct: 300 NIAARIEKNVTEYLK 314


>gi|167765214|ref|ZP_02437327.1| hypothetical protein BACSTE_03602 [Bacteroides stercoris ATCC
           43183]
 gi|167696842|gb|EDS13421.1| hypothetical protein BACSTE_03602 [Bacteroides stercoris ATCC
           43183]
          Length = 313

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 129/321 (40%), Positives = 186/321 (57%), Gaps = 13/321 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L+      P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MNALTATDFNFPGQQSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N     PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKTATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGE--HDADISKEEILAKGLATPEEYAIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E  LILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EKYTMALFKRGTEIAAERDLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYSEGYEER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+
Sbjct: 234 FAKGEPQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTH 316
            +++     ERI  N+ +Y  
Sbjct: 294 KEDTS-NIAERIEKNVTEYLK 313


>gi|254883212|ref|ZP_05255922.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 4_3_47FAA]
 gi|319642586|ref|ZP_07997233.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_40A]
 gi|254836005|gb|EET16314.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 4_3_47FAA]
 gi|317385820|gb|EFV66752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_40A]
          Length = 314

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 188/315 (59%), Gaps = 11/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 8   TDFNFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG   Q FP+E+IVRGYL G+        YKNG R+I  
Sbjct: 68  LDATTDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKNGVREICG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+
Sbjct: 124 VKLPEGMKENQKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEILEKYTLA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G  
Sbjct: 182 LFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEP 240

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E 
Sbjct: 241 QKQLSKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE- 299

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+ +Y  
Sbjct: 300 NIAARIEKNVTEYLK 314


>gi|295086801|emb|CBK68324.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides xylanisolvens XB1A]
          Length = 331

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 133/322 (41%), Positives = 191/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 18  MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 77

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G+        YK+G
Sbjct: 78  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCGSAW----RAYKSG 133

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 134 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMG--LHDEDISKEEILKQGLATPEEYEIL 191

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 192 EKYTLALFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYAEGYQER 250

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 251 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 310

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + +R
Sbjct: 311 KEDT-TNIAERIFKNVETFLNR 331


>gi|212694468|ref|ZP_03302596.1| hypothetical protein BACDOR_03996 [Bacteroides dorei DSM 17855]
 gi|212662969|gb|EEB23543.1| hypothetical protein BACDOR_03996 [Bacteroides dorei DSM 17855]
          Length = 322

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 188/315 (59%), Gaps = 11/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 16  TDFNFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKF 75

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG   Q FP+E+IVRGYL G+        YKNG R+I  
Sbjct: 76  LDATTDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKNGVREICG 131

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+
Sbjct: 132 VQLPEGMKENQKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEILEKYTLA 189

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G  
Sbjct: 190 LFKRGTEIAAERGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEP 248

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E 
Sbjct: 249 QKQLSKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE- 307

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+ +Y  
Sbjct: 308 NIAARIEKNVTEYLK 322


>gi|86131829|ref|ZP_01050426.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Dokdonia
           donghaensis MED134]
 gi|85817651|gb|EAQ38825.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Dokdonia
           donghaensis MED134]
          Length = 315

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 118/322 (36%), Positives = 175/322 (54%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++      P   + Y GKVRE Y L D   + +ATDRLSAFD  +   IP+KG++LN
Sbjct: 1   MNTITDTNFNFPGQKSIYKGKVREVYTLEDDLLLMVATDRLSAFDVVMPKGIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T D+  N  +  PDPNV +G++ + F +E+++RGY++G+        YK G
Sbjct: 61  QIATKMMKDTEDLVPNWLVATPDPNVAIGKRCEPFKVEMVIRGYMSGHAARE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    +P+ M +N   P P+ITP TK+       D+ IS  +II + I++   +  +
Sbjct: 117 RRILCGVAMPEGMKENDVFPEPIITPATKAEMG--DHDEDISREDIIKKNIVSEEDYLVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A   GLILVD+KYEFG      I+L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EDYTRKLFQRGSEIAASRGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYAEGYEER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W+++          +P++ +  I   S+ YI  YE ITG  F 
Sbjct: 235 QAAGEAQKQLSKEFVRQWLISNNFQGLEGQTVPEMTDEYIETVSERYIELYENITGDAFA 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             ++     ERI  N+  Y  +
Sbjct: 295 KADTS-NIQERIEKNVLTYLAK 315


>gi|332290997|ref|YP_004429606.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169083|gb|AEE18338.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 315

 Score =  294 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 118/322 (36%), Positives = 175/322 (54%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++      P   + Y GKVRE Y L D   + +ATDRLSAFD  +   IP+KG++LN
Sbjct: 1   MNTITDTNFNFPGQKSIYKGKVREVYTLEDDLLLMVATDRLSAFDVVMPKGIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T D+  N  +  PDPNV +G++ + F +E+++RGY++G+        YK G
Sbjct: 61  QIATKMMKDTEDLVPNWLVATPDPNVAIGKRCEPFKVEMVIRGYMSGHAARE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    +P+ M +N   P P+ITP TK+       D+ IS  +II + I++   +  +
Sbjct: 117 RRVLCGVEMPEGMKENDAFPAPIITPATKAEMG--DHDEDISREDIIKKAIVSEEDYLVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A   GLILVD+KYEFG      I+L DEIHTPDSSRY+  E YE+ 
Sbjct: 175 EDYTCKLFQRGSEIAASRGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYAEGYEER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W+++          +P++ +  I   S+ YI  YE ITG  F 
Sbjct: 235 QAAGEAQKQLSKEFVRQWLISNDFQGLEGQRVPEMTDEYIETVSERYIELYENITGDAFA 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             ++    L RI  N+  Y  +
Sbjct: 295 KADTS-NILNRIEKNVLAYLAK 315


>gi|218261471|ref|ZP_03476282.1| hypothetical protein PRABACTJOHN_01948 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223989|gb|EEC96639.1| hypothetical protein PRABACTJOHN_01948 [Parabacteroides johnsonii
           DSM 18315]
          Length = 315

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 133/321 (41%), Positives = 190/321 (59%), Gaps = 13/321 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 3   KALTKTDFNFPGQKSVYHGKVRDVYNINDDVLVMVATDRISAFDVVLPEGIPYKGQMLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+        YK+G 
Sbjct: 63  IAAKFLDATTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKSGV 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LP+ M +N++ P P++TPTTK+       D  IS  EI+ +G+ T  ++E + 
Sbjct: 119 REICGIKLPEGMRENERFPEPIVTPTTKAEIGE--HDADISKEEILAQGLATPEEYELLE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F
Sbjct: 177 KYTLALFKRGTEIAAERGLILVDTKYEFGKHGG-KIYLMDEIHTPDSSRYFYSEGYEERF 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W++      +    +P++   I+   S+ YI  YE ITG KF  
Sbjct: 236 AKGEPQKQLSKEFVREWLMENGFQGKAGQKVPEMTPAIVDGISERYIELYEHITGEKFEK 295

Query: 297 DNSELPPLERIRNNLRKYTHR 317
            +++   L RI  N+ +Y ++
Sbjct: 296 GDTD-NLLSRIEKNVTEYLNK 315


>gi|217979155|ref|YP_002363302.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocella silvestris BL2]
 gi|217504531|gb|ACK51940.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylocella silvestris BL2]
          Length = 330

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 219/315 (69%), Gaps = 2/315 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L  A+IPELPNYY GKVRENY L +G RI IATDR+SAFDQN+A IP+KG+VL  I ++
Sbjct: 18  LLEDAFIPELPNYYRGKVRENYDLPNGERILIATDRVSAFDQNLASIPFKGQVLTDIARF 77

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T+DIC NH    PDPNV+V ++L+M P+E+IVR YLAG+T TS+LT YK G R++Y
Sbjct: 78  WFEATADICPNHVRANPDPNVVVVERLEMMPVEIIVRDYLAGSTATSILTMYKAGARRMY 137

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D +  N+KLP  ++TPT+K+       D P++ +EI+  G+LT  QWE +   AL
Sbjct: 138 GLDFADGLRANEKLPQTIVTPTSKA--GHGSHDAPLTADEILDSGLLTPRQWEDVCEKAL 195

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A   GLIL D+KYEFG + + +I+LADEIHTPDSSRYW  ETY +    G 
Sbjct: 196 ALFTRGREIAAGRGLILADTKYEFGFNAEGHIVLADEIHTPDSSRYWLEETYPERLESGG 255

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDKDFIRNW+  RC+PYRD IP IP ++IL  + TYI  +E I+G  F+    +  
Sbjct: 256 APDSLDKDFIRNWVSARCDPYRDPIPQIPPDVILEAAATYIRTFETISGRSFVFPEDQSA 315

Query: 303 PLERIRNNLRKYTHR 317
           PL+RIR NL  Y  R
Sbjct: 316 PLDRIRANLAFYWTR 330


>gi|86144213|ref|ZP_01062549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leeuwenhoekiella blandensis MED217]
 gi|85829343|gb|EAQ47809.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leeuwenhoekiella blandensis MED217]
          Length = 317

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 121/320 (37%), Positives = 176/320 (55%), Gaps = 12/320 (3%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + ++      P   + Y GKVRE Y L +   + IATDRLSAFD  +   IPYKG++LNQ
Sbjct: 4   KTITDTNYTFPGQTHVYKGKVREVYSLDNDLLVMIATDRLSAFDVVMPKGIPYKGQILNQ 63

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I       T D+  N     PDPNV VG++   F +E+++RGY++G+        YK GK
Sbjct: 64  IATKMMRDTEDLVPNWLAATPDPNVAVGKKCDPFKVEMVIRGYMSGHAARE----YKAGK 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ M +N K P P+ITP TK+       D+ IS  +I+ RGI++   +  + 
Sbjct: 120 RMLCGVPLPEGMKENDKFPQPIITPATKAEMG--DHDEDISKEDILKRGIVSAEDYAVLE 177

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y   LF+RG ++A E GLILVD+KYEFG      I+L DEIHTPDSSRY+  + Y +  
Sbjct: 178 DYTRKLFQRGSEIAAERGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYADGYAERQ 237

Query: 239 REGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W+++          +P++ +  I   S+ YI  YE ITG  F+ 
Sbjct: 238 EKGEAQKQLSKEFVRQWLISNGFQGLEGQTLPEMTDAYIETVSERYIELYENITGEPFVK 297

Query: 297 DNSELPPLERIRNNLRKYTH 316
            +      +RI  N+  Y +
Sbjct: 298 ADLS-DIDKRIETNVLNYLN 316


>gi|224024794|ref|ZP_03643160.1| hypothetical protein BACCOPRO_01522 [Bacteroides coprophilus DSM
           18228]
 gi|224018021|gb|EEF76028.1| hypothetical protein BACCOPRO_01522 [Bacteroides coprophilus DSM
           18228]
          Length = 327

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 133/321 (41%), Positives = 188/321 (58%), Gaps = 13/321 (4%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P   + Y GKVR+ Y + D   + +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 15  KALTKTDYHFPGQKSVYHGKVRDVYNIGDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQ 74

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+        YK+G 
Sbjct: 75  IAAKFLDATTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKSGV 130

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LP+ M +N+K P+P+ITPTTK+       D+ IS  EI+ + + T  ++ET+ 
Sbjct: 131 REICGVRLPEGMRENEKFPHPIITPTTKAEMGM--HDEDISKEEILAKELATPEEYETLE 188

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LFERG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E Y++ F
Sbjct: 189 KYTLALFERGTQMAAERGLILVDTKYEFGK-HNGEIYLMDEIHTPDSSRYFYLEGYQERF 247

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +      L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+ 
Sbjct: 248 EKEEPQKQLSKEFVREWLMANGFQGKEGQQVPEMTPEIVSSISDRYIELYEHITGETFVK 307

Query: 297 DNSELPPLERIRNNLRKYTHR 317
            ++     ERI  N+  Y  +
Sbjct: 308 ADT-ANIAERIEKNVTDYLTK 327


>gi|294778886|ref|ZP_06744302.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides vulgatus PC510]
 gi|294447195|gb|EFG15779.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides vulgatus PC510]
          Length = 322

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 11/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 16  TDFNFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKF 75

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG   Q FP+E+IVRGYL G+        YKNG R+I  
Sbjct: 76  LDATTDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKNGVREICG 131

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+
Sbjct: 132 VKLPEGMKENQKFPEPIITPTTKAEMG--LHDEDISKEEILKQGLATPEEYEILEKYTLA 189

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G  
Sbjct: 190 LFKRGTEIAAKRGLILVDTKYEFGK-HNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEP 248

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E 
Sbjct: 249 QKQLSKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE- 307

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+ +Y  
Sbjct: 308 NIATRIEKNVTEYLK 322


>gi|325297312|ref|YP_004257229.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides salanitronis DSM 18170]
 gi|324316865|gb|ADY34756.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides salanitronis DSM 18170]
          Length = 315

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 137/319 (42%), Positives = 191/319 (59%), Gaps = 13/319 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P L + Y GKVR+ Y ++D   I +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 3   KALTKTDFHFPGLKSVYHGKVRDVYNINDEKLIMVATDRISAFDVVLPEGIPYKGQMLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+        YK+G 
Sbjct: 63  IAAKFLDATADICPNWKLATPDPMVTVGVLCQGFPVEMIVRGYLCGSAW----RAYKSGV 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LPDNM +N+K P+P+ITPTTK+       D+ IS  EI+ RG+ T  ++E + 
Sbjct: 119 REICGVRLPDNMRENEKFPHPIITPTTKAEMGM--HDEDISKEEILARGLATPEEYEILE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LFERG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ F
Sbjct: 177 RYTLALFERGTQIAAERGLILVDTKYEFGK-HNGQIYLMDEIHTPDSSRYFYSEGYQERF 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            + +    L K+F+R W++      ++   +P++   I+   S  YI  +E ITG  F+ 
Sbjct: 236 EKELPQKQLSKEFVREWLMANGFQGKEGQQVPEMTPEIVNSISDRYIELFEHITGEPFVK 295

Query: 297 DNSELPPLERIRNNLRKYT 315
            +++    ERI  N+  Y 
Sbjct: 296 ADTD-HLAERIEKNVMDYL 313


>gi|325270152|ref|ZP_08136759.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella multiformis DSM 16608]
 gi|324987453|gb|EGC19429.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella multiformis DSM 16608]
          Length = 316

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 174/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y + D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDIDDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDQTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVRLPDGMRENERFPEPIVTPTTKADEG---HDLNISKEEIIRQGIVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A   GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRRLFARGQEIAARQGLILVDTKYEFGK-RDGKCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LAKGEPQRQLSKEFVRQWLIEHDFMNEPGQTMPEITDEYAASVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+++Y   
Sbjct: 293 KAAEEGDIAARIEKNVKRYLAS 314


>gi|261880573|ref|ZP_06007000.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bergensis DSM 17361]
 gi|270332692|gb|EFA43478.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bergensis DSM 17361]
          Length = 316

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 128/322 (39%), Positives = 179/322 (55%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y + D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFEGQKSVYHGKVRDVYNIDDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G+        YK+G
Sbjct: 61  QIAAKFLDDTKDICPNWKLATPDPMVTVGVKCEGFRVEMIIRSILTGSAW----RAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +NQ+ P P+ITPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVKLPEGMRENQRFPEPIITPTTKADEG---HDLNISREEIISQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LFERG ++A ++GLILVD+KYEFG      I L DEIHTPDSSRY+  + YE  
Sbjct: 174 EDWTRKLFERGQEIAAKHGLILVDTKYEFGKSGD-QIYLIDEIHTPDSSRYFYADGYEDR 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIDHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             + E     RI  N++ Y  +
Sbjct: 293 KADEEEDIAARIERNVKDYLAK 314


>gi|260592408|ref|ZP_05857866.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           veroralis F0319]
 gi|260535644|gb|EEX18261.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           veroralis F0319]
          Length = 316

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 125/322 (38%), Positives = 178/322 (55%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTEFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK+G
Sbjct: 61  QIASKFLDLTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R I    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRGICGVKLPDGMRENERFPEPIVTPTTKADEG---HDMNISKEEIIKQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A + GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRKLFARGQEIAAKQGLILVDTKYEFGK-RDGQCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 LAKGEPQKQLSKEFVRQWLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+++Y   
Sbjct: 293 KAAEEGDIAARIEKNVKEYLAS 314


>gi|189461839|ref|ZP_03010624.1| hypothetical protein BACCOP_02505 [Bacteroides coprocola DSM 17136]
 gi|189431433|gb|EDV00418.1| hypothetical protein BACCOP_02505 [Bacteroides coprocola DSM 17136]
          Length = 314

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 134/319 (42%), Positives = 189/319 (59%), Gaps = 13/319 (4%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P   + Y GKVR+ Y + D   + +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 3   KALTKTDYHFPGQKSVYHGKVRDVYNIKDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G+        YK+G 
Sbjct: 63  IAAKFLDATTDICPNWKLATPDPMVTVGVMCEGFPVEMIVRGYLCGSAW----RAYKSGV 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LP+ M +N+K P+P+ITPTTK+       D+ IS  EI+ +G+ T  ++ET+ 
Sbjct: 119 REICGVRLPEGMRENEKFPHPIITPTTKAEMGM--HDEDISKEEILAKGLATPEEYETLE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LFERG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ F
Sbjct: 177 RYTLALFERGTQMAAERGLILVDTKYEFGK-HNGEIYLMDEIHTPDSSRYFYSEGYQERF 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             G     L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+ 
Sbjct: 236 ENGEPQKQLSKEFVREWLMANGFQGKEGQKVPEMTPAIVSSISDRYIELYEHITGETFVK 295

Query: 297 DNSELPPLERIRNNLRKYT 315
            +++    ERI  N+ +Y 
Sbjct: 296 ADTDQ-LAERIEKNVTEYL 313


>gi|332876531|ref|ZP_08444293.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685498|gb|EGJ58333.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 315

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 126/322 (39%), Positives = 187/322 (58%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+      P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTHTDFNFPGQKSVYHGKVRDVYNINDELMVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDI  N  L  PDP V VG + + F +E+I+RGYL G+        Y+NG
Sbjct: 61  QIAATFLDATSDIVPNWKLATPDPMVTVGLKCEGFRVEMIIRGYLTGSAWRE----YQNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +NQK P P+ITPTTK+       D+ IS  EII +G++++  +E +
Sbjct: 117 CRELCGVKLPEGMKENQKFPTPIITPTTKADAG---HDENISKEEIIAQGLVSKEDYELM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF RG ++A E GLILVD+KYEFG  K   + L DEIHTPDSSRY+  + Y++ 
Sbjct: 174 EKYTYALFARGTEMAAEKGLILVDTKYEFGK-KDGKVYLIDEIHTPDSSRYFYADGYQEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ +  +   S  YI  YE I G KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIDHNFMGKEGQQVPEMTDEYVNSVSDRYIELYEHIVGQKFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             ++      RI  N+ +Y ++
Sbjct: 293 KADNHDDLAARIEKNVTEYLNQ 314


>gi|307109403|gb|EFN57641.1| hypothetical protein CHLNCDRAFT_21048 [Chlorella variabilis]
          Length = 380

 Score =  292 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 130/316 (41%), Positives = 191/316 (60%), Gaps = 7/316 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           + L+   +  +   Y GKVR+ Y L D   + + TDR SAFD+ +A IP+KG+VLNQ + 
Sbjct: 69  QCLTDTDL-GMGKKYKGKVRDTYDLGD-KLVIVTTDRQSAFDRLLAAIPFKGQVLNQTSA 126

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +W   T  I  N  L  PD N  + ++  +FP+E + RG++ G+T TSL T YKNG R+ 
Sbjct: 127 WWMQQTQHIVKNALLSVPDANACIMKKCGVFPVEFVCRGFMTGSTDTSLWTHYKNGAREY 186

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
                PD M  N++L   VITPTTK+       D+PISP +I+ +G++++  W+ +S+ A
Sbjct: 187 CGNTFPDGMRKNERLAQNVITPTTKAE----DHDEPISPADIVRQGLMSQEDWDAVSTAA 242

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF  G + A + GL+LVD+KYEFG D+  NI+L DEIHTPDSSRYW  +TYE+   +G
Sbjct: 243 LQLFAFGQQQAAQRGLLLVDTKYEFGKDEAGNILLIDEIHTPDSSRYWLADTYEQRHAQG 302

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
             P  +DK+F+R W    C+PY D + P+ P  +    S+ Y+  YEKITG +F     +
Sbjct: 303 EEPQNIDKEFLRLWFRANCDPYNDAVLPEAPAELRCELSRRYVLLYEKITGQQFQPAPLD 362

Query: 301 LPPLERIRNNLRKYTH 316
             P +R+R ++     
Sbjct: 363 EEPAQRMRRSVAAALE 378


>gi|327312415|ref|YP_004327852.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola F0289]
 gi|326945587|gb|AEA21472.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola F0289]
          Length = 316

 Score =  292 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 175/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDQTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVRLPDGMCENERFPEPIVTPTTKADEG---HDLNISKEEIIRQGIVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A   GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRRLFARGQEIAARQGLILVDTKYEFGK-RDGKCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LAKGEPQRQLSKEFVRQWLIEHDFMNEPGQTMPEITDEYAASVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+++Y   
Sbjct: 293 KAAEEGDIAARIEKNVKQYLAS 314


>gi|154490942|ref|ZP_02030883.1| hypothetical protein PARMER_00859 [Parabacteroides merdae ATCC
           43184]
 gi|154088690|gb|EDN87734.1| hypothetical protein PARMER_00859 [Parabacteroides merdae ATCC
           43184]
          Length = 315

 Score =  292 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 133/321 (41%), Positives = 190/321 (59%), Gaps = 13/321 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 3   KALTKTDFNFPGQKSVYHGKVRDVYNINDDVLVMVATDRISAFDVVLPEGIPYKGQMLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+        YK+G 
Sbjct: 63  IAAKFLDATTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKSGV 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LP+ M +N++ P P++TPTTK+       D  IS  EI+ +G+ T  ++E + 
Sbjct: 119 REICGVKLPEGMRENERFPEPIVTPTTKAEIGE--HDADISKEEILAKGLATPEEYELLE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F
Sbjct: 177 KYTLALFKRGTEIAAERGLILVDTKYEFGKHGG-KIYLMDEIHTPDSSRYFYSEGYEERF 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W++      +    +P++   I+   S+ YI  YE ITG KF  
Sbjct: 236 AKGEPQKQLSKEFVREWLMENDFQGKAGQKVPEMTPAIVDGISERYIELYEHITGEKFEK 295

Query: 297 DNSELPPLERIRNNLRKYTHR 317
            +++   L RI  N+ +Y ++
Sbjct: 296 GDTD-NLLSRIEKNVTEYLNK 315


>gi|281420649|ref|ZP_06251648.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           copri DSM 18205]
 gi|281405422|gb|EFB36102.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           copri DSM 18205]
          Length = 316

 Score =  291 bits (745), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 126/323 (39%), Positives = 178/323 (55%), Gaps = 13/323 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        Y+ G
Sbjct: 61  QIAAKFLDTTTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YQKG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQ+ P P+ITPTTK+ E     D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPDGMRENQRFPEPIITPTTKADEG---HDMNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   +F RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRRIFARGQEIAAKQGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQRQLSKEFVRQWLIEHNFMNEPGQTMPEITDEYAESVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHRH 318
               E     RI  N+ ++   H
Sbjct: 293 KAAEEGDIAARIEKNVSEWLAAH 315


>gi|288925786|ref|ZP_06419717.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccae D17]
 gi|288337441|gb|EFC75796.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccae D17]
          Length = 316

 Score =  291 bits (745), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 126/320 (39%), Positives = 180/320 (56%), Gaps = 13/320 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+RG L G+        YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRGILTGSAWRE----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPEGMRENERFPEPIVTPTTKADEG---HDLNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG      + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFGKRGG-KVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I ++     S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDDYAESVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
               +     RI  N+ +Y 
Sbjct: 293 KATEQGDIATRIEKNVSEYL 312


>gi|288800102|ref|ZP_06405561.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 299 str. F0039]
 gi|288333350|gb|EFC71829.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 299 str. F0039]
          Length = 316

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 125/320 (39%), Positives = 180/320 (56%), Gaps = 13/320 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+          + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTSTNFNFDGQKSVYHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YKNG
Sbjct: 61  QIAAQFLDSTTDICPNWKLATPDPMVTVGLKCEGFKVEMIIRSILTGSAWRD----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +GI++   +  +
Sbjct: 117 VREICGIQLPDGMKENERFPEPIITPTTKADEG---HDLNISKEEIIAQGIVSAEDYAIM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   +F RG ++A ++GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDYTRRIFARGQEIASKHGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           IP++ +      S+ YI  YE ITG KF+
Sbjct: 233 LAKGEPQRQLSKEFVRQWLINHNFMNEPGQVIPEMTDEYTNSVSERYIELYEHITGNKFV 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
                    +RI++N+  Y 
Sbjct: 293 KPTESEDINKRIQDNINNYL 312


>gi|282859530|ref|ZP_06268635.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bivia JCVIHMP010]
 gi|282587758|gb|EFB92958.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bivia JCVIHMP010]
          Length = 332

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 125/322 (38%), Positives = 176/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L++         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 17  MKALTQTNFNFEGQKSVYHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 76

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        Y+ G
Sbjct: 77  QIAAKFLDQTTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YQKG 132

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 133 CREICGVKLPDGMRENERFPEPIITPTTKADEG---HDLNISREEIIAQGIVSEEDYNII 189

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   +F RG ++A + GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+ 
Sbjct: 190 EDWTRKIFARGQEIAAKQGLILVDTKYEFGK-RDGQCYLIDEIHTPDSSRYFYAEGYEEK 248

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           IP+I +      S  YI  YE ITG  F 
Sbjct: 249 FEKGEPQRQLSKEFVRQWLIEHNFMNEPGQVIPEITDEYAETVSDRYIELYEHITGENFE 308

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               +    ERI  N++ Y   
Sbjct: 309 KKEYDGDIAERIEKNVKAYLAE 330


>gi|198276470|ref|ZP_03209001.1| hypothetical protein BACPLE_02665 [Bacteroides plebeius DSM 17135]
 gi|198270558|gb|EDY94828.1| hypothetical protein BACPLE_02665 [Bacteroides plebeius DSM 17135]
          Length = 315

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 133/320 (41%), Positives = 187/320 (58%), Gaps = 13/320 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+K     P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQ
Sbjct: 3   KALTKTDFHFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+        YK+G 
Sbjct: 63  IAAKFLDATTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCGSAW----RAYKSGV 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R+I    LP+ M +N+K P+P+ITPTTK+       D+ IS  EI+ +G+ T  ++ T+ 
Sbjct: 119 REICGVRLPEGMRENEKFPHPIITPTTKAEMG--LHDEDISKEEILAKGLATPEEYATLE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y L+LFERG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ F
Sbjct: 177 KYTLALFERGTQMAAERGLILVDTKYEFGK-HNGEIYLMDEIHTPDSSRYFYSEGYQERF 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +      L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+ 
Sbjct: 236 EKEEPQKQLSKEFVREWLMANGFQGKEGQQVPEMTPAIVESISDRYIELYEHITGESFVK 295

Query: 297 DNSELPPLERIRNNLRKYTH 316
             +E    +RI  N+  Y  
Sbjct: 296 GETE-DLTKRIEKNVTDYLT 314


>gi|126662346|ref|ZP_01733345.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BAL38]
 gi|126625725|gb|EAZ96414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BAL38]
          Length = 316

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 177/322 (54%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++      P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LN
Sbjct: 1   MNTITTTNFNFPGQKSVYRGKVREVYNINDDLLVMVATDRLSAFDVVLPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  G
Sbjct: 61  QIATKFMELTSDIVPNWLVATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YAAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    +P+ + +N K P P+ITPTTK+   +   D+ IS   I+   I+T   +  +
Sbjct: 117 RRILCGVEMPEGLKENDKFPTPIITPTTKADNGS--HDEDISREAILANRIVTEADYLIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +L++RG ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTRALYQRGTEIAASRGLILVDTKYEFGKTKDGQIVLIDEIHTPDSSRYFYAEGYQER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
                    L K+F+R W++      ++   IP++ +  I   S+ YI  +E I G KF+
Sbjct: 235 QNNNEEQKQLSKEFVRRWLIENGFQGKEGQQIPNMTDEYIETVSERYIELFENIIGEKFV 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +      ERI  N+  Y   
Sbjct: 295 KADIS-NINERIEKNVLNYLEN 315


>gi|315122329|ref|YP_004062818.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495731|gb|ADR52330.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 330

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 248/316 (78%), Positives = 279/316 (88%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RI+S+AYIPELPNYY GKVRENYFL+DGTRITIATDRLSAFD+NI CIP+KGE+LN+ITQ
Sbjct: 12  RIISEAYIPELPNYYPGKVRENYFLNDGTRITIATDRLSAFDRNITCIPHKGELLNKITQ 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF HTSDIC NH LDYPDPNVLVG+QLQMFPIELIVRGYLAGNTKTSLLTFYK G+R I
Sbjct: 72  YWFQHTSDICENHALDYPDPNVLVGKQLQMFPIELIVRGYLAGNTKTSLLTFYKKGQRTI 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPDNM DNQKLP+ +ITPTTKSS      D+PISP+EII +GILT+NQWETISSYA
Sbjct: 132 YGHSLPDNMHDNQKLPHTIITPTTKSSGPNFEHDKPISPHEIIQKGILTQNQWETISSYA 191

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LFERGCKLA E  LILVDSKYEFG+DKK NI+LADEIHTPDSSRYW+ ETYEKS +EG
Sbjct: 192 LALFERGCKLASERDLILVDSKYEFGLDKKNNIVLADEIHTPDSSRYWKAETYEKSLKEG 251

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
            +P GLDKD IRNWILT CNPY+DNIP+IPENI+L  SQTY+ AYE+ITGLKFI +NS+ 
Sbjct: 252 TSPEGLDKDLIRNWILTHCNPYKDNIPNIPENILLHISQTYMTAYERITGLKFIGENSDF 311

Query: 302 PPLERIRNNLRKYTHR 317
            PL RIRNNL +Y +R
Sbjct: 312 SPLHRIRNNLEQYINR 327


>gi|315608264|ref|ZP_07883254.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella buccae ATCC 33574]
 gi|315250045|gb|EFU30044.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella buccae ATCC 33574]
          Length = 316

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 126/320 (39%), Positives = 181/320 (56%), Gaps = 13/320 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+RG L G+        YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRGILTGSAWRE----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPEGMRENERFPEPIVTPTTKADEG---HDLNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I ++     S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDDYAENVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
               +     RI  N+ +Y 
Sbjct: 293 KATEQGDIATRIEKNVSEYL 312


>gi|288802489|ref|ZP_06407928.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica D18]
 gi|288335017|gb|EFC73453.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica D18]
          Length = 316

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/322 (38%), Positives = 178/322 (55%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTEFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK+G
Sbjct: 61  QIAAKFLDLTTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CREICGVKLPDGMRENERFPEPIVTPTTKADEG---HDMNISKEEIIEQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A + GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDWTRKLFARGQEIAAKQGLILVDTKYEFGK-RDGQCYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LEKGEPQKQLSKEFLRQWLIEHNFMNEPGQTMPEITDEYAETVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               +     RI  N+++Y   
Sbjct: 293 KAVEDGDIAARIEKNVKEYLAS 314


>gi|330995519|ref|ZP_08319423.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Paraprevotella xylaniphila YIT 11841]
 gi|329575431|gb|EGG56973.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Paraprevotella xylaniphila YIT 11841]
          Length = 315

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 126/322 (39%), Positives = 186/322 (57%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+      P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTHTDFNFPGQQSVYHGKVRDVYNINDELMVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDI  N  L  PDP V VG + + F +E+I+RGYL G+        Y+NG
Sbjct: 61  QIAATFLDATSDIVPNWKLATPDPMVTVGLKCEGFRVEMIIRGYLTGSAWRE----YQNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +NQK P P+ITPTTK+       D+ IS  EII +G++++  +E +
Sbjct: 117 CRELCGVKLPEGMKENQKFPTPIITPTTKADAG---HDENISKEEIIAQGLVSKEDYELM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF RG ++A E GLILVD+KYEFG  K   + L DEIHTPDSSRY+  + Y++ 
Sbjct: 174 EKYTYALFARGTEMAAEKGLILVDTKYEFGK-KDGKVYLIDEIHTPDSSRYFYADGYQEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ +  +   S  YI  YE I G KF 
Sbjct: 233 FEKGEAQKQLSKEFVRQWLIDHNFMGKEGQQVPEMTDEYVNSVSDRYIELYEHIVGQKFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +       RI  N+ +Y ++
Sbjct: 293 KADDHDDLAARIEKNVTEYLNQ 314


>gi|317502844|ref|ZP_07960945.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella salivae DSM 15606]
 gi|315666033|gb|EFV05599.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella salivae DSM 15606]
          Length = 316

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/322 (38%), Positives = 176/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + IATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMIATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDATSDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ M +N++ P P++TPTTK+ E     D  IS  EII +G++++  ++ I
Sbjct: 117 CRDLCGVKLPEGMRENERFPEPIVTPTTKADEG---HDMNISREEIIAQGLVSKEDYDVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTKKLFKRGQEIAAKQGLILVDTKYEFGK-RDGKIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 LAAGKPQKQLSKEFVRQWLIEHNFMNEPGQQMPEISDEYAESVSERYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI  N+  Y   
Sbjct: 293 KSVESGDIAARIEKNVENYLKT 314


>gi|302346462|ref|YP_003814760.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica ATCC 25845]
 gi|302150442|gb|ADK96703.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica ATCC 25845]
          Length = 316

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/322 (38%), Positives = 178/322 (55%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTEFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK+G
Sbjct: 61  QIAAKFLDLTTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CREICGVKLPDGMRENERFPEPIVTPTTKADEG---HDMNISKEEIIEQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A + GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDWTRKLFARGQEIAAKQGLILVDTKYEFGK-RDGQCYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LEKGEPQKQLSKEFLRQWLIEHNFMNEPGQTMPEITDEYAETVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               +     RI  N+++Y   
Sbjct: 293 KAVEDGDIAARIEKNVKQYLAS 314


>gi|282879525|ref|ZP_06288256.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           timonensis CRIS 5C-B1]
 gi|281306473|gb|EFA98502.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           timonensis CRIS 5C-B1]
          Length = 314

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 123/321 (38%), Positives = 178/321 (55%), Gaps = 13/321 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDKIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDLTQDICPNWKLATPDPMVTVGIKCEGFRVEMIIRSILTGSAWRE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +N++ P P++TPTTK+ E     D  IS  EII +G+++   +  I
Sbjct: 117 ARELCGVKLPEGMKENERFPEPIVTPTTKADEG---HDMNISKEEIIKQGLVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFARGQEIAAKQGLILVDTKYEFGK-RDGKIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF+
Sbjct: 233 LAKGEPQKQLSKEFVRQWLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFV 292

Query: 296 ADNSELPPLERIRNNLRKYTH 316
             +       RI  N+++Y  
Sbjct: 293 KADEHDDLAARIERNVKEYLK 313


>gi|325852022|ref|ZP_08171105.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola CRIS 18C-A]
 gi|325484578|gb|EGC87494.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola CRIS 18C-A]
          Length = 316

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 175/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDQTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVRLPDGMRENERFPEPIVTPTTKADEG---HDLNISKEEIIRQGIVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A   GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRRLFARGQEIAARQGLILVDTKYEFGK-RDGKCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LAKGEPQRQLSKEFVRQWLIEHDFMNEPGQTMPEITDEYAASISDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+++Y   
Sbjct: 293 KAAEEGDIATRIEKNVKQYLAS 314


>gi|300727223|ref|ZP_07060639.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bryantii B14]
 gi|299775461|gb|EFI72055.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bryantii B14]
          Length = 316

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 128/320 (40%), Positives = 178/320 (55%), Gaps = 13/320 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAQFLDATSDICPNWKLATPDPMVTVGVKCEGFRVEMIIRSILTGSAW----RAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQ+ P P+ITPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CREICGVKLPEGMKENQRFPEPIITPTTKADEG---HDMNISKEEIIAQGIVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF+RG ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRKLFQRGQEIAAKRGLILVDTKYEFGKKGD-QIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G+    L K+F+R W++           +P+I +      S+ YI  YE I G KF 
Sbjct: 233 FEKGLPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDEYAESVSERYIELYENIVGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
               E     RI  N++ Y 
Sbjct: 293 KAVEEGDIASRIEKNVKAYL 312


>gi|254495474|ref|ZP_05108398.1| phosphoribosylamidoimidazole-succinocarboxamidesynthase
           [Polaribacter sp. MED152]
 gi|85819829|gb|EAQ40986.1| phosphoribosylamidoimidazole-succinocarboxamidesynthase
           [Polaribacter sp. MED152]
          Length = 314

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 123/321 (38%), Positives = 184/321 (57%), Gaps = 12/321 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  +++     P   + Y GKVRE Y ++D   + IATDRLSAFD  +   IP+KG++LN
Sbjct: 1   MNTINETNFEFPGQKSIYKGKVREVYNINDDLLVMIATDRLSAFDVILPRQIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI     + TSDI  N  +  PD NV VG   + F +E+++RGYL+G+        YK G
Sbjct: 61  QIATKMMNETSDIVPNWLIANPDENVAVGHLCEPFKVEMVIRGYLSGHAARE----YKLG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    +P+N+ +N K P P+ITP+TK+       D+ IS  +I+  GI++   +  +
Sbjct: 117 KRLLCGVKMPENLKENDKFPTPIITPSTKADNGE--HDEDISREDILANGIVSEEDYLIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  K+  I+L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EEYTRKLFQRGSEIAAKRGLILVDTKYEFGKTKEGKIVLIDEIHTPDSSRYFYAEGYQER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                    L K+F+R W++      +    IP++ +  I+  S  YI  YE+ITG +F+
Sbjct: 235 QDNNEAQKQLSKEFVRQWLIENGFQGKEGQAIPEMSDEKIVEISNRYIELYEQITGEQFV 294

Query: 296 ADNSELPPLERIRNNLRKYTH 316
              +E   L+RI  N+  +  
Sbjct: 295 KAQTE-NVLDRIEKNVLDFLS 314


>gi|225010786|ref|ZP_03701254.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-3C]
 gi|225004994|gb|EEG42948.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-3C]
          Length = 315

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 173/315 (54%), Gaps = 10/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVRE Y L +   + IATDRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TNFNFPGQKSIYKGKVREVYALENDLLVMIATDRLSAFDVVMPRGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T DI  N     PDPNV +G   + F +E+++RGY++G+        YK GKR +  
Sbjct: 68  MGATKDIVPNWLTATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGKRMLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ + +N   P P+ITP TK+       D+ IS  +I+ RGI++++ +E +  Y  +
Sbjct: 124 VPMPEGLKENDAFPTPIITPATKAEMG--DHDEDISREDILARGIVSKDDYEILEKYTYA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LFERG  LA + GLILVD+KYEFG      I+L DEIHTPDSSRY+  + YE+    G  
Sbjct: 182 LFERGTALAAQRGLILVDTKYEFGKTASGEIVLIDEIHTPDSSRYFYADGYEERQAAGEA 241

Query: 244 PIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++++         +P++ +  I   S+ YI  YE ITG  F+      
Sbjct: 242 QKQLSKEFVRQWLISQNFQGLEGQTLPEMSDEYIASVSERYIELYENITGETFVKA-PLD 300

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+  +  
Sbjct: 301 NIQSRIEENVLNFLK 315


>gi|162449321|ref|YP_001611688.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Sorangium
           cellulosum 'So ce 56']
 gi|161159903|emb|CAN91208.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Sorangium
           cellulosum 'So ce 56']
          Length = 323

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 123/313 (39%), Positives = 184/313 (58%), Gaps = 4/313 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +  +      Y GKVR+ Y   DG R+ + TDR+SAFD+ +  +P KG+VLN+++ 
Sbjct: 13  RVLERTSLAGPFARYEGKVRDCYTTPDGRRLLVVTDRISAFDRVLGTLPLKGQVLNRLSA 72

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T  +  NH +  PDPNVL   +    P+E++VR Y+ G T TS+ T Y  G+R  
Sbjct: 73  FWFERTRSVAPNHMISQPDPNVLEAIECVPLPVEMVVRAYVTGVTSTSIWTHYARGERVF 132

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
             + LP+ +  N++LP P++TP+TK+ +   G D   S  EI+  G +    ++  +  A
Sbjct: 133 CGHRLPEGLRKNERLPRPILTPSTKAPKG--GHDLSASREEILALGTIDARDFDAAAEMA 190

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF+ G +   E GLILVD+KYEFG D+  NI++ DEIHTPDSSR+W   +Y + F  G
Sbjct: 191 LALFDHGARACAEQGLILVDTKYEFGKDRDGNIVVIDEIHTPDSSRFWFASSYGERFAAG 250

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DK+++R W+  R       IP IP+ + +  S+ YI A+E+ITG  F+ D    
Sbjct: 251 EDPESFDKEYVRRWLAARGFQGDGPIPSIPDEVRIEASRRYIEAFERITGAAFVPDL--E 308

Query: 302 PPLERIRNNLRKY 314
            P  RI  NL  +
Sbjct: 309 DPAVRIPRNLGAF 321


>gi|333029902|ref|ZP_08457963.1| Phosphoribosylaminoimidazole-succinocarboxamides synthase
           [Bacteroides coprosuis DSM 18011]
 gi|332740499|gb|EGJ70981.1| Phosphoribosylaminoimidazole-succinocarboxamides synthase
           [Bacteroides coprosuis DSM 18011]
          Length = 317

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 129/317 (40%), Positives = 183/317 (57%), Gaps = 12/317 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   N Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +
Sbjct: 8   TNFNFPGQKNVYHGKVRDVYNINDDLLVMVATDRISAFDVVLPKGIPFKGQVLNQIAAQF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
            + T+ I  N  +  PDP V VG   + F +E+I+R YL G+        YK G R +  
Sbjct: 68  LNATAHIVPNWLIATPDPMVTVGLLCEGFRVEMIIRAYLTGSAWRE----YKKGARTLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+ E     D+ IS  EII +G++++  +E +  Y  +
Sbjct: 124 VQLPEGMKENQKFPTPIITPTTKADEG---HDENISKEEIIAQGLVSKEDYEQLEKYTYA 180

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LFERG K+A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y+++F +G+ 
Sbjct: 181 LFERGSKMAKEKGLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYAEGYKENFEKGLP 239

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++           +P++ E  +   S+ YI  YE I G  F   NSE 
Sbjct: 240 QKQLSKEFVRQWLIEHNFMGEPGQQVPEMTEEYVNSVSERYIELYEHIVGKPFEKANSE- 298

Query: 302 PPLERIRNNLRKYTHRH 318
              ERI  N++ +   +
Sbjct: 299 HLNERIEKNVKAFLATY 315


>gi|159482653|ref|XP_001699382.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158272833|gb|EDO98628.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 372

 Score =  289 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 139/313 (44%), Positives = 192/313 (61%), Gaps = 7/313 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             L+  ++P LPN   GKVR+ Y L D T + + TDR SAFD+ +A +P+KG VLNQ   
Sbjct: 61  NCLTATHLP-LPNRRQGKVRDTYDLGD-TVVIVTTDRQSAFDRLLASVPFKGAVLNQTAA 118

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +W   T+ I  +  L  PDPNV V ++  +FP+E + RG++ G+T TSL T YK G R  
Sbjct: 119 WWLGATAHIAPSALLSCPDPNVAVMKKCAVFPVEFVCRGFMTGSTDTSLWTHYKAGARSY 178

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
                PD M  N +L   VITPTTK+       D PISP EI+ +G++T+ +W+T+SS A
Sbjct: 179 CGNDFPDGMRKNDRLASNVITPTTKAE----DHDVPISPAEIVAQGLMTQQEWDTVSSAA 234

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L +FE G   A + GL+LVD+KYEFG D    I + DE+HTPDSSRYW  +TYE     G
Sbjct: 235 LRIFEFGQAEAAKRGLLLVDTKYEFGKDANGVIHIIDEVHTPDSSRYWLADTYEARHAAG 294

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
             P  +DK+F+R W   RC+PY+D + P+ P  ++   S+ Y+  YEKITG  F   + +
Sbjct: 295 QEPQNIDKEFLRLWFRERCDPYKDAVLPEAPAELVCELSKRYVYLYEKITGQPFAVPDLD 354

Query: 301 LPPLERIRNNLRK 313
            P  +RI  NL+K
Sbjct: 355 TPINDRILANLQK 367


>gi|150025152|ref|YP_001295978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacterium psychrophilum JIP02/86]
 gi|166229547|sp|A6GYJ4|PUR7_FLAPJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|149771693|emb|CAL43167.1| Phosphoribosylaminoimidazolesuccinocarboxamidesynthase
           [Flavobacterium psychrophilum JIP02/86]
          Length = 316

 Score =  289 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 177/322 (54%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++      P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LN
Sbjct: 1   MNTITTTNFNFPNQKSVYRGKVREVYNINDELLVMVATDRLSAFDVVLPEGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  G
Sbjct: 61  QIATKFMELTQDIVPNWLIATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YALG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR I    +P+ + +N + P P+ITPTTK+   +   D+ IS + I+ + I++   +  +
Sbjct: 117 KRTICGVTMPEGLKENDQFPTPIITPTTKADNGS--HDEDISRSAILAKNIVSEQDYLVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   L++RG ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y+  
Sbjct: 175 EKYTRDLYQRGTEIAASRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYAEGYQDR 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                    L K+F+R W++      +D   IP++ +  I   S+ YI  YE I G KF+
Sbjct: 235 QNNEEEQKQLSKEFVRRWLIENGFQGQDGQEIPEMNQEYITSVSERYIELYENILGEKFV 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +      +RI  N+ +Y   
Sbjct: 295 KADISS-INDRIEKNVLEYLQN 315


>gi|260062628|ref|YP_003195708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Robiginitalea biformata HTCC2501]
 gi|88784195|gb|EAR15365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Robiginitalea biformata HTCC2501]
          Length = 316

 Score =  289 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 122/319 (38%), Positives = 173/319 (54%), Gaps = 12/319 (3%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+      P     Y GKVRE Y+L +   + +ATDRLSAFD  +   IPYKG++LNQ
Sbjct: 3   QTLTDTNFEFPGQQRVYKGKVREVYYLENNLLVMVATDRLSAFDVVMPRGIPYKGQILNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I       T D+  N  L  PDPNV VG   + F +E+++RGYLAG+        Y  GK
Sbjct: 63  IATRMMQATEDLVPNWLLATPDPNVAVGVHCEPFKVEMVIRGYLAGHAARE----YAAGK 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R++    LP+ M +N   P P+ITP TK+ +     D+ IS   I+ RG+++   +  + 
Sbjct: 119 RELCGVPLPEGMRENDAFPEPIITPATKAEKG--DHDEDISREGILERGLVSAEDYAVLE 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y   LF+RG +LA E GL+LVD+KYEFG      I+L DEIHTPDSSRY+    Y +  
Sbjct: 177 DYTRKLFQRGTQLAAERGLLLVDTKYEFGKTPDGRIVLIDEIHTPDSSRYFYASGYRERQ 236

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           + G     L K+F+R W++      +    +P++ +  I   S  YI  YEKITG+ F  
Sbjct: 237 QRGEAQKQLSKEFVRQWLIANGFQGKPGQEVPEMTDAYIDTVSNRYIELYEKITGVPFAG 296

Query: 297 DNSELPPLERIRNNLRKYT 315
            ++      RI  N+  Y 
Sbjct: 297 ADTS-DIPGRIEKNVLGYL 314


>gi|294673466|ref|YP_003574082.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           ruminicola 23]
 gi|294473413|gb|ADE82802.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           ruminicola 23]
          Length = 318

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 126/327 (38%), Positives = 183/327 (55%), Gaps = 14/327 (4%)

Query: 1   MRILSKAYIP--ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFKFAGQKSVYHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +GI++   +  +
Sbjct: 117 CRELCGVKLPDGMKENERFPEPIITPTTKADEG---HDMNISKEEIIAQGIVSAEDYAIM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   +F RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKIFARGQEIAAKRGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S+ YI  YE I G KF 
Sbjct: 233 LAKGEPQRQLSKEFVRQWLIEHDFMNEPGQTMPEITDEYAESVSERYIELYEHIVGEKFE 292

Query: 296 ADNSELPPLERIRNNLRKYTHRHLSSR 322
            +NS+    +RI  N+ ++      SR
Sbjct: 293 RENSDEDIAQRIEKNVSEWLA-AFKSR 318


>gi|256841382|ref|ZP_05546889.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides sp. D13]
 gi|256737225|gb|EEU50552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides sp. D13]
          Length = 316

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 131/316 (41%), Positives = 185/316 (58%), Gaps = 11/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 8   TDFNFPRQKSVYHGKVRDVYNINDEVLVMVATDRISAFDVILPEGIPYKGQMLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  L  PDP V VG Q Q FP+E+IVRGYL G+        YK+G R+I  
Sbjct: 68  LDATTDICPNWKLATPDPMVTVGVQCQGFPVEMIVRGYLCGSAW----RAYKSGVREICG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQ  P P+ITPTTK+       DQ IS  EI+ +G++++  +E +  Y ++
Sbjct: 124 VKLPEGMRENQHFPEPIITPTTKAEIGE--HDQDISKEEILAKGLVSKEDYEVLEKYTMA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE  F +G  
Sbjct: 182 LFKRGTEIAKERGLILVDTKYEFGH-RDGKIYLIDEIHTPDSSRYFYSEGYEDRFAKGEP 240

Query: 244 PIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +    +P++   I+   S  YI  +E ITG  F+   ++ 
Sbjct: 241 QKQLSKEFVREWLMENGFQGKSGQKVPEMTPEIVEGISNRYIELFEHITGETFVKGETD- 299

Query: 302 PPLERIRNNLRKYTHR 317
             L RI  N+ +Y   
Sbjct: 300 NLLNRIEKNVTEYLQN 315


>gi|300175735|emb|CBK21278.2| unnamed protein product [Blastocystis hominis]
          Length = 475

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 138/313 (44%), Positives = 189/313 (60%), Gaps = 8/313 (2%)

Query: 2   RILSKAYIPEL--PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQI 59
             LSK  +  +   N Y GKVR+ +  +D   + I TDR+S FD+ +  +P+KG+VLN  
Sbjct: 164 NTLSKTNLEGINVQNLYIGKVRDRFECND-KVVLITTDRMSGFDRQLCTVPFKGQVLNLT 222

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           + +WF  T  I  NH L  PD NV +G++   FPIE ++RGY+ G+T TSL T Y+NG R
Sbjct: 223 SAWWFKQTEHIVPNHVLAIPDANVTIGRKCTPFPIEFVMRGYITGSTSTSLWTNYQNGVR 282

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
           K     LP+ +  NQKL   +ITPTTKS E     D+ ISP +++ RG +++  W+  + 
Sbjct: 283 KYCGIDLPEGLKKNQKLWENLITPTTKSDE----HDELISPEDVVKRGFMSQEDWDYCAQ 338

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            A  LF  G K+A E+GLILVD+KYEFG D+   I L DEIHTPDSSRYW   TYE  F 
Sbjct: 339 KARELFAFGQKVADEHGLILVDTKYEFGKDENGMIRLIDEIHTPDSSRYWISSTYEARFA 398

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADN 298
            G  P  +DK+F+R W  T C+PY+D  IP+ P +++   S+ YI  YE ITG  F    
Sbjct: 399 AGENPDNIDKEFLRTWYRTHCDPYKDEVIPEAPADLVNELSRRYIQLYELITGEDFRFPE 458

Query: 299 SELPPLERIRNNL 311
                 +RI +N+
Sbjct: 459 DGRNAADRIHDNV 471


>gi|150008601|ref|YP_001303344.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides distasonis ATCC 8503]
 gi|255014399|ref|ZP_05286525.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_7]
 gi|262383451|ref|ZP_06076587.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_33B]
 gi|298376133|ref|ZP_06986089.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_19]
 gi|301309499|ref|ZP_07215441.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 20_3]
 gi|149937025|gb|ABR43722.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Parabacteroides distasonis ATCC 8503]
 gi|262294349|gb|EEY82281.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_33B]
 gi|298267170|gb|EFI08827.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_19]
 gi|300832588|gb|EFK63216.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 20_3]
          Length = 316

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 130/316 (41%), Positives = 186/316 (58%), Gaps = 11/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +
Sbjct: 8   TDFNFPRQKSVYHGKVRDVYNINDEVLVMVATDRISAFDVILPEGIPYKGQMLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DIC N  +  PDP V VG Q Q FP+E+IVRGYL G+        YK+G R+I  
Sbjct: 68  LDATTDICPNWKMATPDPMVTVGVQCQGFPVEMIVRGYLCGSAW----RAYKSGVREICG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQ+ P P+ITPTTK+       DQ IS  EI+ +G++++  +E +  Y ++
Sbjct: 124 VKLPEGMRENQRFPEPIITPTTKAEIGE--HDQDISKEEILAKGLVSKEDYEVLEKYTMA 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE  F +G  
Sbjct: 182 LFKRGTEIAKERGLILVDTKYEFGH-RDGKIYLIDEIHTPDSSRYFYSEGYEDRFAKGEP 240

Query: 244 PIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +    +P++   I+   S  YI  +E ITG  F+   ++ 
Sbjct: 241 QKQLSKEFVREWLMENGFQGKSGQKVPEMTPEIVEGISNRYIELFEHITGETFVKGETD- 299

Query: 302 PPLERIRNNLRKYTHR 317
             L RI  N+ +Y   
Sbjct: 300 NLLNRIEKNVTEYLQN 315


>gi|288928099|ref|ZP_06421946.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 317 str. F0108]
 gi|288330933|gb|EFC69517.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 317 str. F0108]
          Length = 316

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 121/322 (37%), Positives = 175/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L++         + Y GKVR+ Y +     + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTQTNFHFAGQKSVYHGKVRDVYDIDGDKIVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YKNG
Sbjct: 61  QIAAKFLDLTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP  M +N++ P P++TPTTK+ E     D  IS  EII +G+++   +  +
Sbjct: 117 CRELCGVKLPGGMKENERFPEPIVTPTTKADEG---HDLNISKEEIIAQGLVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF RG ++A ++GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDYTKKLFRRGQEIAAKHGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG  F 
Sbjct: 233 LAKGEPQRQLSKEFLRQWLIEHNFMNEPGQTMPEITDEYAEEVSNRYIELYEHITGETFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+ +Y  +
Sbjct: 293 KAADEADLAARIEKNVTEYLAQ 314


>gi|328675566|gb|AEB28241.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase /
           Phosphoribosylamine--glycine ligase [Francisella cf.
           novicida 3523]
          Length = 770

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 138/317 (43%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y+GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYTGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +  PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIASPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G + ALE+GLIL D+KYEFG+D+K   IIL DE+HTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQQKALEHGLILADTKYEFGVDEKTGEIILIDELHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|260911920|ref|ZP_05918485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 472 str. F0295]
 gi|260633943|gb|EEX52068.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 472 str. F0295]
          Length = 316

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 173/322 (53%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L++         + Y GKVR+ Y +     + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTQTDFHFAGQKSVYHGKVRDVYDIDGDKIVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIAAKFLDLTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YKKG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E     D  IS  EII +G+++   +  +
Sbjct: 117 CRELCGVKLPDGMKENERFPEPIVTPTTKADEG---HDLNISKEEIIAQGLVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDYTKKLFRRGQEIAAKQGLILVDTKYEFGK-RDGKVYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S  YI  YE ITG  F 
Sbjct: 233 LAKGEPQRQLSKEFLRQWLIEHNFMNEPGQTMPEITDEYAEEVSNRYIELYEHITGETFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+  +  +
Sbjct: 293 KAADEADLAARIEKNVTDFLAK 314


>gi|225459162|ref|XP_002285714.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142022|emb|CBI19225.3| unnamed protein product [Vitis vinifera]
          Length = 388

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 140/321 (43%), Positives = 193/321 (60%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 71  NCLSETNLHLTVPALKSKTRGKVRDVYDGGD-YLVLVTTDRQSAFDRVLASIPFKGQVLN 129

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF  T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T YKNG
Sbjct: 130 ETSLWWFDKTQHIAPNAVVSAPDKNVTIAKKCSVFPVEFVVRGYVTGSTDTSLWTVYKNG 189

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      LPD M  NQKLP  ++TPTTK+    +  D PI+P+EI+  G++T+  ++ +
Sbjct: 190 VRNYCGNALPDGMVKNQKLPANILTPTTKA----ADHDVPIAPDEIVKLGLMTQADYDEV 245

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G  +ALE+GLILVD+KYEFG      ++L DE+HTPDSSRYW   +YE+ 
Sbjct: 246 SRKALSLFEYGQHVALEHGLILVDTKYEFGKGSDGTVLLIDEVHTPDSSRYWIANSYEER 305

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           FR GI P  +DK+F+R W    CNPY D + PD P  ++   +  Y+  YE IT  KF  
Sbjct: 306 FRNGIEPENVDKEFLRLWFREHCNPYEDEVLPDAPTELVSELAWRYVFLYETITNSKFEI 365

Query: 297 DNSELPPLERIRNNLRKYTHR 317
              E P  +RI  N+      
Sbjct: 366 PLMEEPIHDRISRNVSLALAS 386


>gi|325278982|ref|YP_004251524.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Odoribacter splanchnicus DSM 20712]
 gi|324310791|gb|ADY31344.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Odoribacter splanchnicus DSM 20712]
          Length = 314

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 126/322 (39%), Positives = 187/322 (58%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + K     P   + Y GKVR+ Y ++D   + + +DR+SAFD  +   +PYKG+VLN
Sbjct: 1   MDAIVKTDFCFPGQKSVYKGKVRDVYDINDEYLVMVVSDRISAFDVILPEGVPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DI  N  +  PDP V VG + + F +E+++RGYL G++       YK+G
Sbjct: 61  QIASKFLDATADIVPNWKIATPDPMVTVGHKCEPFKVEMVIRGYLTGSSW----RAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    LP+ M +NQK   P+ITPTTK+ E     D+ IS  EII +G+++R  +E +
Sbjct: 117 ERTLCGLPLPEGMRENQKFDSPLITPTTKADEG---HDENISKEEIIAQGLVSREDYELM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EKYTYALFQRGTEIAAEKGLILVDTKYEFGK-KNGRIYLIDEIHTPDSSRYFYAEGYEER 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +    +P++   ++   +  YI  YE ITG KF+
Sbjct: 233 FAKGEKQKQLSKEFVREWLMDNGFQGQAGQKVPEMTPAVVAGITDRYIELYEHITGQKFV 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +S    L+RI +N+      
Sbjct: 293 KADS-THVLKRIEDNVNACLKT 313


>gi|298372465|ref|ZP_06982455.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275369|gb|EFI16920.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroidetes oral taxon 274 str. F0058]
          Length = 314

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 126/322 (39%), Positives = 177/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L K     P     Y+GKVR+ Y +     + I TDR+SAFD  +   IP+KG++LN
Sbjct: 1   MNALIKTSYRFPNQTTVYNGKVRDVYTIGGKELVMITTDRISAFDVVMPRGIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N     PDP V  G   + FPIE+IVRGYL G+        YK G
Sbjct: 61  QIAAKFLDETKDICPNWKCATPDPMVTCGIMCKGFPIEMIVRGYLCGSAWRD----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + I    +PD M +N+K P P++TPTTK+       D+ IS  EII +G+++   +  +
Sbjct: 117 AKTISGVPIPDGMRENEKFPTPIVTPTTKAELG--RHDENISKEEIIAQGLVSAEDYAVV 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             YAL+LFERG ++A   GLILVD+KYEFG      I L DE+HTPDSSRY+   TY + 
Sbjct: 175 ERYALALFERGTQIADRRGLILVDTKYEFGT-ADGTIYLMDEVHTPDSSRYFYKNTYREL 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F  G     L K+F+R W++      ++   IP++ + ++   S+ Y   YE+ITG KF 
Sbjct: 234 FEAGKPQRQLSKEFVRQWLMDNGFQGKEGQKIPEMTDEVVRGISERYRELYEQITGEKFT 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +      +RI  N+  Y  +
Sbjct: 294 VSD-NEDIEQRIEKNVLNYLSK 314


>gi|313202976|ref|YP_004041633.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paludibacter propionicigenes WB4]
 gi|312442292|gb|ADQ78648.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paludibacter propionicigenes WB4]
          Length = 315

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 123/322 (38%), Positives = 188/322 (58%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L+          N Y GKVR+ Y + +   + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MNALTNTDFHFDGQTNVYHGKVRDVYTVKNDLLVMVATDRISAFDVVLPKGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DI  N  L  PDP V VG + + +P+E+IVRGYL G+   +    YK+G
Sbjct: 61  QIAAKFLDATADIVPNWKLASPDPMVTVGLRCEGYPVEMIVRGYLCGSAWRT----YKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    +PD M +NQ+ P P+ITPTTK+       D+ I+ +EI+ +G+++  ++E +
Sbjct: 117 VREICGVKIPDGMRENQRFPQPIITPTTKAELG--RHDEDITRDEILSQGLVSVEEYEML 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y + LF RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+ V++Y++ 
Sbjct: 175 EKYTMELFMRGTEIAAKRGLILVDTKYEFGR-RDGKIYLIDEIHTPDSSRYFYVDSYQEL 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D  ++P++   I+   S+ YI  +E I+G  F 
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKDGQSVPEMTPEIVAGISERYIELFENISGESFD 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +      +RI  N+  Y   
Sbjct: 294 KAD-IADISKRIEKNVVDYLKT 314


>gi|56707995|ref|YP_169891.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670466|ref|YP_667023.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           FSC198]
 gi|224457077|ref|ZP_03665550.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370478|ref|ZP_04986483.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254874795|ref|ZP_05247505.1| purC/purD fusion protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604487|emb|CAG45527.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320799|emb|CAL08910.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151568721|gb|EDN34375.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254840794|gb|EET19230.1| purC/purD fusion protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159183|gb|ADA78574.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 770

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 142/317 (44%), Positives = 198/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YIA +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYIALFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|228474075|ref|ZP_04058816.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga gingivalis ATCC 33624]
 gi|228274589|gb|EEK13430.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga gingivalis ATCC 33624]
          Length = 317

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 124/324 (38%), Positives = 177/324 (54%), Gaps = 12/324 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++          + Y GKVR+ Y + +   + I TDRLSAFD  +   IP+KG++LN
Sbjct: 1   MNSITSTDFSFENQKSLYKGKVRDVYSIGEDLLVMITTDRLSAFDVILPKGIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T DI  N  L  PDPNV VG +   F +E+++RGYLAG+        Y+ G
Sbjct: 61  QIASECMEQTKDIVPNWLLATPDPNVSVGMRCTPFKVEMVIRGYLAGHAARE----YQAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    LP+ + +N   P P+ITP+TK+       D+ IS   I+ RGI++   +  I
Sbjct: 117 KRTLCGVTLPEGLQENAPFPSPIITPSTKAENG--LHDEDISRENILKRGIVSEEDYAVI 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG +LAL+ GLILVD+KYEFG  K+  I+L DE HTPDSSRY+  + YE+ 
Sbjct: 175 EKYTYDLFKRGSQLALQRGLILVDTKYEFGKTKEGTIVLIDEAHTPDSSRYFYADGYEER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
            + G     L K+F+R W++      R    IP++    +   S+ YI  YE + G KFI
Sbjct: 235 LKRGEPQKQLSKEFVRQWLIENGFQGRPGEKIPEMTAAHVASISERYIELYEHLLGKKFI 294

Query: 296 ADNSELPPLERIRNNLRKYTHRHL 319
             ++     ERI  N+ +Y    L
Sbjct: 295 KSDT-TNIQERIYKNVSEYLRSLL 317


>gi|134302215|ref|YP_001122184.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134049992|gb|ABO47063.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 770

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 142/317 (44%), Positives = 198/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YIA +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYIALFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|254373858|ref|ZP_04989340.1| fusion protein PurC/PurD [Francisella novicida GA99-3548]
 gi|151571578|gb|EDN37232.1| fusion protein PurC/PurD [Francisella novicida GA99-3548]
          Length = 770

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 198/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R+ 
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSREY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|146300478|ref|YP_001195069.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacterium johnsoniae UW101]
 gi|146154896|gb|ABQ05750.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacterium johnsoniae UW101]
          Length = 317

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 119/318 (37%), Positives = 179/318 (56%), Gaps = 10/318 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
             +    P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI  
Sbjct: 6   TTTNFNFPNQKSVYRGKVREVYNINDELLVMVATDRLSAFDVVLPKGIPYKGQILNQIAT 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
            +   T DI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  G+++I
Sbjct: 66  KFMELTQDIVPNWLIATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YAAGRKQI 121

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               + + + +N K P P+ITPTTK+   +   D+ IS   I+ +GI++   +  +  Y 
Sbjct: 122 CGVTMAEGLKENDKFPEPIITPTTKADNGS--HDEDISREAILSKGIISEEDYLVLEKYT 179

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
            +LF+RG ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y +   +G
Sbjct: 180 RALFQRGTEIAASRGLILVDTKYEFGKTKDGVIVLIDEIHTPDSSRYFYADGYAERQEKG 239

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
                L K+F+R W++      ++   IPD+ +  I   S+ YI  YE I G KF+  + 
Sbjct: 240 EEQKQLSKEFVRRWLIENGFQGQEGQQIPDMSDEYIESVSERYIELYENILGEKFVKADI 299

Query: 300 ELPPLERIRNNLRKYTHR 317
           +    +RI  N+ +Y   
Sbjct: 300 D-NIDQRIEKNVLQYLTS 316


>gi|307565641|ref|ZP_07628119.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           amnii CRIS 21A-A]
 gi|307345673|gb|EFN91032.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           amnii CRIS 21A-A]
          Length = 316

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 173/322 (53%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L++         + Y GKVR+ Y + +   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTQTNFNFDGQKSVYHGKVRDVYDIDNDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G+        Y+ G
Sbjct: 61  QIASKFLDQTKDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YQKG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CREICGVKLPDGMRENERFPEPIITPTTKADEG---HDMNISREEIIAQGIVSEEDYNII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   +F RG ++A ++GLILVD+KYEFG  +     L DE+HTPDSSRY+  E YE+ 
Sbjct: 174 EEWTRKIFARGQEIAAKHGLILVDTKYEFGK-RNGQCYLIDEVHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            ++G     L K+F+R W++           +P I +      S  YI  YE ITG  F 
Sbjct: 233 LKKGEPQRQLSKEFVRQWLIDHNFMNEPGQTMPYISDEYAESVSNRYIELYEHITGEPFK 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI  N++ Y  +
Sbjct: 293 KQEYTGDIARRIEENVKDYLAK 314


>gi|17978592|gb|AAL48317.1| succinoaminoimidazolecarboximide ribonucleotide synthetase [Vigna
           unguiculata]
          Length = 402

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 138/321 (42%), Positives = 196/321 (61%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 85  NCLSETNLHNTVPGLVSKTRGKVRDIYDAGD-YLVLVTTDRQSAFDRILASIPFKGQVLN 143

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF  T  I  N  +  PD NV + ++  +FP+E + RG++ G+T TSL T Y  G
Sbjct: 144 ETSLWWFERTKQIVPNAVVSAPDKNVTIAKKCSVFPVEFVARGFVTGSTDTSLWTVYNKG 203

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R     +LPD M  NQKL   ++TPTTK+    +  D P++P+EII RG++TR+ +E +
Sbjct: 204 SRNYCGNVLPDGMVKNQKLSENILTPTTKA----ADHDVPVTPDEIIERGLMTRSDYEAV 259

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G ++A E+GLILVD+KYEFG     +I+L DE+HTPDSSRYW   +Y + 
Sbjct: 260 SEKALSLFEYGQQVASEHGLILVDTKYEFGKANDGSIMLIDEVHTPDSSRYWIANSYLER 319

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F+ G+ P  +DK+F+R W  + CNPY D + PD PE+++   S  YI  YE IT  KF  
Sbjct: 320 FQNGLEPENIDKEFLRLWFKSHCNPYEDEVLPDAPEDLVCELSWRYIFLYETITNSKFEM 379

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             +E P  +RI  N+      
Sbjct: 380 PLTEEPIHDRISRNVASALSS 400


>gi|255087808|ref|XP_002505827.1| predicted protein [Micromonas sp. RCC299]
 gi|226521097|gb|ACO67085.1| predicted protein [Micromonas sp. RCC299]
          Length = 375

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 131/317 (41%), Positives = 185/317 (58%), Gaps = 7/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             ++ + +      Y GKVR+ Y + D   I + TDR SAFD+++A IP+KG VLN+ + 
Sbjct: 65  NCVTSSDLK-YGQKYEGKVRDTY-VDDELMIAVTTDRQSAFDRHLASIPFKGAVLNRTSA 122

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF+ T DI  N  +  PDPNV V ++  +FPIE +VRGYL G+T TSL T Y  G R  
Sbjct: 123 WWFNQTKDIVPNAWISSPDPNVTVMKKCTVFPIEFVVRGYLTGSTSTSLWTHYSKGGRDY 182

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               L D M  NQKLP  ++TPTTK  E     D+PIS  +I+  G + ++  +   +  
Sbjct: 183 CGNPLADGMVKNQKLPKNIVTPTTKEKE----HDRPISLADIVSEGWMEKDDLDYCVAKT 238

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L +FE   ++A E GLILVD+KYEFG D    I L DEI+TPDSSRYW  ++Y +    G
Sbjct: 239 LEVFEFAQRVAAERGLILVDTKYEFGRDADGVIRLIDEINTPDSSRYWLADSYAERHAAG 298

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W   RC+PY D  +P  P+ +++  SQ YI  YE ITG  F     +
Sbjct: 299 LEPDMIDKEFLRLWFAERCDPYNDETLPAAPDELVVELSQRYIKLYEMITGETFEVPPLD 358

Query: 301 LPPLERIRNNLRKYTHR 317
           +    RI  N+ +   +
Sbjct: 359 VDVKSRIDENVGRALGK 375


>gi|254372387|ref|ZP_04987877.1| hypothetical protein FTCG_01611 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570115|gb|EDN35769.1| hypothetical protein FTCG_01611 [Francisella novicida GA99-3549]
          Length = 770

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|118497027|ref|YP_898077.1| SAICAR synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. novicida U112]
 gi|194324262|ref|ZP_03058036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella tularensis subsp. novicida FTE]
 gi|118422933|gb|ABK89323.1| SAICAR synthetase/phosphoribosylamine-glycine ligase [Francisella
           novicida U112]
 gi|194321709|gb|EDX19193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella tularensis subsp. novicida FTE]
          Length = 770

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|254368656|ref|ZP_04984670.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica FSC022]
 gi|157121571|gb|EDO65748.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica FSC022]
          Length = 770

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|328676491|gb|AEB27361.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase /
           Phosphoribosylamine--glycine ligase [Francisella cf.
           novicida Fx1]
          Length = 770

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 196/317 (61%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y  
Sbjct: 307 LENINQRIVKNVTDYLS 323


>gi|208780484|ref|ZP_03247824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella novicida FTG]
 gi|208743630|gb|EDZ89934.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella novicida FTG]
          Length = 770

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 196/317 (61%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y  
Sbjct: 307 LENINQRIVKNVTDYLS 323


>gi|188994840|ref|YP_001929092.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis ATCC 33277]
 gi|188594520|dbj|BAG33495.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis ATCC 33277]
          Length = 313

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 125/319 (39%), Positives = 181/319 (56%), Gaps = 14/319 (4%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
             L++    +P     Y GKVR+ Y L +   + IATDR+SAFD  +   IPYKG+VLNQ
Sbjct: 3   ETLARTDFRLPGQKAVYHGKVRDVYTLENDLLVMIATDRISAFDVVLPAGIPYKGQVLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I  ++   T DI  N  +  PDP V +G + + F +E+++RGY+ G+        Y  G+
Sbjct: 63  IAAHYLDATRDIVPNWKIATPDPMVTIGHRCEPFKVEMVIRGYITGSAW----RAYAAGE 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ M +NQ+  +P+ITPTTK+ E     D+ IS  EII +G++++  +E I 
Sbjct: 119 RVLCGLPLPEGMRENQRFEHPIITPTTKADEG---HDENISREEIIAQGLVSKEDYEQIE 175

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y  +LFERG ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ F
Sbjct: 176 RYTYALFERGTQMAAEKGLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYAEGYQERF 234

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             G     L K+F+R W++      +    IP++ E      S+ YI  YE++ G  F  
Sbjct: 235 ERGEAQKQLSKEFVRQWLIENGFQGKPGQQIPEMTEAYCDSVSERYIELYERVVGKPFEK 294

Query: 297 DNSELPPLERIRNNLRKYT 315
            +      ERI  N+ +Y 
Sbjct: 295 ADLS-NLAERIEKNITEYL 312


>gi|299140688|ref|ZP_07033826.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris C735]
 gi|298577654|gb|EFI49522.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris C735]
          Length = 316

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 178/322 (55%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDIC N  +  PDP V VG + + F +E+I+R  L G+   S    YK G
Sbjct: 61  QIAAKFLDATSDICPNWKMATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRS----YKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +N+K P P++TPTTK+ E     D  IS  EII +GI+++  +E I
Sbjct: 117 CRELCGVKLPEGMRENEKFPEPIVTPTTKADEG---HDLNISKEEIIAQGIVSKEDYEII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDYTKKLFKRGQEIAAKQGLILVDTKYEFGK-RDGKIYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++           +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LAAGKPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDEYADSVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI NN+  Y   
Sbjct: 293 RSIECGDIAARIENNVATYLKT 314


>gi|187931295|ref|YP_001891279.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|187712204|gb|ACD30501.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. mediasiatica FSC147]
          Length = 770

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 141/317 (44%), Positives = 196/317 (61%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    +  + N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNLA-IKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|304382671|ref|ZP_07365165.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella marshii DSM 16973]
 gi|304336296|gb|EFM02538.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella marshii DSM 16973]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 121/322 (37%), Positives = 176/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y + +   + +ATDR+SAFD  +   IPYKG+VLN
Sbjct: 1   MKALTKTDFHFKGQKSVYHGKVRDVYDIDNDLIVMVATDRISAFDVVLPKGIPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG + + F +E+I+R  L G+        YKNG
Sbjct: 61  QIAAKFLDLTADICPNWKMATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRE----YKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +G+++   +  I
Sbjct: 117 CRELCGVRLPDGMKENERFPEPIITPTTKADEG---HDMNISKEEIIAQGLVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y   +F+RG ++A   GLILVD+KYEFG  +   + L DE+HTPDSSRY+  + YE+ 
Sbjct: 174 ENYTRKIFKRGQEIAAHQGLILVDTKYEFGK-RDGKVYLIDEVHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
            ++G     L K+F+R W++           +P+I +      S  YI  YE ITG  F 
Sbjct: 233 LKKGEPQRQLSKEFVRQWLIDHNFMNEPGQVMPEITDTYAQSVSDRYIELYEHITGEPFN 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI  N+  Y  +
Sbjct: 293 RSTETGDIAARIHRNVSAYLAQ 314


>gi|332886266|gb|EGK06510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dysgonomonas mossii DSM 22836]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 126/316 (39%), Positives = 181/316 (57%), Gaps = 12/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +  +     N Y GKVR+ Y + +   + IATDR+SAFD  +   IPYKG+VLNQI   +
Sbjct: 8   TNFHFNGQTNVYHGKVRDVYSVGNDLLVMIATDRISAFDVVLPKGIPYKGQVLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DI  N  L  PDP V  G + + + +E+++RGYL G+        YK G R +  
Sbjct: 68  LDATADIVPNWKLATPDPMVTTGLRCEPYKVEMVIRGYLTGSAWRE----YKAGARTLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +NQK P P+ITPTTK+ E     D+ IS  EII +G+++R ++E +  Y  +
Sbjct: 124 VSLPEGMKENQKFPTPIITPTTKADEG---HDENISKEEIIAQGLVSREEYEQLEKYTYA 180

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A +  LILVD+KYEFG  K   I L DEIHTPDSSRY+  +TY+  F +G  
Sbjct: 181 LFQRGTEMAAQKNLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYTDTYQDLFEKGEE 239

Query: 244 PIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +    +P++ E      S+ YI  YEKI G  FI  +   
Sbjct: 240 QRQLSKEFVRKWLMDNGFQGKEGQTVPEMTEEYCNSVSERYIELYEKIVGEPFIKADVS- 298

Query: 302 PPLERIRNNLRKYTHR 317
              ERI  N+ +Y  +
Sbjct: 299 NVSERIEENISRYLKK 314


>gi|332827678|gb|EGK00417.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dysgonomonas gadei ATCC BAA-286]
          Length = 316

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 125/316 (39%), Positives = 182/316 (57%), Gaps = 12/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   N Y GKVR+ Y + D   + IATDR+SAFD  +   IPYKG+VLNQI   +
Sbjct: 8   TDFNFPGQTNVYHGKVRDVYSIGDDLLVMIATDRISAFDVVLPQGIPYKGQVLNQIAAKF 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DI  N  LD PDP V VG + + + +E+++RGYL G+        YK G R +  
Sbjct: 68  LDATADIVPNWKLDTPDPMVTVGLRCEQYKVEMVIRGYLTGSAWRE----YKAGARTLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ M +N+K P P+ITPTTK        D+ IS  EII +G++++ ++E +  Y  +
Sbjct: 124 VPLPEGMKENEKFPTPIITPTTKEDVG---HDENISKEEIIAQGLVSKEEYEQLEKYTYA 180

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A +  LILVD+KYEFG  +   I L DEIHTPDSSRY+  +TY++ F +G  
Sbjct: 181 LFQRGTEMAAQKNLILVDTKYEFGKKEG-KIYLIDEIHTPDSSRYFYADTYQELFDKGEE 239

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +D   +P++ E      S+ YI  YEKI G KF+      
Sbjct: 240 QRQLSKEFVRKWLMDNGFQGKDGQKVPEMTEEYCNSVSERYIELYEKIVGEKFVKA-EAA 298

Query: 302 PPLERIRNNLRKYTHR 317
               R+  N+ +Y  +
Sbjct: 299 DVAVRLEKNINEYLKQ 314


>gi|298208245|ref|YP_003716424.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Croceibacter atlanticus HTCC2559]
 gi|83848166|gb|EAP86036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Croceibacter atlanticus HTCC2559]
          Length = 316

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 126/323 (39%), Positives = 177/323 (54%), Gaps = 12/323 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++++    P   + Y GKVR+ Y L+DG  + +A+DRLSAFD  +   IPYKG++LN
Sbjct: 1   MNTITESNFTFPGQTDVYKGKVRDVYTLNDGRLVMVASDRLSAFDVVMPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T D+  N     PDPNV VG   + F +E+++RGYL+G+        YK G
Sbjct: 61  QIATKMMAATEDLVPNWLQATPDPNVAVGIACEPFKVEMVIRGYLSGHAARE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    +PD M +N K P P+ITP TK+ +     D+ IS  +I+ RGI+++  +  +
Sbjct: 117 KRILCGVAMPDGMKENDKFPEPIITPATKAEKG--DHDEDISKEDILKRGIVSKEDYTVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG +LA + GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y   
Sbjct: 175 EDYTKKLFKRGSELADKRGLILVDTKYEFGKTLDGKILLIDEIHTPDSSRYFYKEGYADR 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++           IP++ +  I   S  YI  YE ITG  FI
Sbjct: 235 QNAGEAQKQLSKEFVRQWLIANDFQGFEGQTIPEMSDAYIKSVSDRYIELYENITGEAFI 294

Query: 296 ADNSELPPLERIRNNLRKYTHRH 318
             +       RI  NL +Y   +
Sbjct: 295 KSDIS-NITSRISKNLIEYLKEN 316


>gi|37983622|gb|AAR06292.1| SAICAR synthetase [Nicotiana tabacum]
          Length = 399

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 131/321 (40%), Positives = 196/321 (61%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+ ++    P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 82  NCLSETHLDLTVPALKSKIRGKVRDIYDGGD-YLVMVTTDRQSAFDRILASIPFKGQVLN 140

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF+ T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G
Sbjct: 141 ETSLWWFNKTQHITPNAVVSVPDRNVTIARKCSVFPVEFVVRGYVTGSTDTSLWTVYNKG 200

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      LPD +  NQKL   ++TPTTK+    +  D P++P+EI+ RG++T+  ++ +
Sbjct: 201 LRNYCGNSLPDGLVKNQKLQENILTPTTKA----ADHDVPVTPDEIVQRGLMTQADYDEV 256

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  A+SLFE G ++AL++GLILVD+KYEFG      I L DE+HTPDSSRYW   +Y++ 
Sbjct: 257 SRKAISLFEFGQRVALDHGLILVDTKYEFGKGADGKIYLIDEVHTPDSSRYWIAHSYQER 316

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F+ G+ P  +DK+F+R W    CNPY D + PD PE ++   +  YI  +E IT  +F  
Sbjct: 317 FQSGLEPENIDKEFLRLWFKNHCNPYEDEVLPDAPEELVSELAWRYIFLFETITNSRFEM 376

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  +RI  N+ +    
Sbjct: 377 PGTKEPVHDRISRNVSQALSS 397


>gi|89255807|ref|YP_513169.1| fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314299|ref|YP_763022.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|156501787|ref|YP_001427852.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167009608|ref|ZP_02274539.1| fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           FSC200]
 gi|290952947|ref|ZP_06557568.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313858|ref|ZP_06804428.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|89143638|emb|CAJ78836.1| Fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129198|gb|ABI82385.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|156252390|gb|ABU60896.1| Phosphoribosylaminoimidazole-succinocarboxamide
           synthase/Phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica FTNF002-00]
          Length = 770

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 140/317 (44%), Positives = 196/317 (61%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ N Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTNL-DIKNKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQQQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G K ALE+GL L D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  
Sbjct: 187 LELFEFGQKKALEHGLFLADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKFEVPRD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 LENINQRIVKNVTDYLN 323


>gi|323345646|ref|ZP_08085869.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella oralis ATCC 33269]
 gi|323093760|gb|EFZ36338.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella oralis ATCC 33269]
          Length = 315

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 126/322 (39%), Positives = 174/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFEGQKSVYHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G+        YK+G
Sbjct: 61  QIAAKFLDATKDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTGSAW----RAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LPD M +N+    P++TPTTK+ E     D  IS  EII +GI++   +  I
Sbjct: 117 CRDLCGVKLPDGMRENECFKEPIVTPTTKADEG---HDMNISREEIISQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFGKRSG-KIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 FEKGEPQRQLSKEFVRQWLIEHNFMNEPGQQMPEITDEYAESVSERYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E     RI  N+  Y   
Sbjct: 293 KAVEEGNIAARIEKNVAAYLAS 314


>gi|330836825|ref|YP_004411466.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta coccoides DSM 17374]
 gi|329748728|gb|AEC02084.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta coccoides DSM 17374]
          Length = 336

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 145/318 (45%), Positives = 191/318 (60%), Gaps = 9/318 (2%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L++  +P  PN   GKVR+ Y L +G  + + TDR SAFD+ +A IP+KG+VLN ++ +
Sbjct: 19  TLTETNLP-YPNRKVGKVRDRYDLGNGRLLFVTTDRQSAFDRVLASIPFKGQVLNMVSAW 77

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T DI  NH L  PDP V + +   + PIE +VRGY+ G+T TSL T YK G+R   
Sbjct: 78  WFARTKDIIGNHLLSTPDPCVTISRACTVLPIEFVVRGYITGSTDTSLWTHYKKGERTYC 137

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               PD +  NQKL  PVITPTTK        D+PISP EII  G L++N W+  S+ AL
Sbjct: 138 GVNFPDGLKKNQKLEQPVITPTTKED----AHDRPISPAEIIEEGWLSQNDWDEASAAAL 193

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF  G + A + GLILVD+KYEFG D    + L DEIHTPDSSRYW  ++YE  F  G 
Sbjct: 194 ALFRFGTEEAAKKGLILVDTKYEFGRDADGILRLIDEIHTPDSSRYWLGDSYENRFATGH 253

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE- 300
            P  +DK+F+R W    C+PY+D + P  P +++   S  YI  YE ITG KFI  + + 
Sbjct: 254 EPENIDKEFLRLWFTKVCDPYKDEVLPPAPMDLVAELSTRYIRLYEMITGEKFIFPDEDS 313

Query: 301 --LPPLERIRNNLRKYTH 316
               P ER+  NL     
Sbjct: 314 MKESPYERLTRNLSAALE 331


>gi|34540724|ref|NP_905203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis W83]
 gi|39931717|sp|Q7MVR8|PUR7_PORGI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|34397038|gb|AAQ66102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Porphyromonas gingivalis W83]
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 125/319 (39%), Positives = 180/319 (56%), Gaps = 14/319 (4%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
             L++    +P     Y GKVR+ Y L +   + IATDR+SAFD  +   IPYKG+VLNQ
Sbjct: 3   ETLARTDFRLPGQKAVYHGKVRDVYTLENDLLVMIATDRISAFDVVLPAGIPYKGQVLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I  ++   T DI  N  +  PDP V +G + + F +E+++RGY+ G+        Y  G+
Sbjct: 63  IAAHYLDATRDIVPNWKIATPDPMVTIGHRCEPFKVEMVIRGYITGSAW----RAYAAGE 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ M +NQ+  +P+ITPTTK+ E     D+ IS  EII +G++++  +E I 
Sbjct: 119 RVLCGLPLPEGMRENQRFEHPIITPTTKADEG---HDENISRQEIIAQGLVSKEDYEQIE 175

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y  +LFERG ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ F
Sbjct: 176 RYTYALFERGTQMAAEKGLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYAEGYQERF 234

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             G     L K+F+R W++      +    IP + E      S+ YI  YE++ G  F  
Sbjct: 235 ERGEAQKQLSKEFVRQWLIENGFQGKPGQQIPKMTEAYCDSVSERYIELYERVVGKPFEK 294

Query: 297 DNSELPPLERIRNNLRKYT 315
            +      ERI  N+ +Y 
Sbjct: 295 ADLS-NLAERIEKNITEYL 312


>gi|167626637|ref|YP_001677137.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167596638|gb|ABZ86636.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           Phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 769

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 137/317 (43%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    + ++ + Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKATDL-DIKDKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +  PD NV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIASPDANVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQEQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G + ALE+GLIL D+KYEFG+D+K   IIL DEIHTPDSSR+W  ++Y + F  
Sbjct: 187 LELFEFGQQKALEHGLILADTKYEFGVDEKTGEIILIDEIHTPDSSRFWLKDSYAERFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D++ P  P+ +++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDDVLPQAPQELVVDLSQKYITLFEMITGQKFEVPVD 306

Query: 300 ELPPLERIRNNLRKYTH 316
                +RI  N+  Y +
Sbjct: 307 IKNISQRIAKNVANYLN 323


>gi|308811086|ref|XP_003082851.1| phosphoribosylimida (ISS) [Ostreococcus tauri]
 gi|116054729|emb|CAL56806.1| phosphoribosylimida (ISS) [Ostreococcus tauri]
          Length = 354

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 136/317 (42%), Positives = 189/317 (59%), Gaps = 11/317 (3%)

Query: 1   MRIL----SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVL 56
           M  +    + + +  +   Y+GKVR+ Y   D T I + TDR SAFD+++A IP+KG VL
Sbjct: 41  MEAMASCVTSSDL-GVGEKYAGKVRDTYVSGD-TMIAVTTDRQSAFDRHLAFIPFKGAVL 98

Query: 57  NQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           NQ +Q+WF  T+DI  N  L  PDPNV V ++ ++FPIE +VRGYL G+T TSL T YK 
Sbjct: 99  NQTSQWWFRQTADIVPNAVLATPDPNVTVMRRCEVFPIEFVVRGYLTGSTSTSLWTHYKK 158

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G R      L D M  NQKLP  ++TPTTK  E     D+PIS  +I+  G + +   + 
Sbjct: 159 GGRNYCGNELADGMVKNQKLPMNIVTPTTKEKE----HDRPISLEDIVKEGWMKQEDLDY 214

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
             +  L +FE    +A   GLILVD+KYEFG D    I L DEI+TPDSSRYW  ++Y +
Sbjct: 215 CVAKTLEVFEYAQGIAATRGLILVDTKYEFGRDSDGTIRLIDEINTPDSSRYWLNDSYAE 274

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFI 295
               G  P  +DK+F+R W   RC+PY+D + P+ P +++   S  Y+  YE ITG  F 
Sbjct: 275 RHAAGKEPDMIDKEFLRLWFAERCDPYKDEVLPEAPADLVAELSSRYVKLYEMITGETFE 334

Query: 296 ADNSELPPLERIRNNLR 312
              + +   ER+RN+L+
Sbjct: 335 VPPTSVDVNERMRNSLK 351


>gi|282877956|ref|ZP_06286765.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccalis ATCC 35310]
 gi|281299957|gb|EFA92317.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccalis ATCC 35310]
          Length = 316

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 172/322 (53%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYNINDDLIVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  +  PDP V VG + + F +E+I+R  L G+        Y  G
Sbjct: 61  QIAAKFLDSTKDICPNWKIATPDPMVTVGVKCEGFRVEMIIRSILTGSAWRE----YNAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E     D  IS  EII +GI+    +  I
Sbjct: 117 ARELCGVKLPDGMKENERFPEPIVTPTTKADEG---HDLNISKEEIISQGIVPAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF RG ++A + GLILVD+KYEFG  K   I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFARGQEIAAKQGLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++           +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 LAKGEPQKQLSKEFVRQWLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFK 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI  N+  Y   
Sbjct: 293 KAADHDDLAARIEKNVSDYLAS 314


>gi|295133687|ref|YP_003584363.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Zunongwangia profunda SM-A87]
 gi|294981702|gb|ADF52167.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Zunongwangia profunda SM-A87]
          Length = 315

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 118/315 (37%), Positives = 174/315 (55%), Gaps = 10/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ Y   D   + IA+DRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TDYNFPGQKSVYKGKVRDVYAFEDDQLVMIASDRLSAFDVVMPKGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T D+  N     PDPNV VG+  + F +E+++RGYL+G+        YK GKR +  
Sbjct: 68  MKDTEDLVPNWLQATPDPNVAVGEACEPFKVEMVIRGYLSGHAARE----YKAGKRTLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ M +N + P P+ITP TK+ +     D+ IS  +I+ RGI++   +  +  Y   
Sbjct: 124 VAMPEGMKENDRFPEPIITPATKAEQG--DHDEDISKEDILKRGIVSAEDYAVLEDYTKK 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+   TY++   +G  
Sbjct: 182 LFQRGTEIAEKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYANTYKELQEKGEP 241

Query: 244 PIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +    +P + +  I   S+ YI  YE ITG  F   +   
Sbjct: 242 QKQLSKEFVRQWLIQNGFQGKEGQEVPFMSDEYIETVSERYIELYENITGETFEKADVS- 300

Query: 302 PPLERIRNNLRKYTH 316
              +R+  N++ Y  
Sbjct: 301 NIEKRVEENVKAYLK 315


>gi|241667194|ref|ZP_04754772.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254875746|ref|ZP_05248456.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254841767|gb|EET20181.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 769

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 137/318 (43%), Positives = 197/318 (61%), Gaps = 8/318 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
            +L    +  + + Y GKVR+ YF  D + +  +TDR SAFD+++  IP+KG++L Q + 
Sbjct: 13  NVLKSTDL-NIKDKYIGKVRDMYFTDDKSILI-STDRQSAFDRSLGFIPFKGQILAQSSV 70

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ I  NH +  PD NV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R  
Sbjct: 71  WWFKETAHIVKNHFIASPDANVVIARKARVLPIEFVVRGYITGSTSTSLWTHYKNGSRDY 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LP+ +  NQKLP  ++TPTTK        D+PIS  +I+  G LT+ QW+  S  A
Sbjct: 131 CGNILPEGLKKNQKLPQNILTPTTK----EQDHDRPISAEDIVKEGWLTQEQWDFASQKA 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFRE 240
           L LFE G + ALE+GLIL D+KYEFG+D+K   IIL DEIHTPDSSR+W  ++Y + F  
Sbjct: 187 LELFEFGQQKALEHGLILADTKYEFGVDEKTGEIILIDEIHTPDSSRFWLKDSYVERFEN 246

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           G  P  +DK+F R W    C+PY D++ P  P+++++  SQ YI  +E ITG KF     
Sbjct: 247 GEEPENIDKEFFRLWFAKNCDPYNDDVLPQAPQDLVVDLSQKYITLFEMITGQKFEVPVD 306

Query: 300 ELPPLERIRNNLRKYTHR 317
                +RI  N+  Y + 
Sbjct: 307 IKNISQRIAKNVANYLNT 324


>gi|299137860|ref|ZP_07031041.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium sp. MP5ACTX8]
 gi|298600501|gb|EFI56658.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium sp. MP5ACTX8]
          Length = 317

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 133/300 (44%), Positives = 185/300 (61%), Gaps = 6/300 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P L   Y GKVR+ Y L DG  + + TDR S FD+ +  IP+KG+VLN+ + +W
Sbjct: 14  LTETNLPLLDK-YPGKVRDTYDLGDGRLLLVTTDRQSGFDRMLGAIPFKGQVLNRTSLHW 72

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T  I  NH L  P  N L+ ++ ++ PIE +VRGYL G+T TS+ T Y  G R+   
Sbjct: 73  FAATKHIVGNHVLRSPHANALLARKCRVLPIEFVVRGYLTGSTDTSIWTQYAKGVRQYCG 132

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           + LP+ M  N+KL   ++TPTTK     +  D+PI+  EI+  G +T  QWE  S+ AL+
Sbjct: 133 HALPEGMRKNEKLQQNIVTPTTK----ETAHDRPITAQEIVAEGWMTAEQWEFCSAKALA 188

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF  G K+A E+GLILVD+KYEFG+     I+L DEIHTPDSSRYW  ++Y +    G  
Sbjct: 189 LFAFGQKIAAEHGLILVDTKYEFGVGDDGEILLIDEIHTPDSSRYWLADSYAERLAVGQE 248

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F R W   RC+PY+D I P  P+++I   +  YI  +EKITG  F+ D   L 
Sbjct: 249 PDMIDKEFFRLWFRERCDPYKDAILPVPPDDLIAELASRYIQLFEKITGTAFVPDLRPLD 308


>gi|281425827|ref|ZP_06256740.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris F0302]
 gi|281400088|gb|EFB30919.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris F0302]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 177/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ L+K         + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDIC N  +  PDP V VG + + F +E+I+R  L G+   S    YK G
Sbjct: 61  QIAAKFLDATSDICPNWKMATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRS----YKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N+K P P++TPTTK+ E     D  IS  EII +GI+++  +E I
Sbjct: 117 CRELCGVKLPDGMRENEKFPEPIVTPTTKAEEG---HDLNISKEEIIAQGIVSKEDYEII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EDYTKKLFKRGQEIAAKQGLILVDTKYEFGK-RDGKIYLIDEIHTPDSSRYFYAEGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++           +P+I        S  YI  YE ITG KF 
Sbjct: 233 LAAGKPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITGEYADSVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                     RI NN+  Y   
Sbjct: 293 RSIECGDIAARIENNVATYLKT 314


>gi|303237113|ref|ZP_07323683.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           disiens FB035-09AN]
 gi|302482500|gb|EFL45525.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           disiens FB035-09AN]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 128/322 (39%), Positives = 175/322 (54%), Gaps = 13/322 (4%)

Query: 1   MRILSKAYIP--ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L+K           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MNALTKTEFKFEGQNEVYHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDIC N  L  PDP V VG + + F +E+I+R  L G+        YK G
Sbjct: 61  QIASKFLDSTSDICPNWKLATPDPMVTVGLKCEGFKVEMIIRSILTGSAWRE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N++ P P+ITPTTK+ E     D  IS  EII +GI++   + TI
Sbjct: 117 CREICGVKLPDGMRENERFPEPIITPTTKADEG---HDLNISREEIIKQGIVSEEDYNTI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A E GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRKLFARGQEMAAEKGLILVDTKYEFGK-RNGKCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P+I +         YI  YE ITG KF+
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIEHNFMNEPGQIMPEITDEYATSVGDRYIELYEHITGEKFV 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                    +RI  N+ +Y   
Sbjct: 293 KATDTTDLAKRIEKNVSEYLAS 314


>gi|149370679|ref|ZP_01890368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [unidentified eubacterium SCB49]
 gi|149356230|gb|EDM44787.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [unidentified eubacterium SCB49]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 117/316 (37%), Positives = 172/316 (54%), Gaps = 10/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR  Y L D   + +ATDRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TDFNFPGQKSVYHGKVRSVYTLQDDILLMVATDRLSAFDVVMPKGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T D+  N  +  PDPNV +G   + F +E+++RGY++G+        YK G+R +  
Sbjct: 68  MRDTEDLVPNWLIATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGRRVLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ M +N   P P+ITP TK+       D+ I+  +II R I++   +  +  Y   
Sbjct: 124 VPMPEGMKENDAFPSPIITPATKAEMG--DHDEDIAREDIIKRNIVSEEDYLVLEDYTRK 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E YE+  + G  
Sbjct: 182 LFKRGSEIADSRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYKEGYEERQKAGEA 241

Query: 244 PIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++           +P++ +  I   S  YI  +E ITG  F+  +   
Sbjct: 242 QKQLSKEFVRQWLIQNDFQGLEGQTVPEMTDEYIDTVSDRYIELFENITGDTFVKADV-T 300

Query: 302 PPLERIRNNLRKYTHR 317
              ERI  N+ +Y ++
Sbjct: 301 NIDERIVTNVAEYFNK 316


>gi|163788811|ref|ZP_02183256.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriales bacterium ALC-1]
 gi|159876048|gb|EDP70107.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriales bacterium ALC-1]
          Length = 315

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 176/315 (55%), Gaps = 10/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TNFNFPNQKSVYKGKVREVYNINDEQLVMVATDRLSAFDVVMPKGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T D+  N  +  PDPNV VG   + F +E+++RGY++G+        YK G+R +  
Sbjct: 68  MKETEDLVPNWLVATPDPNVAVGHLCEPFKVEMVIRGYMSGHAARE----YKAGRRLLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +PD M +N K P P+ITP TK+       D+ IS  +I+ +GI+++  +  +  Y   
Sbjct: 124 IEMPDGMKENDKFPQPIITPATKAEMG--DHDEDISREDILAKGIVSKEDYSILEDYTRK 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y++   +G  
Sbjct: 182 LFQRGTEIAAERGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADGYQERQDKGEA 241

Query: 244 PIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W+++          +P + +  I   S+ YI  YE ITG +F+  +   
Sbjct: 242 QKQLSKEFVRQWLISNNFQGLEGQTVPFMSDEYIETVSERYIELYENITGDRFVKGDVS- 300

Query: 302 PPLERIRNNLRKYTH 316
               RI  N+  Y  
Sbjct: 301 DIQGRIEANVLGYLK 315


>gi|270158588|ref|ZP_06187245.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella longbeachae D-4968]
 gi|289166583|ref|YP_003456721.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella longbeachae NSW150]
 gi|269990613|gb|EEZ96867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella longbeachae D-4968]
 gi|288859756|emb|CBJ13737.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella longbeachae NSW150]
          Length = 329

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 134/313 (42%), Positives = 194/313 (61%), Gaps = 7/313 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L +  +P     Y GKVR+ Y L D   + + TDRLSAFD+++A IPYKG VLN  + +W
Sbjct: 22  LDQTNLPAGEK-YQGKVRDAYDLGDAIML-VTTDRLSAFDRHLALIPYKGAVLNLTSAWW 79

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T ++  NH +  PDPNV++ ++  +FPIE +VRGY++G T TSL T Y+NG R    
Sbjct: 80  FEQTKNLVPNHIIAVPDPNVVIAKKCTVFPIEFVVRGYISGTTSTSLWTQYQNGTRDYCG 139

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              P+ +  NQKL   V+TPTTK        D+PISP+EII  G ++   W  +S+ AL 
Sbjct: 140 ITFPEGLRKNQKLEQAVLTPTTK----EKIHDRPISPDEIISEGWMSEEDWLEVSALALK 195

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           L++RG ++A ++GLILVD+KYEFG D +  I + DEIHTPDSSRYW  ++Y+     G+ 
Sbjct: 196 LYQRGAEIARDHGLILVDTKYEFGRDAEGTIRVVDEIHTPDSSRYWLADSYQSRIAAGLE 255

Query: 244 PIGLDKDFIRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W     +PY D  +P+ P+ +++  S  YI  YE+ITG  F  +  + P
Sbjct: 256 PENIDKEFLRLWFAKNSDPYHDEKLPEAPQELVVELSARYIQLYERITGKDFNFNAHKEP 315

Query: 303 PLERIRNNLRKYT 315
             +RI  ++  Y 
Sbjct: 316 AEQRILRHIANYL 328


>gi|120436254|ref|YP_861940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gramella
           forsetii KT0803]
 gi|117578404|emb|CAL66873.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Gramella
           forsetii KT0803]
          Length = 317

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 121/316 (38%), Positives = 177/316 (56%), Gaps = 10/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVR+ YFL +     IA+DRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TDFNFPGQQSVYKGKVRDVYFLENDLLAMIASDRLSAFDVVMPKGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              TSDI  N     PDPNV +G++ + F +E+++RGY++G+        YK GKR++  
Sbjct: 68  MEKTSDIVPNWLEATPDPNVAIGKKCEPFKVEMVIRGYMSGHAARE----YKAGKRELCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ + +N K P P+ITP TK+       D+ IS  +II +GI+    +  +  Y  +
Sbjct: 124 VAMPEGLKENDKFPQPIITPATKAEHG--DHDEDISREDIIKKGIVAEGDYLKLEEYTRN 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A +  LILVD+KYEFG      I+L DEIHTPDSSRY+  + YEK    G  
Sbjct: 182 LFQRGTEIAAQQDLILVDTKYEFGKTVDGEIVLIDEIHTPDSSRYFYKDGYEKRQENGEA 241

Query: 244 PIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W+++         ++P++ +  I   S+ YI  YEKITG  F   +   
Sbjct: 242 QKQLSKEFVRQWLISNGFQGLEGQSVPEMSDEYIESVSERYIELYEKITGDTFEKADVS- 300

Query: 302 PPLERIRNNLRKYTHR 317
               RI+NN+  Y   
Sbjct: 301 HIESRIQNNVESYLET 316


>gi|268316892|ref|YP_003290611.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Rhodothermus marinus DSM 4252]
 gi|262334426|gb|ACY48223.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Rhodothermus marinus DSM 4252]
          Length = 328

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 130/323 (40%), Positives = 193/323 (59%), Gaps = 14/323 (4%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            + +  + EL   Y GKVR+ Y + DG  + + TDR+SAFD  +   IP+KG+VLNQ+  
Sbjct: 14  TIRETNLRELGTPYRGKVRDVYTV-DGHLVIVTTDRISAFDHILRQTIPFKGQVLNQLAA 72

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           Y+F HT+D+  NH    PDPNV V ++ +  PIE +VRGYLAG+        Y++G+R++
Sbjct: 73  YFFRHTADLVPNHVEAVPDPNVTVARRCRPIPIEFVVRGYLAGHAW----RVYRSGRREL 128

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ +  N +LP P++TP TK+ E     D+ IS  EII RG+L    ++ I    
Sbjct: 129 CGKKLPEGLVQNARLPEPILTPATKAKEG---HDEDISREEIIARGLLDAETFDRIEVMT 185

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+L+ RG ++A   GLILVD+KYEFGID +  I L DE+HTPDSSRY+  + YE+  R+G
Sbjct: 186 LALYRRGAEMAARRGLILVDTKYEFGIDDEGMIRLIDEVHTPDSSRYFYADEYEERLRKG 245

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
           +    L K+F+R W++      +    +PD+P+++ +  ++ YI  YE++TG  F  D  
Sbjct: 246 LPQRQLSKEFVREWLMEHGFMGQPGQQLPDLPDDVRVEIARRYIEVYEQLTGEPFQPDTH 305

Query: 300 ELPPLERIRNNLR--KYTHRHLS 320
              P +RIR NL         LS
Sbjct: 306 P-DPEQRIRENLAALPLLQAQLS 327


>gi|168001844|ref|XP_001753624.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695031|gb|EDQ81376.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 342

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 126/309 (40%), Positives = 192/309 (62%), Gaps = 6/309 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           IP L     GKVR+ Y   D   + + TDR SAFD+ +A +P+KG+VLNQ + +WF++T 
Sbjct: 36  IPSLGPKIRGKVRDIYDAGD-YMVLVTTDRQSAFDRILASVPFKGQVLNQTSIWWFNNTK 94

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PDPNV + ++  +FP+E +VRG++ G+T TSL T Y  G R      L +
Sbjct: 95  HITDNAIVSAPDPNVTIAKKCTVFPVEFVVRGFVTGSTSTSLWTVYNQGVRNYCGNELKE 154

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  N+KL   ++TPTTK+    +  D PIS +EI  +G+++R  +E + S AL+LF+ G
Sbjct: 155 GMKKNEKLEANILTPTTKA----ADHDLPISGDEIAEQGLMSREDYEEVKSRALALFKFG 210

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A ++GL+LVD+KYEFG      I+L DE+HTPDSSRYW   +YE+  R+G+ P  +D
Sbjct: 211 QEVARKHGLLLVDTKYEFGKTSDGTIVLIDEVHTPDSSRYWIAASYEERQRQGLEPENID 270

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W  ++C+PY   + P+ P+ ++   S  YI  YE ITG KF+  + +    +RI
Sbjct: 271 KEFLRLWFKSQCDPYTAEVLPEAPKELVSELSWRYIVLYETITGTKFVLPDVKENLHDRI 330

Query: 308 RNNLRKYTH 316
             N++    
Sbjct: 331 IRNVQDALS 339


>gi|89891201|ref|ZP_01202708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BBFL7]
 gi|89516513|gb|EAS19173.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BBFL7]
          Length = 321

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 122/317 (38%), Positives = 179/317 (56%), Gaps = 10/317 (3%)

Query: 6   KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF 64
               P   N Y GKVR+ Y ++D   + +A+DRLSAFD  +   IPYKG++LNQI     
Sbjct: 11  DFNFPNQTNVYKGKVRQVYSINDDLLVMVASDRLSAFDVVMPRGIPYKGQILNQIATQMM 70

Query: 65  HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             T DI  N  L  PDPNV +G Q + F +E+++RGY++G+        YK G+R +   
Sbjct: 71  QATEDIVPNWLLATPDPNVAIGYQCEPFKVEMVIRGYMSGHAARE----YKAGRRMLCGV 126

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            +PD M +N + P P+ITP TK+       D+ IS  +II RGI++ + +E +  Y   L
Sbjct: 127 PMPDGMKENDQFPEPIITPATKAEMG--DHDEDISREDIISRGIVSEHDYEILEKYTRDL 184

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           F+RG +LA + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y+         
Sbjct: 185 FKRGSQLAKKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYAEGYQNRQDNNEPQ 244

Query: 245 IGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
             L K+F+R W+++          +P++ +  I+  S  YI  YEKITG +F   ++   
Sbjct: 245 KQLSKEFVRQWLISHNFQGLEGQILPEMDDAYIMSVSDRYIELYEKITGKEFEKSDTS-D 303

Query: 303 PLERIRNNLRKYTHRHL 319
              RI +N++ +   + 
Sbjct: 304 IKNRIESNVQDWFEANF 320


>gi|213963513|ref|ZP_03391766.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga sputigena Capno]
 gi|213953793|gb|EEB65122.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga sputigena Capno]
          Length = 317

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 126/324 (38%), Positives = 185/324 (57%), Gaps = 13/324 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++K     P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MNTITKTNFKFPKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDAILPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG
Sbjct: 61  QIAVSFLQQTEDIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSA----RLYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
            RK+    LP+ + +    P  P+ITP TK+ +     D+ IS  EII RGI+  + +  
Sbjct: 117 VRKLSGVPLPEGLREFDMFPQHPIITPATKAEQG--LHDEDISREEIIRRGIVNEDDYRL 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y  +LF RG ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E YE+
Sbjct: 175 MEKYTYALFARGTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYEE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G   I L K+F+R W++++         +P++ +  +   S  YI  YE I G KF
Sbjct: 235 RQENGEPQIQLSKEFVRQWLISQGFQGEKGQKMPEMSDEYVQSVSDRYIELYENIMGEKF 294

Query: 295 IADNSELPPLERIRNNLRKYTHRH 318
           +  ++      RI +N+ ++    
Sbjct: 295 LPADTS-DIENRIHDNVLRFLQNQ 317


>gi|145356524|ref|XP_001422478.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582721|gb|ABP00795.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 367

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 130/298 (43%), Positives = 180/298 (60%), Gaps = 6/298 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y   D T I + TDR SAFD+++A IP+KG VLNQ +Q+WF  T  I  N  
Sbjct: 72  YEGKVRDTYVTGD-TMIAVTTDRQSAFDRHLAYIPFKGAVLNQTSQWWFKQTEHIVPNAV 130

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV V ++ ++FPIE +VRGYL G+T TSL T YK G R      L D M  NQK
Sbjct: 131 VATPDPNVTVMRRCEVFPIEFVVRGYLTGSTSTSLWTHYKTGGRNYCGNALDDGMVKNQK 190

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           LP  ++TPTTK  E     D+PIS  +I+  G + ++  +   +  L +F    ++A   
Sbjct: 191 LPANIVTPTTKEKE----HDRPISLEDIVKEGWMKQDDLDYCVAKTLEVFAYAQEVAATR 246

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D    I L DEI+TPDSSRYW   +Y +    G+ P  +DK+F+R W
Sbjct: 247 GLILVDTKYEFGRDADGTIRLIDEINTPDSSRYWLSNSYVERHAAGMEPDMIDKEFLRLW 306

Query: 256 ILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
              RC+PY+D  +P+ P +++   S  Y+  YE ITG  F    + +   +R+R+ L+
Sbjct: 307 FAERCDPYKDETLPEAPADLVAELSSRYVKLYEMITGETFDVPPAGVDVNKRMRDALK 364


>gi|326336374|ref|ZP_08202545.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691548|gb|EGD33516.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 317

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 130/324 (40%), Positives = 180/324 (55%), Gaps = 12/324 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  +             Y GKVR+ Y + D   + +ATDRLSAFD  +   IPYKG++LN
Sbjct: 1   MNSIISTDFSFKNQKTVYKGKVRDVYTIGDDLLVMVATDRLSAFDVILPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T  I  N  L  PDPNV VG     F +E+++RGYLAG+        YK G
Sbjct: 61  QIASECMEQTKYIVPNWLLATPDPNVSVGMLCTPFKVEMVIRGYLAGHAARE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +   +LP+ + +N  LP P+ITP+TK+       D+ IS  EI+ +GI+T + +  I
Sbjct: 117 KRTLCGVVLPEGLQENAPLPSPIITPSTKADNG--LHDEDISREEILKKGIITADDYAII 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG +LA E GLILVD+KYEFG  K   I+L DE+HTPDSSRY+ VE Y + 
Sbjct: 175 EQYTHALFKRGSELAKEKGLILVDTKYEFGKTKNGTIVLIDEVHTPDSSRYFYVEGYGER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
            ++G     L K+F+R W++      +    IP++    I   S+ YI  YE + G KFI
Sbjct: 235 LKKGEPQKQLSKEFVRQWLIENGFQGKAGEKIPEMTHAHIAAISERYIELYEHLLGKKFI 294

Query: 296 ADNSELPPLERIRNNLRKYTHRHL 319
             ++     ERI  N+ +Y H  L
Sbjct: 295 KADTH-NIKERIYTNVSEYLHSLL 317


>gi|228469387|ref|ZP_04054401.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas uenonis 60-3]
 gi|228309071|gb|EEK17701.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas uenonis 60-3]
          Length = 314

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 125/321 (38%), Positives = 183/321 (57%), Gaps = 14/321 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+   +  P +   + GKVR+ YFL       +ATDR+SAFD  +   IPYKG+VLNQ
Sbjct: 3   QALTHTDLSLPGIQAVFHGKVRDVYFLEGDLIAMVATDRISAFDVVLPEGIPYKGQVLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I       T+ +  N  +  PDP V VG + + F +E+IVRGY+AG+        Y+ G+
Sbjct: 63  IAAEQLDATAHLVPNWKIATPDPMVTVGHRCEPFKVEMIVRGYIAGSAW----RAYQAGE 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R I    LP+ + +N++LP+P+ITPTTK+ E     D+ IS  EII  G+++   ++ I 
Sbjct: 119 RTICGIQLPEGLKENERLPHPIITPTTKADEG---HDENISREEIIASGLISEEDYKVIE 175

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y  +LFE G ++A E GLILVD+KYEFG  K   +IL DEIHTPDSSRY+ +E YE+  
Sbjct: 176 QYTRTLFEEGTRIARERGLILVDTKYEFGK-KDGKVILIDEIHTPDSSRYFYLEGYEERQ 234

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W++ +    +    +P I        S  YI  YE ITG  F+ 
Sbjct: 235 AKGEPQRQLSKEFVRQWLIEQGFQGKAGQKMPAITPEYAASVSDRYIELYEHITGKTFVK 294

Query: 297 DNSELPPLERIRNNLRKYTHR 317
           + +     +RI +NL  +  +
Sbjct: 295 EQT-QDVAKRIEDNLLAFLKK 314


>gi|302821881|ref|XP_002992601.1| hypothetical protein SELMODRAFT_135614 [Selaginella moellendorffii]
 gi|300139565|gb|EFJ06303.1| hypothetical protein SELMODRAFT_135614 [Selaginella moellendorffii]
          Length = 365

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 130/318 (40%), Positives = 197/318 (61%), Gaps = 11/318 (3%)

Query: 4   LSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQI 59
           L++  +    P L     GKVR+ Y   D   + + TDR+SAFD+ +A IP+KG+VLNQ 
Sbjct: 53  LTETRLDETVPGLGPKRRGKVRDVYETKD-HLVIVTTDRMSAFDRVLASIPFKGQVLNQT 111

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           + +WF++T  I  N  +  PDPNV + ++  +FP+E +VRGY+ G+T TSL T Y  G R
Sbjct: 112 SVWWFNNTRHITPNAFVSAPDPNVTIARKCAVFPVEFVVRGYITGSTSTSLWTVYNQGIR 171

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
                 LP+ +  NQ+L Y ++TPTTKS       D+PIS  EI+ +G+++   ++++SS
Sbjct: 172 YYCGNDLPEGLIKNQRLDYLMLTPTTKSD----DHDRPISGEEIVEQGLMSEADYKSVSS 227

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            AL+LF  G ++AL++GL+LVD+KYEFG     +I L DE+HTPDSSRYW   +YE+  +
Sbjct: 228 KALALFAYGQEVALKHGLLLVDTKYEFGKMADGSICLIDEVHTPDSSRYWIAGSYEERMK 287

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLK-FIAD 297
           +G+ P  +DK+F+R W    CNPY+D + PD P  ++   +  YI  YE IT  K  + +
Sbjct: 288 QGLEPENIDKEFLRLWFKDNCNPYKDKVLPDAPVELVTELAWRYIHLYETITSEKMIVPE 347

Query: 298 NSELPPLERIRNNLRKYT 315
            +E    ERI  ++ +  
Sbjct: 348 KAEEDAHERITRSVIQAL 365


>gi|325288094|ref|YP_004263884.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga lytica DSM 7489]
 gi|324323548|gb|ADY31013.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga lytica DSM 7489]
          Length = 316

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 121/322 (37%), Positives = 181/322 (56%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++      P+  N Y GKVRE Y L D   + +ATDRLSAFD  +   IPYKG++LN
Sbjct: 1   MNTITDTNFKFPKQVNVYKGKVREVYRLEDDIMVMVATDRLSAFDVVMPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI     + T+DI  N  L  PD NV +G   + F +E+++RGY++G+        YK G
Sbjct: 61  QIATKMMNDTADIVPNWLLKTPDANVAIGHACEPFKVEMVIRGYMSGHAARE----YKAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    +P+ + +N K P P+ITP TK+       D+ IS  +II RGI++   ++ +
Sbjct: 117 KRVLCGVPMPEGLKENDKFPSPIITPATKAEMG--DHDEDISREDIIKRGIVSETDYKQL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG ++A + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EDYTFALFKRGTEIAAKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADGYKER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W+++          +P++ +  I   S+ YI  YE ITG  F+
Sbjct: 235 QEKGEPQKQLSKEFVRQWLISNNFQGLEGQTLPEMTDEYIASVSERYIELYENITGETFV 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             +      +RI  N+ +    
Sbjct: 295 KADIS-NIQKRIETNVLECLQT 315


>gi|126724328|ref|ZP_01740171.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
 gi|126705492|gb|EBA04582.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
          Length = 328

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 151/318 (47%), Positives = 203/318 (63%), Gaps = 2/318 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             L+    PELP +   KVR+ Y L  G R+ I+TDR SAFDQ +   P KG+VL Q  +
Sbjct: 13  NCLTDTEFPELPGFTRNKVRDTYKLPGGRRLLISTDRQSAFDQILTATPNKGQVLTQTAR 72

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T+DIC N  + YPDPNV++ + L M PIE++VR YL G+T TS+   Y+ G+R I
Sbjct: 73  YWFDATADICPNQVISYPDPNVVLVKDLDMLPIEIVVRAYLTGSTNTSVWPMYERGERVI 132

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +   D  S NQKLP  +ITPTTK      G D PI+  EI+  G+LT +QW  IS  +
Sbjct: 133 YGHEFADGYSKNQKLPEAIITPTTKPDGG--GHDAPITAAEILETGLLTADQWADISKKS 190

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG KLA E GLILVD+KYEFG+D+   I++ADEIHTPDSSR+W  + Y++    G
Sbjct: 191 LALFARGQKLAAEKGLILVDTKYEFGVDENGVIVIADEIHTPDSSRFWIADVYQERVDAG 250

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
           + P  LDK+F+R W++ +C+PY D IP+IP+  +L  S  YIA +E +TGL F   +  +
Sbjct: 251 LEPESLDKEFLRLWVVGQCDPYNDPIPEIPDETVLEFSNKYIALFETVTGLTFDRPDPAI 310

Query: 302 PPLERIRNNLRKYTHRHL 319
              +RIR  L K    + 
Sbjct: 311 SVKDRIRAALVKEFPEYF 328


>gi|302769239|ref|XP_002968039.1| hypothetical protein SELMODRAFT_409077 [Selaginella moellendorffii]
 gi|300164777|gb|EFJ31386.1| hypothetical protein SELMODRAFT_409077 [Selaginella moellendorffii]
          Length = 365

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 130/318 (40%), Positives = 196/318 (61%), Gaps = 11/318 (3%)

Query: 4   LSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQI 59
           L++  +    P L     GKVR+ Y   D   + + TDR+SAFD+ +A IP+KG+VLNQ 
Sbjct: 53  LTETRLDETVPGLGPKRRGKVRDVYETKD-HLVIVTTDRMSAFDRVLASIPFKGQVLNQT 111

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           + +WF++T  I  N  +  PDPNV + ++  +FP+E +VRGY+ G+T TSL T Y  G R
Sbjct: 112 SVWWFNNTRHITPNAFVSAPDPNVTIARKCAVFPVEFVVRGYITGSTSTSLWTVYNQGIR 171

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
                 LP+ +  NQ+L Y ++TPTTKS       D+PIS  EI+ +G+++   ++++SS
Sbjct: 172 YYCGNDLPEGLIKNQRLDYLMLTPTTKSD----DHDRPISGEEIVEQGLMSEADYKSVSS 227

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            AL+LF  G ++AL++GL+LVD+KYEFG     +I L DE+HTPDSSRYW   +YE+  +
Sbjct: 228 KALALFAYGQEVALKHGLLLVDTKYEFGKMADGSICLIDEVHTPDSSRYWIAGSYEERMK 287

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLK-FIAD 297
           +G+ P  +DK+F+R W    CNPY D + PD P  ++   +  YI  YE IT  K  + +
Sbjct: 288 QGLEPENIDKEFLRLWFKDNCNPYEDKVLPDAPVELVTELAWRYIHLYETITSEKMIVPE 347

Query: 298 NSELPPLERIRNNLRKYT 315
            +E    ERI  ++ +  
Sbjct: 348 KAEEDAHERITRSVIQAL 365


>gi|88803429|ref|ZP_01118955.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaribacter irgensii 23-P]
 gi|88780995|gb|EAR12174.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaribacter irgensii 23-P]
          Length = 315

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 116/322 (36%), Positives = 180/322 (55%), Gaps = 12/322 (3%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  +++     P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IP+KG++LN
Sbjct: 1   MNTINETNFKFPNQKSVYRGKVREVYNINDSLLVMVATDRLSAFDVILPKQIPFKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI     + T+ I  N  L  PD NV VGQ    F +E+++RGY++G+        Y  G
Sbjct: 61  QIATRMMNDTAAIVPNWLLANPDENVAVGQLCTPFKVEMVIRGYMSGHAARE----YAAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    +P+ + +N + P+P+ITP+TK+       D+ IS   I+ +GI+    +  +
Sbjct: 117 KRMLCGVPMPEGLKENDQFPFPIITPSTKADNG--DHDEDISREAILAQGIVIEADYLIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y  +LF +G ++A + GLILVD+KYEFG   +  I+L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 ENYTRALFTKGTEIAAKRGLILVDTKYEFGKTNEGEIVLIDEIHTPDSSRYFYAEGYQER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G +   L K+F+R W++           IP++ +  I+  S  YI  YE+I G  F+
Sbjct: 235 QNTGGSQKQLSKEFVRQWLIENGFQGLEGQKIPEMSDAKIIEISNRYIELYEQIVGEPFV 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
              +E   L+RI  N+  +   
Sbjct: 295 KAATE-NVLDRIEKNINSFLSN 315


>gi|218202296|gb|EEC84723.1| hypothetical protein OsI_31696 [Oryza sativa Indica Group]
          Length = 403

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 131/321 (40%), Positives = 190/321 (59%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             L +  +    P L     GKVR+ Y   +   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 87  NCLGETSLHLAVPGLRLAAKGKVRDVYESGE-HLVLVTTDRQSAFDRVLASIPFKGQVLN 145

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF  T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G
Sbjct: 146 ETSLWWFDRTRHITPNAVVSSPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKG 205

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R     +L D +  NQKL   ++TPTTK+    +  D P++P EII+ G++++  ++  
Sbjct: 206 ARNYCGNVLRDGLVKNQKLSANILTPTTKA----ADHDVPVTPEEIINSGLMSKEDFDEA 261

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            S ALSLF  G ++ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ 
Sbjct: 262 RSKALSLFAYGQEVALENGLILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEER 321

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F  G+ P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF  
Sbjct: 322 FSSGLEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEI 381

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  ERI  N+ +    
Sbjct: 382 PKTQEPIHERISRNVAQALQN 402


>gi|313885954|ref|ZP_07819692.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas asaccharolytica PR426713P-I]
 gi|332299379|ref|YP_004441300.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas asaccharolytica DSM 20707]
 gi|312924484|gb|EFR35255.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas asaccharolytica PR426713P-I]
 gi|332176442|gb|AEE12132.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas asaccharolytica DSM 20707]
          Length = 314

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 125/321 (38%), Positives = 184/321 (57%), Gaps = 14/321 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + L+   +  P + + + GKVR+ YFL       +ATDR+SAFD  +   IPYKG+VLNQ
Sbjct: 3   QALTHTDLSLPGIQSVFHGKVRDVYFLEGDLIAMVATDRISAFDVVLPEGIPYKGQVLNQ 62

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I       T+ +  N  +  PDP V VG + + F +E+IVRGY+AG+        Y+ G+
Sbjct: 63  IAAEQLDATAHLVPNWKIATPDPMVTVGHRCEPFKVEMIVRGYIAGSAW----RAYQAGE 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R I    LP+ + +N++LP+P+ITPTTK+ E     D+ IS  EII  G+++   ++ I 
Sbjct: 119 RTICGIELPEGLKENERLPHPIITPTTKADEG---HDENISREEIIASGLISEEDYKVIE 175

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y  +LFE G ++A E GLILVD+KYEFG  K   +IL DEIHTPDSSRY+ +E YE+  
Sbjct: 176 QYTRTLFEEGTRIARERGLILVDTKYEFGK-KDGKVILIDEIHTPDSSRYFYLEGYEERQ 234

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W++ +    +    +P I        S  YI  YE ITG  F+ 
Sbjct: 235 AKGEPQRQLSKEFVRQWLIEQGFQGKAGQKMPTITPEYAASVSDRYIELYEHITGKTFVK 294

Query: 297 DNSELPPLERIRNNLRKYTHR 317
           + +     +RI +NL  +  +
Sbjct: 295 EQT-QNLAKRIEDNLLAFLKK 314


>gi|255531762|ref|YP_003092134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter heparinus DSM 2366]
 gi|255344746|gb|ACU04072.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Pedobacter
           heparinus DSM 2366]
          Length = 316

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 118/322 (36%), Positives = 181/322 (56%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +     P+  ++Y GKVR+ Y + +     + TDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MTAIKETNFSFPKQTSFYKGKVRDVYTIDNRFMAMVVTDRISAFDVVLPEAIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   + + T DI  N  +  PD  V +G+  + F +E++VRGYLAG+        Y  G
Sbjct: 61  QIAAKFLNATKDIVPNWVIAVPDEMVTIGRICEPFKVEMVVRGYLAGHAWRE----YSAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    LP+ + +N KLP P+ITPTTK+S      D+ IS  +I+ +GI++   +  +
Sbjct: 117 KRSVCGVALPEGLKENDKLPGPIITPTTKASVG---HDEDISREDILAKGIVSLADYSQL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y  +L+ERG ++A E GLILVD+KYEFG   +  I L DEIHTPDSSRY+  E Y + 
Sbjct: 174 ENYTYALYERGTQMAAERGLILVDTKYEFGKVGE-EIYLIDEIHTPDSSRYFYAEGYSER 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +      L K+F+R W++      +   +IP +   I+   +  YI  YE+ITG +F+
Sbjct: 233 QEQNEPQKQLSKEFVRKWLIENGFQGKEGQSIPVMTPEIVNSIADRYIELYEQITGDRFV 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             N +   + RI  N+  +   
Sbjct: 293 K-NEQADVVARIEKNVNGFLST 313


>gi|19347902|gb|AAL85973.1| putative phosphoribosyamidoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
          Length = 374

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 138/321 (42%), Positives = 195/321 (60%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN
Sbjct: 55  NCLSETNLLATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLN 113

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF++T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G
Sbjct: 114 ETSLWWFNNTQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKG 173

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      L D +  NQKLP  ++TPTTK+    +  D PISPNEI+  G +T+ +++  
Sbjct: 174 VRNYCGNELSDGLVKNQKLPANILTPTTKA----ADHDVPISPNEIVEGGFMTQAEFDEA 229

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ 
Sbjct: 230 SMKALSLFEFGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEER 289

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F++G+ P  +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +   
Sbjct: 290 FQKGLEPENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDI 349

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  +RI  N  +    
Sbjct: 350 IPTQEPIHDRISRNTSQALSS 370


>gi|15232462|ref|NP_188748.1| PUR7 (PURIN 7); phosphoribosylaminoimidazolesuccinocarboxamide
           synthase [Arabidopsis thaliana]
 gi|79313319|ref|NP_001030739.1| PUR7 (PURIN 7); phosphoribosylaminoimidazolesuccinocarboxamide
           synthase [Arabidopsis thaliana]
 gi|26454658|sp|P38025|PUR7_ARATH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase, chloroplastic; AltName: Full=SAICAR
           synthetase; Flags: Precursor
 gi|11994271|dbj|BAB01454.1| 5'-phosphoribosyl-4-(N-succinocarboxamide)-5- ami noimidazole
           synthetase [Arabidopsis thaliana]
 gi|27754219|gb|AAO22563.1| putative phosphoribosyamidoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
 gi|332642941|gb|AEE76462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
 gi|332642942|gb|AEE76463.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
          Length = 411

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 138/321 (42%), Positives = 195/321 (60%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN
Sbjct: 92  NCLSETNLLATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLN 150

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF++T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G
Sbjct: 151 ETSLWWFNNTQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKG 210

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      L D +  NQKLP  ++TPTTK+    +  D PISPNEI+  G +T+ +++  
Sbjct: 211 VRNYCGNELSDGLVKNQKLPANILTPTTKA----ADHDVPISPNEIVEGGFMTQAEFDEA 266

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ 
Sbjct: 267 SMKALSLFEFGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEER 326

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F++G+ P  +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +   
Sbjct: 327 FQKGLEPENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDI 386

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  +RI  N  +    
Sbjct: 387 IPTQEPIHDRISRNTSQALSS 407


>gi|115479657|ref|NP_001063422.1| Os09g0467100 [Oryza sativa Japonica Group]
 gi|46806330|dbj|BAD17522.1| putative succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Oryza sativa Japonica Group]
 gi|113631655|dbj|BAF25336.1| Os09g0467100 [Oryza sativa Japonica Group]
 gi|215693325|dbj|BAG88707.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 403

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 132/321 (41%), Positives = 190/321 (59%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             L +  +    P L     GKVR+ Y   +   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 87  NCLGETSLHLAVPGLRLAAKGKVRDVYESGE-HLVLVTTDRQSAFDRVLASIPFKGQVLN 145

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF  T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G
Sbjct: 146 ETSLWWFDRTRHITPNAVVSSPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKG 205

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R     +L D M  NQKL   ++TPTTK+    +  D P++P EII+ G++++  ++  
Sbjct: 206 ARNYCGNVLRDGMVKNQKLSANILTPTTKA----ADHDVPVTPEEIINSGLMSKEDFDEA 261

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            S ALSLF  G ++ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ 
Sbjct: 262 RSKALSLFAYGQEVALENGLILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEER 321

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F  G+ P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF  
Sbjct: 322 FSSGLEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEI 381

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  ERI  N+ +    
Sbjct: 382 PKTQEPIHERISRNVAQALQN 402


>gi|453384|gb|AAA16231.1| SAICAR synthetase [Arabidopsis thaliana]
          Length = 411

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 139/321 (43%), Positives = 195/321 (60%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN
Sbjct: 92  NCLSETNLLATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLN 150

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF++T  I  N  L  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G
Sbjct: 151 ETSLWWFNNTQHITPNAMLYSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKG 210

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      L D +  NQKLP  ++TPTTK+    +  D PISPNEI+  G +T+ +++  
Sbjct: 211 VRNYCGNELSDGLVKNQKLPANILTPTTKA----ADHDVPISPNEIVEGGFMTQAEFDEA 266

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ 
Sbjct: 267 SMKALSLFEFGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEER 326

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F++G+ P  +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +   
Sbjct: 327 FQKGLEPENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDI 386

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  +RI  N  +    
Sbjct: 387 IPTQEPIHDRISRNTSQALSS 407


>gi|332521534|ref|ZP_08397988.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Lacinutrix
           algicola 5H-3-7-4]
 gi|332042933|gb|EGI79132.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Lacinutrix
           algicola 5H-3-7-4]
          Length = 317

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 122/320 (38%), Positives = 172/320 (53%), Gaps = 12/320 (3%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
             ++      P   N Y GKVR  Y ++D   + IATDRLSAFD  +   IPYKG++LNQ
Sbjct: 5   NTITDTNYNFPGQKNVYKGKVRAVYNINDEELVMIATDRLSAFDVVMPKGIPYKGQILNQ 64

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I       T D+  N     PDPNV VG   + F +E+++RGYL+G+        YK GK
Sbjct: 65  IATSMMKATEDLVPNWLTATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YKAGK 120

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    +PD M +N K P P+ITP TK+       D+ IS  +I+ +GI+++  +  + 
Sbjct: 121 RMLCGVPMPDGMKENDKFPEPIITPATKAEMG--DHDEDISREDILKKGIVSKEDYSVLE 178

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y   LF+RG ++A   GLILVD+KYEFG  K+  I+L DEIHTPDSSRY+  E Y++  
Sbjct: 179 DYTRKLFQRGTEIAASRGLILVDTKYEFGKTKEGKIVLIDEIHTPDSSRYFYTEGYQERQ 238

Query: 239 REGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
               T   L K+F+R W++           +P++ +  I   S+ YI  YE I G  FI 
Sbjct: 239 DNNETQKQLSKEFVRQWLIANNFQGLEGQTVPEMSDEYIETVSERYIELYENIMGEPFIK 298

Query: 297 DNSELPPLERIRNNLRKYTH 316
            +       RI  N+  Y  
Sbjct: 299 ADVS-NIQARIEANVLDYLK 317


>gi|297835076|ref|XP_002885420.1| hypothetical protein ARALYDRAFT_898545 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297331260|gb|EFH61679.1| hypothetical protein ARALYDRAFT_898545 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 411

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 140/321 (43%), Positives = 196/321 (61%), Gaps = 10/321 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   I I TDRLSAFD+N+A IP+KG+VLN
Sbjct: 92  NCLSETNLLATVPGLKSRIKGKVRDIYDAGD-YLILITTDRLSAFDRNLASIPFKGQVLN 150

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF++T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G
Sbjct: 151 ETSLWWFNNTQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKG 210

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      L D +  NQKLP  ++TPTTK+    +  D PISPNEI+ RG +T+ +++  
Sbjct: 211 VRNYCGNELSDGLVKNQKLPANILTPTTKA----ADHDVPISPNEIVERGFMTQAEFDEA 266

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  ALSLFE G ++A E+GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ 
Sbjct: 267 SMKALSLFEFGQRVAKEHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEER 326

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           F++G+ P  +DK+F+R W     NPY D + P  P  ++   +  YI  YE ITG +   
Sbjct: 327 FQKGLEPENVDKEFLRLWFKENSNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDI 386

Query: 297 DNSELPPLERIRNNLRKYTHR 317
             ++ P  +RI  N  +    
Sbjct: 387 IPTQEPIHDRISRNTSQALSS 407


>gi|91215684|ref|ZP_01252654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychroflexus torquis ATCC 700755]
 gi|91186150|gb|EAS72523.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychroflexus torquis ATCC 700755]
          Length = 316

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 123/316 (38%), Positives = 178/316 (56%), Gaps = 10/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           ++  +P   +YY GKVRE Y L+D   + +ATDRLSAFD  +   IPYKG++LN+I    
Sbjct: 8   TQFNLPGQVDYYKGKVREVYTLADHNIVIVATDRLSAFDVVLPQGIPYKGQILNEIASEM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T DI  N     PDPNV +G +   F +E++VR YL G+        Y  G RK+  
Sbjct: 68  LKATEDIVPNWLEAVPDPNVSIGVKCDTFKVEMVVRNYLVGHAARE----YTAGNRKLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             L + +  N K   P++TPTTK+ +     DQ IS  EI+ +GI++ + ++ +  YAL 
Sbjct: 124 VNLKEGLKVNDKFDSPILTPTTKAEQG--DHDQDISKEEILAQGIVSHSDYKVLEDYALK 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LFERG +LA + GL+LVD+KYEFG      I++ DEIHTPDSSRY+  E Y +   +G  
Sbjct: 182 LFERGSQLADQRGLLLVDTKYEFGKTPDGKIVVIDEIHTPDSSRYFYKEGYNERQTKGEK 241

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      ++   IP++   I+   S+ YI  YEKITG  F     E 
Sbjct: 242 QKQLSKEFVREWLMENGFQGKEGQKIPELTPQIVNSISERYIELYEKITGKAFRKAKVE- 300

Query: 302 PPLERIRNNLRKYTHR 317
               RI  N++ +  +
Sbjct: 301 DIEARILANIKTHLSK 316


>gi|332876871|ref|ZP_08444625.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685154|gb|EGJ57997.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 317

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 127/323 (39%), Positives = 183/323 (56%), Gaps = 13/323 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++K     P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LN
Sbjct: 2   MNTITKTNFKFPKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDVILPKGIPYKGQILN 61

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           Q+   +   T DI  N     PDPNV +GQ  +   +E+++RGYLAG+        YKNG
Sbjct: 62  QMAVRFLEQTEDIVPNWLTASPDPNVSIGQVCEPLKVEMVIRGYLAGHAA----RLYKNG 117

Query: 118 KRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           KR +    LP+ + +    P  P+ITP TK+ +     D+ IS  EII RGI++   +  
Sbjct: 118 KRMLSGVALPEGLREFDIFPQHPIITPATKAEQG--LHDEDISREEIIRRGIVSEEDYRL 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y  +LF RG ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y++
Sbjct: 176 MEKYTYALFARGSEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              +G   I L K+F+R W++++         +P++ +  +   S  YI  YE I G KF
Sbjct: 236 RQEKGEPQIQLSKEFVRQWLISQGFQGEKGQKVPEMSDAYVQSVSDRYIELYENIMGEKF 295

Query: 295 IADNSELPPLERIRNNLRKYTHR 317
           I  ++      RI  N+ KY   
Sbjct: 296 IPGDT-TDIEGRIYENVEKYLKS 317


>gi|91776594|ref|YP_546350.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacillus flagellatus KT]
 gi|123380361|sp|Q1GZ28|PUR7_METFK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|91710581|gb|ABE50509.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacillus flagellatus KT]
          Length = 297

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 92/310 (29%), Positives = 149/310 (48%), Gaps = 29/310 (9%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           M   L  + I  L     GKVR+ Y + D   + +A+DRLSAFD  +   I  KG +L Q
Sbjct: 1   MTTPLMHSSIKSLKLINQGKVRDIYDIDDRHMLLVASDRLSAFDVILPTPIKDKGAILTQ 60

Query: 59  ITQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAG 104
           I  +WF     I  NH                    P  LV ++L+  PIE IVRGYLAG
Sbjct: 61  IANFWFEKLKHIVPNHLTGIDPNTVVKDPAEQAQLGPRALVVKKLKPLPIEAIVRGYLAG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +             + +    LP  + +  +LP P+ TP++K+       D+ I+  +  
Sbjct: 121 SGWKEY-----QASQSVCGIPLPAGLQEAAQLPEPLFTPSSKAEVG--DHDENITLEKCA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++     + ++  ++ L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPD
Sbjct: 174 --QLIGPELADKVARVSVQLYKEAAAYALGRGIIIADTKFEFGLDEAGELYLIDEVLTPD 231

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + Y    + G  P   DK ++R+W+ +         P +P+ +  RT+  Y  
Sbjct: 232 SSRFWPQDQY----QVGSNPPSFDKQYVRDWLESTGWNKTPPGPALPDEVAARTADKYRE 287

Query: 285 AYEKITGLKF 294
           A+E++TG  F
Sbjct: 288 AFERLTGKPF 297


>gi|325103870|ref|YP_004273524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter saltans DSM 12145]
 gi|324972718|gb|ADY51702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter saltans DSM 12145]
          Length = 314

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 186/322 (57%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M+ + +     P   ++Y GKVR+ Y + +   + + TDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKAIKETNFNFPGQTSFYKGKVRDVYTIDNKYLVMVVTDRISAFDVVLPEPIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   + + T DI  N  +  PD NV +G+  + F +E+++RGYLAG+        Y  G
Sbjct: 61  QIAAKFLNATKDIVPNWVVTVPDANVTIGRICEPFKVEMVIRGYLAGHVARE----YAAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR++    LP+ + +N KLP P+ITPTTK++      D+ IS  EI+ RGI+T   +  +
Sbjct: 117 KRELCGVALPEGLKENDKLPEPIITPTTKAAVG---HDEDISREEILKRGIVTEADYIQL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y   L++RG ++A   GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 ENYTRKLYQRGTEIAASQGLILVDTKYEFGKTEG-TIYLIDEIHTPDSSRYFYKEGYEEL 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++      ++   +P++    +   S+ YI  YEKITG KFI
Sbjct: 233 QAKGEPQKQLSKEFVRRWLIENGFQGKEGQQVPEMNAERVEAISERYIELYEKITGEKFI 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
              ++    +R+  N+    ++
Sbjct: 293 KAGTD-NVYKRVEENIIFALNK 313


>gi|163755517|ref|ZP_02162636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kordia
           algicida OT-1]
 gi|161324430|gb|EDP95760.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kordia
           algicida OT-1]
          Length = 315

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 121/315 (38%), Positives = 174/315 (55%), Gaps = 10/315 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P     Y+GKVRE Y ++D   + IATDRLSAFD  +   IP+KG++LNQI    
Sbjct: 8   TNFNFPNQTAKYTGKVREVYTINDDLLVMIATDRLSAFDVVMPKGIPFKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T  +  N  +  PDPNV +G   + F +E+++RGYL+G+        YK GKR++  
Sbjct: 68  MKATEHLVPNWLIATPDPNVAIGHMCKPFKVEMVIRGYLSGHAARE----YKAGKRRLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ M +N K P P+ITP TK+       D+ IS  EI+ +GI++   +  + +Y   
Sbjct: 124 VEMPEGMIENDKFPSPIITPATKAEMGE--HDEDISREEILAKGIVSEEDYAQLENYTRL 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LFE G K+A E GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  +TYE+  ++   
Sbjct: 182 LFEEGTKIAKERGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADTYEELQKKQEP 241

Query: 244 PIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W++      +    +P + +  I   S  YI  YE ITG  F   +   
Sbjct: 242 QKQLSKEFVRQWLINNDFQGKEGQTVPFMSDEYINSVSDRYIELYENITGETFKKADVS- 300

Query: 302 PPLERIRNNLRKYTH 316
             L RI  N+  +  
Sbjct: 301 NILNRIEENVVSFLE 315


>gi|256820356|ref|YP_003141635.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga ochracea DSM 7271]
 gi|256581939|gb|ACU93074.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Capnocytophaga ochracea DSM 7271]
          Length = 317

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 121/324 (37%), Positives = 185/324 (57%), Gaps = 13/324 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++K     P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MNTITKTNFKFPKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDTILPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           Q+   +   T DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG
Sbjct: 61  QMAVSFLQQTEDIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSA----RLYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
            RK+    LP+ + +    P  P+ITP TK+ +     D+ IS  ++I +GI++   +  
Sbjct: 117 VRKLSGVPLPEGLREFDMFPQHPIITPATKAEQG--LHDEDISREDLIRKGIVSEEDYRL 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y  +LF RG ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y++
Sbjct: 175 MEKYTYALFARGTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G   I L K+F+R W++++         +P + +  +   S+ YI  YE I G KF
Sbjct: 235 RQENGEPQIQLSKEFVRQWLISKGFQGEKGQKVPTMTDKYVQSVSERYIELYENIMGEKF 294

Query: 295 IADNSELPPLERIRNNLRKYTHRH 318
           +  ++      RI +N+ ++    
Sbjct: 295 LPADTS-DIENRIYDNIMRFLQNQ 317


>gi|110638311|ref|YP_678520.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Cytophaga
           hutchinsonii ATCC 33406]
 gi|122966754|sp|Q11TT6|PUR7_CYTH3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110280992|gb|ABG59178.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Cytophaga hutchinsonii ATCC 33406]
          Length = 310

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 123/320 (38%), Positives = 185/320 (57%), Gaps = 15/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +    +P    +Y GKVR+ Y+++D   + +A+DR+SAFD  +   IP+KG+VLN
Sbjct: 1   MNAIKETRFELPGQTGFYKGKVRDVYYVAD-KLVVVASDRISAFDVVLPRAIPFKGQVLN 59

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T+D+  N  L  PDP+V +G + + F +E+++RGYLAG+        YK G
Sbjct: 60  QIAAKMLAQTADVVPNWILSVPDPSVSIGIKCEPFKVEMVIRGYLAGHAARE----YKAG 115

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    LP+ + +N KLP P+ITPTTK+ E     D+ IS  +++ RGI++   +  +
Sbjct: 116 KRTLCGVALPEELKENDKLPAPIITPTTKADEG---HDEDISREDLLARGIVSEADYIQL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG +LA + GLILVD+KYEFG      I L DEIHTPDSSRY+ ++ Y + 
Sbjct: 173 EKYTQALFQRGTELAEKQGLILVDTKYEFGKVGD-KIYLIDEIHTPDSSRYFYIDGYAER 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++      +   N+P + + I+   S+ YI  YEK+ G  F 
Sbjct: 232 QAKGEAQKQLSKEFVRQWLIENGFQGKEGQNVPVMTDEIVSSISERYIELYEKVIGESFK 291

Query: 296 ADNSELPPLERIRNNLRKYT 315
               E  P ERI  N+ K  
Sbjct: 292 KP-EESNPEERILKNILKAL 310


>gi|319954743|ref|YP_004166010.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga algicola DSM 14237]
 gi|319423403|gb|ADV50512.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga algicola DSM 14237]
          Length = 317

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 124/316 (39%), Positives = 175/316 (55%), Gaps = 10/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +    P   + Y GKVRE Y L++   + IATDRLSAFD  +   IPYKG++LNQI    
Sbjct: 8   TNFNFPGQLSIYKGKVREVYTLANDIMVMIATDRLSAFDVVMPKGIPYKGQILNQIATKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              TSDI  N  L  PDPNV +G   + F +E+++RGY++G+        YK GKR +  
Sbjct: 68  MADTSDIVPNWLLATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGKRMLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ + +N K P P+ITP TK+       D+ IS  +I+ RGI++   +  +  Y   
Sbjct: 124 VALPEGLIENDKFPEPIITPATKAEMG--DHDEDISREDILKRGIVSEEDYSILEKYTKD 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF+RG ++A E GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y +  + G  
Sbjct: 182 LFQRGTEIAAERGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYTEGYTERQKNGAM 241

Query: 244 PIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W+++          +P++ ++ I   S  YI  YE I G  F   N   
Sbjct: 242 QKQLSKEFVRQWLISNDFQGLEGQKVPEMSDDYITTVSDRYIELYENIVGESFQKANIS- 300

Query: 302 PPLERIRNNLRKYTHR 317
               RI  N+  Y ++
Sbjct: 301 DIQTRIETNVLAYLNK 316


>gi|108761229|ref|YP_630309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Myxococcus xanthus DK 1622]
 gi|108465109|gb|ABF90294.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Myxococcus xanthus DK 1622]
          Length = 319

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 130/317 (41%), Positives = 173/317 (54%), Gaps = 13/317 (4%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +  +P L  +Y GKVRE Y   D   I + TDRLSAFD  +  IP+KGEVLN+++ +
Sbjct: 13  TLQQTDLPALGQHYRGKVRETYRQDDQ-LILVTTDRLSAFDHILTTIPFKGEVLNRLSAF 71

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T  I  NH LD PD NV V +  Q F +E++VRGYL G+        Y+ G    Y
Sbjct: 72  WFERTKHIVPNHVLDVPDANVTVARACQPFAVEVVVRGYLTGSLWRD----YQKGTHTAY 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               PD +  ++  P P+ITP+TK+       D+PIS  E++ RG+ T   W  IS  AL
Sbjct: 128 GLPFPDGLRKDEAFPAPLITPSTKAEYG--LHDEPISEKELLARGLATPGDWARISEAAL 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF  G K A   GLILVD+KYEFG      + + DE+HTPDSSRYW  + YE  F +G 
Sbjct: 186 GLFAEGQKWARSRGLILVDTKYEFGKVGD-TLYVIDEMHTPDSSRYWMADEYEARFAKGE 244

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+   R    +   P IP+++ +  +  Y+AAYE ITG     +    
Sbjct: 245 DQRMLDKENIRQWLIRERNFSGQGTPPPIPDDVRVDLAAKYVAAYEHITGTTLTLEP--G 302

Query: 302 PPLERIRNNLRK--YTH 316
               RI  NLR+  Y  
Sbjct: 303 DVKTRIERNLREKGYLK 319


>gi|149276252|ref|ZP_01882396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter sp. BAL39]
 gi|149232772|gb|EDM38147.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter sp. BAL39]
          Length = 314

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 120/322 (37%), Positives = 179/322 (55%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +     P+  N+Y GKVR+ Y ++D     + TDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MTAIKETNFSFPKQTNFYKGKVRDVYTINDEFMAMVVTDRISAFDVVLPEAIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  L  PD  V +G+  + F +E++VRGYLAG+        Y  G
Sbjct: 61  QIAAKFLTATQDIVPNWVLSVPDEMVTIGRICEPFKVEMVVRGYLAGHAWRE----YSAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    LP+ + +N +LP P+ITPTTK+S      D+ IS  +I+ +GI++   +E +
Sbjct: 117 RRSVCGVALPEGLKENDQLPAPIITPTTKASVG---HDEDISREDILAKGIVSLADYEQL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y L+L+ RG ++A   GLILVD+KYEFG   +  I L DEIHTPDSSRY+  E Y++ 
Sbjct: 174 EAYTLALYARGTEMAASRGLILVDTKYEFGKVGE-EIFLIDEIHTPDSSRYFYAEGYQER 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
                    L K+F+R W++      +D   +P +   I+   S+ YI  YE+ITG  F 
Sbjct: 233 QDANEPQKQLSKEFVRKWLIENGFQGKDGQVVPVMTPEIVNSISERYIELYEQITGDTFQ 292

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
             N      +RI  N+     +
Sbjct: 293 K-NETADVTQRIEVNVTAALAK 313


>gi|255039216|ref|YP_003089837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dyadobacter fermentans DSM 18053]
 gi|254951972|gb|ACT96672.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Dyadobacter fermentans DSM 18053]
          Length = 311

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 130/318 (40%), Positives = 196/318 (61%), Gaps = 15/318 (4%)

Query: 1   MRIL--SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  +  +    P    +Y GKVR+ Y       + IATDR+SAFD  +   IPYKG+VLN
Sbjct: 1   MNSIPATNFQFPGQTGFYKGKVRDVYSFE-KRLVMIATDRISAFDVILPRAIPYKGQVLN 59

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI  ++ + TSDI  N   + PDPNV +G + Q +P+E++VRGYLAG+        YK G
Sbjct: 60  QIAAHFLNATSDIVPNWLEEVPDPNVSIGLKCQAYPVEMVVRGYLAGHAWRE----YKAG 115

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR++    LP+ + +N KLP P+ITPTTK+ E     D+ IS  +I+ +G+++ +++E +
Sbjct: 116 KREVCGVALPEGLKENDKLPQPIITPTTKAHEG---HDEDISREQILAQGLVSEDEYEHL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF RG ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+  +TYE++
Sbjct: 173 ERYTLALFARGTEMAADQGLILVDTKYEFGQL-DGTIYLIDEIHTPDSSRYFYKDTYEEN 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            R G+    L K+F+R W++      +D   +P++ +  +   S+ YI  +EK+TG++F 
Sbjct: 232 QRAGVAQKQLSKEFVREWLIENGFQGKDGQTVPEMTDEKVTSISERYIELFEKVTGMQFQ 291

Query: 296 ADNSELPPLERIRNNLRK 313
            +N +  PLERI   + +
Sbjct: 292 KNNLD-HPLERIEKAILR 308


>gi|115352723|ref|YP_774562.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria AMMD]
 gi|170697610|ref|ZP_02888699.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria IOP40-10]
 gi|115282711|gb|ABI88228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria AMMD]
 gi|170137497|gb|EDT05736.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria IOP40-10]
          Length = 296

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 95/308 (30%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPEGLQNAQKLPEPIFTPAAKAELGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|171322045|ref|ZP_02910920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MEX-5]
 gi|171092648|gb|EDT37948.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MEX-5]
          Length = 296

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 95/308 (30%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESKLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPEGLQNAQKLPEPIFTPAAKAELGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|167585579|ref|ZP_02377967.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ubonensis Bu]
          Length = 296

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 148/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPILIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEYQE-----SGAVCGVKLPEGLQNAQKLPEPIFTPAAKAEMGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|311747449|ref|ZP_07721234.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Algoriphagus sp. PR1]
 gi|126574808|gb|EAZ79179.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Algoriphagus sp. PR1]
          Length = 312

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 119/319 (37%), Positives = 183/319 (57%), Gaps = 15/319 (4%)

Query: 2   RILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           + + + +   P    +Y GKVR+ Y       + +A+DR+SAFD  +   IP+KG+VLNQ
Sbjct: 3   KAIKETHYQFPGQVGFYKGKVRDVYIFE-KELVVVASDRISAFDVVLPKPIPFKGQVLNQ 61

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           I   +   TSDI  N     PDPNV +G++ + F +E+++RGY+AG+        YK GK
Sbjct: 62  IAAKFLEATSDIVPNWVSATPDPNVTIGKKCEPFKVEMVIRGYMAGHAARE----YKAGK 117

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP++M +N   P P+ITPTTK+SE     D+ IS   I+  GI++   +  + 
Sbjct: 118 RILCGVELPEHMRENDPFPEPIITPTTKASEG---HDEDISKEAILSEGIVSPEDYAVLE 174

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y  +LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + YE++ 
Sbjct: 175 KYTRALFKRGQEMASEMGLILVDTKYEFGKFGD-EIFLIDEIHTPDSSRYFYADGYEENQ 233

Query: 239 REGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G+    L K+F+R W+++     +   ++P++ + I+   S  YI  +EKITG KF  
Sbjct: 234 AKGLPQKQLSKEFVRQWLISNGFQGKEGQSVPEMTDEIVESISDRYIELFEKITGQKFEK 293

Query: 297 DNSELPPLERIRNNLRKYT 315
            ++      RI   +  + 
Sbjct: 294 ADTSQ-INSRIEKVILTHL 311


>gi|172061586|ref|YP_001809238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MC40-6]
 gi|171994103|gb|ACB65022.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MC40-6]
          Length = 296

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 147/308 (47%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEIEQVKGRGVVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPAGLQNAQKLPEPIFTPAAKAELGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|161523853|ref|YP_001578865.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|189351386|ref|YP_001947014.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|221200178|ref|ZP_03573221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2M]
 gi|221206669|ref|ZP_03579681.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2]
 gi|221211357|ref|ZP_03584336.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD1]
 gi|160341282|gb|ABX14368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|189335408|dbj|BAG44478.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|221168718|gb|EEE01186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD1]
 gi|221173324|gb|EEE05759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2]
 gi|221180417|gb|EEE12821.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2M]
          Length = 296

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 147/308 (47%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLEPILIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QATGAVCGVQLPAGLQNAQKLPEPIFTPAAKAEMGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|78067425|ref|YP_370194.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. 383]
 gi|77968170|gb|ABB09550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. 383]
          Length = 296

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 94/306 (30%), Positives = 147/306 (48%), Gaps = 27/306 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVVMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPEGLQNAQKLPEPIFTPAAKAEMGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGQLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y      G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----EVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGL 292
           E+ITG 
Sbjct: 288 ERITGQ 293


>gi|134279733|ref|ZP_01766445.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 305]
 gi|167718304|ref|ZP_02401540.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei DM98]
 gi|217419506|ref|ZP_03451012.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 576]
 gi|134248933|gb|EBA49015.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 305]
 gi|217396810|gb|EEC36826.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 576]
          Length = 296

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 99/308 (32%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|225012860|ref|ZP_03703293.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-2A]
 gi|225002982|gb|EEG40959.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-2A]
          Length = 316

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/316 (38%), Positives = 183/316 (57%), Gaps = 11/316 (3%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYW 63
           +  ++  L + Y+GKVRE Y L + T I +ATDRLSAFD  +   IP+KG++LNQI    
Sbjct: 8   TDLHLEGLKSKYTGKVREVYRLENDTLIMVATDRLSAFDVVMPKGIPFKGQILNQIANKM 67

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+DI  N  +  PDPNV +G   + F +E+++RGYL+G+   +    YK+G+R +  
Sbjct: 68  LAATADIVPNWLVATPDPNVSIGVACEPFKVEMVIRGYLSGHAART----YKSGERLLCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             +P+ + +N   P P+ITP TK+ E     D+ IS  EII + I++ + +  + SY   
Sbjct: 124 VSMPEGLIENDPFPTPIITPATKAEEG---HDEDISREEIIKQSIVSESDYLKLESYTHK 180

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF RG ++A + GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y +   + + 
Sbjct: 181 LFARGTEIAKKQGLILVDTKYEFGKTATGEILLIDEIHTPDSSRYFYEEGYAERQAKALP 240

Query: 244 PIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              L K+F+R W+++      +   +PD+  ++I   S  YI  YE ITGL F    +  
Sbjct: 241 QKQLSKEFVRQWLISNGFQGLEGQILPDMDSSLITSISDRYIELYENITGLPFEKA-TIS 299

Query: 302 PPLERIRNNLRKYTHR 317
              ERI+ N+  Y  +
Sbjct: 300 NIQERIQKNISNYLKQ 315


>gi|53718438|ref|YP_107424.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei K96243]
 gi|53725039|ref|YP_102125.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 23344]
 gi|67641172|ref|ZP_00439956.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei GB8 horse 4]
 gi|76809072|ref|YP_332411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1710b]
 gi|121601218|ref|YP_991942.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei SAVP1]
 gi|124385389|ref|YP_001028388.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei NCTC 10229]
 gi|126440287|ref|YP_001057888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 668]
 gi|126448933|ref|YP_001079621.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei NCTC 10247]
 gi|126455088|ref|YP_001065123.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1106a]
 gi|167002690|ref|ZP_02268480.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei PRL-20]
 gi|167737352|ref|ZP_02410126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 14]
 gi|167814475|ref|ZP_02446155.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 91]
 gi|167822940|ref|ZP_02454411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 9]
 gi|167844508|ref|ZP_02470016.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei B7210]
 gi|167893035|ref|ZP_02480437.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 7894]
 gi|167901495|ref|ZP_02488700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei NCTC 13177]
 gi|167909741|ref|ZP_02496832.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 112]
 gi|167917763|ref|ZP_02504854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei BCC215]
 gi|226199426|ref|ZP_03794984.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei Pakistan 9]
 gi|237811037|ref|YP_002895488.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei MSHR346]
 gi|242315411|ref|ZP_04814427.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1106b]
 gi|254176803|ref|ZP_04883460.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 10399]
 gi|254181612|ref|ZP_04888209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1655]
 gi|254187570|ref|ZP_04894082.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254196707|ref|ZP_04903131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei S13]
 gi|254203805|ref|ZP_04910165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei FMH]
 gi|254208783|ref|ZP_04915131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei JHU]
 gi|254260906|ref|ZP_04951960.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1710a]
 gi|254360164|ref|ZP_04976434.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei 2002721280]
 gi|52208852|emb|CAH34791.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amino imidazole
           synthetase [Burkholderia pseudomallei K96243]
 gi|52428462|gb|AAU49055.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 23344]
 gi|76578525|gb|ABA48000.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1710b]
 gi|121230028|gb|ABM52546.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei SAVP1]
 gi|124293409|gb|ABN02678.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei NCTC 10229]
 gi|126219780|gb|ABN83286.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 668]
 gi|126228730|gb|ABN92270.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1106a]
 gi|126241803|gb|ABO04896.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei NCTC 10247]
 gi|147745317|gb|EDK52397.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei FMH]
 gi|147750659|gb|EDK57728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei JHU]
 gi|148029404|gb|EDK87309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei 2002721280]
 gi|157935250|gb|EDO90920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160697844|gb|EDP87814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 10399]
 gi|169653450|gb|EDS86143.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei S13]
 gi|184212150|gb|EDU09193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1655]
 gi|225928502|gb|EEH24531.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei Pakistan 9]
 gi|237502859|gb|ACQ95177.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei MSHR346]
 gi|238522045|gb|EEP85492.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei GB8 horse 4]
 gi|242138650|gb|EES25052.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1106b]
 gi|243061681|gb|EES43867.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei PRL-20]
 gi|254219595|gb|EET08979.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1710a]
          Length = 296

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 99/308 (32%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKAPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|298715710|emb|CBJ28207.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 366

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 133/304 (43%), Positives = 185/304 (60%), Gaps = 8/304 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y   D   + + TDR SAFD+ +A +P+KG VLNQ + +WF  T  I  NH L 
Sbjct: 65  GKVRDTYICDDA-IVLVTTDRQSAFDRQLARVPFKGAVLNQTSAWWFEKTRHIAPNHLLG 123

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            P PNV VG++ ++FPIE ++RGYL G+T TS+   Y+ G R    + LP+ MS NQ LP
Sbjct: 124 SPHPNVCVGKKCKVFPIEFVMRGYLTGSTSTSIWKNYEKGTRAYCGHTLPEGMSKNQALP 183

Query: 138 Y-PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENG 196
              ++TPTTK        D+ IS  EI+    +++  W+  S  A +LF  G + A E G
Sbjct: 184 MGNILTPTTKDD----LHDELISAQEIVSSNRMSQQDWDECSRLAHALFRFGQEAAAERG 239

Query: 197 LILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWI 256
           LILVD+KYE G D   NIIL DEIHTPDSSRYW  ETYE +  +G  P  +DK+F+R W 
Sbjct: 240 LILVDTKYELGKDADGNIILVDEIHTPDSSRYWVKETYEGNISQGREPENIDKEFLRRWY 299

Query: 257 LTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL-ERIRNNLRKY 314
              C+PY+D  +PD P  ++   S+ Y+  YE ITG  F+  + + PP+ ER+ +++  +
Sbjct: 300 TQHCDPYKDETVPDAPRELVAELSRRYVMLYEIITGQDFVFPSEDGPPVDERMSSSVSNF 359

Query: 315 THRH 318
              H
Sbjct: 360 LKSH 363


>gi|297184141|gb|ADI20260.1| hypothetical protein [uncultured Sphingobacterium sp. EB080_L08E11]
          Length = 316

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 114/320 (35%), Positives = 174/320 (54%), Gaps = 10/320 (3%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M          L ++Y GKVR+ Y +     + +A++R+SAFD  +   IP KG+VLNQI
Sbjct: 1   MNQEPTYQFSGLTHFYRGKVRDVYTIGRDVLVMVASNRISAFDVVLPRPIPGKGQVLNQI 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +++   T DI  N  L  PD  V +G + + F +E+++RGYLAG+   +    YK+G R
Sbjct: 61  AEHFLEATKDIVPNWRLATPDAQVTIGHRAEPFKVEMVIRGYLAGHAART----YKSGIR 116

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
           ++    LP+ M +N   P P+ITP TK+       D+ IS   II +GI++   +  +  
Sbjct: 117 ELCGVTLPEGMKENGAFPEPIITPATKAEHG--AHDEDISREAIITKGIVSEADYILLEQ 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
           Y  +LF+RG ++A E GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y +   
Sbjct: 175 YTRALFKRGSEMAAERGLILVDTKYEFGKLADGTIVLIDEIHTPDSSRYFYAEGYGERQN 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIAD 297
           +      L K+F+R W++      +    +P++ ++ +   S  Y   +EKITG  F   
Sbjct: 235 KNEPQRQLSKEFVREWLMENGFQGQNGQEVPEMTDDFVQLVSNRYQELFEKITGKPFQK- 293

Query: 298 NSELPPLERIRNNLRKYTHR 317
            S+     RI+ N+  Y   
Sbjct: 294 VSDEGAEARIKRNVENYLST 313


>gi|315223486|ref|ZP_07865342.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga ochracea F0287]
 gi|314946521|gb|EFS98513.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga ochracea F0287]
          Length = 317

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/324 (37%), Positives = 184/324 (56%), Gaps = 13/324 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  ++K     P+    Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MNTITKTNFKFPKQKTVYRGKVRDVYQLKDDTLIMIATDRISAFDTILPKGIPYKGQILN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           Q+   +   T DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG
Sbjct: 61  QMAVSFLQQTEDIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSA----RLYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
            RK+    LP+ + +    P  P+ITP TK+ +     D+ IS  ++I +GI++   +  
Sbjct: 117 VRKLSGVPLPEGLREFDMFPQHPIITPATKAEQG--LHDEDISREDLIRKGIVSEEDYRL 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y  +LF RG ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y+K
Sbjct: 175 MEKYTYALFARGTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDK 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G   I L K+F+R W++++         +P + +  +   S+ YI  YE I G KF
Sbjct: 235 RQENGEPQIQLSKEFVRQWLISKGFQGEKGQKVPTMTDKYVQSVSERYIELYENIMGEKF 294

Query: 295 IADNSELPPLERIRNNLRKYTHRH 318
           +  ++      RI +N+ ++    
Sbjct: 295 LPADTS-DIENRIYDNIMRFLQNQ 317


>gi|107023561|ref|YP_621888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia AU 1054]
 gi|116690645|ref|YP_836268.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia HI2424]
 gi|170733989|ref|YP_001765936.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia MC0-3]
 gi|206561175|ref|YP_002231940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia J2315]
 gi|254247335|ref|ZP_04940656.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia cenocepacia PC184]
 gi|105893750|gb|ABF76915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia AU 1054]
 gi|116648734|gb|ABK09375.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia HI2424]
 gi|124872111|gb|EAY63827.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia cenocepacia PC184]
 gi|169817231|gb|ACA91814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia MC0-3]
 gi|198037217|emb|CAR53138.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amin o imidazole
           synthetase [Burkholderia cenocepacia J2315]
          Length = 296

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 146/308 (47%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVVMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPAGLQNAQKLPEPIFTPAAKAEMGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y      G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----EVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQSL 295


>gi|327404400|ref|YP_004345238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fluviicola taffensis DSM 16823]
 gi|327319908|gb|AEA44400.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Fluviicola taffensis DSM 16823]
          Length = 319

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/319 (37%), Positives = 186/319 (58%), Gaps = 14/319 (4%)

Query: 2   RILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
             ++      P+  N Y GKVRE Y + + T + +ATDR+SAFD  +   IP+KG+VLNQ
Sbjct: 4   ETITSTNFKFPKQTNVYRGKVREVYTIDNDTMVMVATDRISAFDHILPKGIPFKGQVLNQ 63

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +   +   T DI  N  +  PDP+V VG   +   +E+++RGYLAG++       Y  GK
Sbjct: 64  VATMFLEATRDIVPNWLIGAPDPSVAVGYACEPVRVEMVIRGYLAGHSARE----YALGK 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +   +LP+ M +N + P P+ITP +K+ E     D+ IS  +I+  GI+ +  +E + 
Sbjct: 120 RMLCGVVLPEGMKENDRFPEPIITPASKAEEG---HDEDISREDILKNGIVPQEIYEKME 176

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
           +Y  +LF+RG ++A E GLILVD+KYEFGI +   +IL DEIHTPDSSRY+  + YE+  
Sbjct: 177 AYTRALFQRGTEMAAERGLILVDTKYEFGI-RNGEVILIDEIHTPDSSRYFYADGYEERQ 235

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +G     L K+F+R W++       +   +P++P++ +   ++ YI  YEKITG  F  
Sbjct: 236 AKGENQRQLSKEFVRQWLIENGFQGLEGQVMPEMPDSFVETITERYIELYEKITGNTFEK 295

Query: 297 DNSELPPLERIRNNLRKYT 315
            ++     +RI  N+  + 
Sbjct: 296 GDTS-NINKRIETNVAVFL 313


>gi|254296308|ref|ZP_04963765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 406e]
 gi|157805679|gb|EDO82849.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 406e]
          Length = 296

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 99/308 (32%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKERAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKAPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|134296831|ref|YP_001120566.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia vietnamiensis G4]
 gi|134139988|gb|ABO55731.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia vietnamiensis G4]
          Length = 296

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 146/308 (47%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++       V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAAVVKRLEPIMIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVPLPAGLQNAQKLPEPIFTPAAKAELGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVAKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|332668147|ref|YP_004450935.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haliscomenobacter hydrossis DSM 1100]
 gi|332336961|gb|AEE54062.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haliscomenobacter hydrossis DSM 1100]
          Length = 317

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 115/320 (35%), Positives = 179/320 (55%), Gaps = 15/320 (4%)

Query: 3   ILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
            + ++   +P    +Y GKVR+ Y L +   + +A+DR+SAFD  +   IPYKG+VLNQI
Sbjct: 8   AIRESNFQLPGQTAFYRGKVRDVYTLGEQ-LLMVASDRISAFDYVLPRPIPYKGQVLNQI 66

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
             ++   T+DI  N     PDPNV +G   + F +E+++R YL G++       Y  G+R
Sbjct: 67  AAHFLKATADIVPNWLQATPDPNVAIGHACEPFRVEMVIRAYLVGHSA----RVYAIGER 122

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +N   P P+ITP TK+ E     D+ IS  +II +GI+    +  + +
Sbjct: 123 SLCGISLPEGLRENDPFPTPIITPATKAEEG---HDEGISREDIIAKGIVAEADYIQLET 179

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
           Y  +LF+RG ++A + GLILVD+KYEFG  K   I + DEIHTPDSSRY+ +E Y +   
Sbjct: 180 YTRALFQRGTEMAAKQGLILVDTKYEFGK-KDGQIYVIDEIHTPDSSRYFYLEGYAERQA 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIAD 297
           +G     L K+F+R W++      +    IP + +  +   S  YI  YE+ITG  F+  
Sbjct: 239 KGERQKQLSKEFVREWLIENGFQGKPGQTIPAMSDEFVWEISNRYIELYERITGTAFVKA 298

Query: 298 NSELPPLERIRNNLRKYTHR 317
           ++     ERI  N+  +  +
Sbjct: 299 DT-ANIAERIYQNVLAWMEK 317


>gi|224826145|ref|ZP_03699248.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lutiella
           nitroferrum 2002]
 gi|224601782|gb|EEG07962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lutiella
           nitroferrum 2002]
          Length = 292

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 94/304 (30%), Positives = 151/304 (49%), Gaps = 27/304 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  ++   +  L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I
Sbjct: 1   MTGITTTNLTSLKKIYSGKVRDLYQIDDKRMLMIATDRLSAFDVILDDPIPGKGQILTAI 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    D+  NH              L   +   +V ++L+  PIE +VRGYLAG+ 
Sbjct: 61  SNFWFERLKDLVPNHLTGDKPEDVVSAEDLPQVEGRAVVAKRLKAVPIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + +  +LP P+ TP+TK++      D+ IS    +  
Sbjct: 121 WKEYQQ-----SGTVCGIKLPEGLKEASQLPEPIFTPSTKAAVG--DHDENISYERCVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     E +   A++L++     A   G+I+ D+K+EFG+D+   + L DE  TPDSS
Sbjct: 173 -IIGAELAEKVRDTAITLYKAAAFYAATRGIIICDTKFEFGLDEDGTLTLMDEALTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++Y      G  P   DK F+R+W+       +   P +P ++  +T+  Y  A 
Sbjct: 232 RFWPADSYVA----GSNPPSFDKQFVRDWLEASGWNKQAPAPAVPLDVREKTADKYREAL 287

Query: 287 EKIT 290
           E++T
Sbjct: 288 ERLT 291


>gi|167835599|ref|ZP_02462482.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis MSMB43]
          Length = 296

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              +       +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVGQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWSKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|284037555|ref|YP_003387485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Spirosoma
           linguale DSM 74]
 gi|283816848|gb|ADB38686.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Spirosoma
           linguale DSM 74]
          Length = 313

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 120/318 (37%), Positives = 183/318 (57%), Gaps = 15/318 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +     P    +Y GKVR+ Y   D   + IA+DR+SAFD  +   IP+KG+VLN
Sbjct: 1   MNAIQETNFQFPGQTAFYRGKVRDVYSFPD-KLVMIASDRISAFDVVLPRPIPFKGQVLN 59

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           Q   Y+   T+DI  N  LD PDPNV +G + + + +E++VRGYLAG+        Y++G
Sbjct: 60  QTASYFLKATADIVPNWLLDVPDPNVSIGLKCEPYAVEMVVRGYLAGHAW----RQYRDG 115

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LPD + +N +LP P+ITP+TK+ E     D+ IS  EI+ R I+ + ++E +
Sbjct: 116 HRILCGVPLPDGLRENDRLPTPIITPSTKAHEG---HDEDISREEILSRSIVPQEEYEQL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             YAL+LF RG ++A + GLILVD+KYEFG +    + L DE+HTPDSSRY+  +TY+ +
Sbjct: 173 EQYALALFARGTEMAAQQGLILVDTKYEFG-NLDGKVYLIDEVHTPDSSRYFYADTYQAN 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                    L K+F+R W++      +    IP + +  + + +  YI  +EK+TG  F 
Sbjct: 232 QEAEQPQKQLSKEFVREWLIANGFQGKTGQTIPAMSDEWVNQITTRYIELFEKVTGQSFQ 291

Query: 296 ADNSELPPLERIRNNLRK 313
                  P+ RI  N+ +
Sbjct: 292 PA-EATDPVARIETNILR 308


>gi|254251529|ref|ZP_04944847.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia dolosa AUO158]
 gi|124894138|gb|EAY68018.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia dolosa AUO158]
          Length = 296

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 95/308 (30%), Positives = 148/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   IE +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLEPILIEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 121 WKEY-----QASGAVCGVQLPAGLQNAQKLPEPIFTPAAKAEMGE--HDENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVAKTAAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQPL 295


>gi|313675630|ref|YP_004053626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Marivirga
           tractuosa DSM 4126]
 gi|312942328|gb|ADR21518.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Marivirga
           tractuosa DSM 4126]
          Length = 334

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 128/321 (39%), Positives = 188/321 (58%), Gaps = 15/321 (4%)

Query: 1   MRILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +    +P   N+Y GKVR+ Y   D   I +ATDRLSAFD  +   IP+KG+VLN
Sbjct: 24  MEAIRETNFQLPNQQNFYRGKVRDVYTTPDQ-LIMVATDRLSAFDVVMPRAIPFKGQVLN 82

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T DI  N  +  PDPNV VG   + +P+E+++RGYLAG+        Y++G
Sbjct: 83  QIAAKALKDTEDIVPNWLIANPDPNVSVGFNCETYPVEMVIRGYLAGHAWRE----YRDG 138

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           KR +    LP+ + +N KLP P+ITPTTK+ E     D+ IS  EI+ +G++++ ++E +
Sbjct: 139 KRSVCGVSLPEGLKENDKLPSPIITPTTKAHEG---HDEDISREEILKQGLVSKEEYEKL 195

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            SY   LF+RG ++A +NGLILVD+KYEFG      I L DEIHTPDSSR++  + Y+++
Sbjct: 196 ESYTQQLFQRGTEIAAKNGLILVDTKYEFGKVGD-KIYLIDEIHTPDSSRFFYSDVYDEN 254

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G+    L K+F+R W++      +D   IP++ +  +   S  YI  YEK+TG KF 
Sbjct: 255 QSKGLKQKQLSKEFVREWLIENGFQGKDGQKIPEMTDEKVEEISNRYIELYEKVTGEKF- 313

Query: 296 ADNSELPPLERIRNNLRKYTH 316
                   L+ I  N+ K   
Sbjct: 314 KPRDYNDVLKTIEQNILKSIK 334


>gi|83721421|ref|YP_441222.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
 gi|167579979|ref|ZP_02372853.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis TXDOH]
 gi|167618049|ref|ZP_02386680.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis Bt4]
 gi|257140112|ref|ZP_05588374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
 gi|83655246|gb|ABC39309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
          Length = 296

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWSKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|312885693|ref|ZP_07745327.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mucilaginibacter paludis DSM 18603]
 gi|311301789|gb|EFQ78824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mucilaginibacter paludis DSM 18603]
          Length = 314

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 123/320 (38%), Positives = 188/320 (58%), Gaps = 14/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +    +P   NYY GKVR+ Y +S+     + TDR+SAFD  +   IPYKG+VLN
Sbjct: 1   MNSIKETHFNLPGQTNYYKGKVRDVYTISNKYLAMVVTDRISAFDVVLPEPIPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DI  N  L  PDPNV +G+  + F +E+++RGYLAG+        YK G
Sbjct: 61  QIAAKFLSATADIVPNWVLSVPDPNVTIGRICEPFKVEMVIRGYLAGHAARE----YKVG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    L + + +N KL  P+ITPTTK+S      D+ IS  +I+ +GI++ + +  +
Sbjct: 117 RRAVCGVTLAEGLKENDKLAEPIITPTTKASVG---HDEDISREDILAKGIVSESDYIQL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y  +LF+RG ++A + GLILVD+KYEFG +    I L DEIHTPDSSRY+  E YE+ 
Sbjct: 174 EAYTRALFQRGTEMAAKQGLILVDTKYEFG-NVDGQIYLIDEIHTPDSSRYFYKEGYEER 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
            + G     L K+F+R W++      +D   +P +  + +   S+ YI  YE+I G KF+
Sbjct: 233 QKNGEPQKQLSKEFVRQWLIENGFQGKDGQQVPVMDADKVNSISERYIELYEQIIGEKFV 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
              ++   LER+  N+++  
Sbjct: 293 KP-ADGNVLERVERNIKEAL 311


>gi|312130319|ref|YP_003997659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leadbetterella byssophila DSM 17132]
 gi|311906865|gb|ADQ17306.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leadbetterella byssophila DSM 17132]
          Length = 313

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 131/322 (40%), Positives = 188/322 (58%), Gaps = 15/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  +S+         ++Y GKVR+ Y L     + IATDR+SAFD  +   IPYKG+VLN
Sbjct: 1   MNTISETDFQFKNQTSFYRGKVRDVYGLG-KYVLMIATDRISAFDVVLPRPIPYKGQVLN 59

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T DI  N  +  PDPN  +G +   FP+E++VRGYLAG+        YK G
Sbjct: 60  QIAARNLEATRDIVPNWLIAVPDPNAALGIKCDTFPVEMVVRGYLAGHAWRE----YKAG 115

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R++    LP+ + +N KLP+P+ITPTTK+ E     DQ IS  EI+  G++   ++  +
Sbjct: 116 RRQVCGVTLPEGLKENDKLPHPIITPTTKAHEG---HDQDISREEILSSGLVQEEKYLML 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             YAL+LFE+G ++A ENGLILVD+KYEFG      I L DEIHTPDSSRY+ ++ YE++
Sbjct: 173 EKYALALFEKGTQMARENGLILVDTKYEFGEVGD-TIYLIDEIHTPDSSRYFYLDKYEEN 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G+    L K+F+R W++      +D   +P++ +  I   S  YI  YEK TG KF 
Sbjct: 232 QAAGLPQKQLSKEFVREWLIENGFQGQDGQKVPEMTDEKIEEISNRYIELYEKFTGEKF- 290

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
                   L+R+ +N+ K+  +
Sbjct: 291 KKKPSENILKRVHDNVEKFLKK 312


>gi|222641738|gb|EEE69870.1| hypothetical protein OsJ_29683 [Oryza sativa Japonica Group]
          Length = 403

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 130/317 (41%), Positives = 188/317 (59%), Gaps = 6/317 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
                  +P +     GKVR+ Y   +   + + TDR SAFD+ +A IP+KG+VLN+ + 
Sbjct: 91  ETSLHLAVPGVRVGAKGKVRDVYESGE-HLVLVTTDRQSAFDRVLASIPFKGQVLNETSL 149

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G R  
Sbjct: 150 WWFDRTRHITPNAVVSSPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKGARNY 209

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +L D M  NQKL   ++TPTTK+    +  D P++P EII+ G++++  ++   S A
Sbjct: 210 CGNVLRDGMVKNQKLSANILTPTTKA----ADHDVPVTPEEIINSGLMSKEDFDEARSKA 265

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LSLF  G ++ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ F  G
Sbjct: 266 LSLFAYGQEVALENGLILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEERFSSG 325

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++
Sbjct: 326 LEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEIPKTQ 385

Query: 301 LPPLERIRNNLRKYTHR 317
            P  ERI  N+ +    
Sbjct: 386 EPIHERISRNVAQALQN 402


>gi|296268162|ref|YP_003650794.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermobispora bispora DSM 43833]
 gi|296090949|gb|ADG86901.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermobispora bispora DSM 43833]
          Length = 283

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 162/294 (55%), Gaps = 23/294 (7%)

Query: 13  PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDIC 71
            + +SGKVR+ Y   DG  + +A+DR+SAFD  +   IP KG++L Q++ +WF   +DI 
Sbjct: 3   KHLHSGKVRDLYETEDGLLLMVASDRISAFDHVLQPEIPDKGKILTQLSLWWFDQLADIV 62

Query: 72  SNHTLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
            NH +    P        + ++L+M P+E + RGYLAG+  T            I    L
Sbjct: 63  PNHVVSTDVPPEYAGRAVLCRKLRMVPVECVARGYLAGSGLTDYRK-----DGAISGVPL 117

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P  +++  +LP P+ TP+TK+ +     D+P++ +E++    + +   E +    L+++E
Sbjct: 118 PPGLTEGSRLPEPIFTPSTKAPKGE--HDRPMTFDEVVAE--VGQEVAEELRRITLAVYE 173

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A E G+IL D+K E G D+   + L DE+ TPDSSR+W +  ++    +      
Sbjct: 174 RGARIAAERGIILADTKIELGWDENGVLTLGDEVLTPDSSRFWPLGEWKPGRPQ----PS 229

Query: 247 LDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            DK F+R+W+L+  + +        P +P+ ++ RT + YI AYE +TG +F  
Sbjct: 230 FDKQFVRDWLLSPESGWDRASGAAPPPLPDEVVARTRERYIQAYELLTGRRFEP 283


>gi|167561721|ref|ZP_02354637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia oklahomensis EO147]
 gi|167568957|ref|ZP_02361831.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia oklahomensis C6786]
          Length = 296

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVEQVKGRGVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGH--HDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L+      A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYREAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+  +        P +P+++I +TS  Y  A 
Sbjct: 232 RFWPADEY----QVGTNPPSFDKQFVRDWLEAQDWNKEPPAPKLPDDVIAKTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGKTL 295


>gi|300770119|ref|ZP_07079998.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762595|gb|EFK59412.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Sphingobacterium spiritivorum ATCC 33861]
          Length = 337

 Score =  272 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 119/322 (36%), Positives = 182/322 (56%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +          +Y GKVR+ Y ++D     +ATDR+SAFD  +   IPYKG+VLN
Sbjct: 23  MNAIRETNFNFENQTAFYRGKVRDVYTIADRYLAMVATDRISAFDVVLPRAIPYKGQVLN 82

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  ++ PDP+V +G+  + F +E+++RGYL+G+        Y  G
Sbjct: 83  QIAAKFLKATEDILPNWVVEVPDPSVTIGKMCEPFKVEMVIRGYLSGHAWRE----YSAG 138

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R++    L + + +N KLP P+ITPTTK++      D+ IS  +I+ +GI++   +  +
Sbjct: 139 RREVCGEKLVEGLKENDKLPEPIITPTTKAAVG---HDEDISRADILKKGIVSEEDYIQL 195

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+ 
Sbjct: 196 EKYTKALFQRGTEIAKERGLILVDTKYEFGK-RDGVIYLIDEIHTPDSSRYFYAEGYEER 254

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++      +D   +P++ + I+   S+ YI  YE ITG +F 
Sbjct: 255 QANGEPQKQLSKEFVRKWLIENGFQGKDGQQVPEMTDEIVNSISERYIELYEHITGERFE 314

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E   L R+ +N+      
Sbjct: 315 YPK-EGEVLGRVEHNISTALKT 335


>gi|242044994|ref|XP_002460368.1| hypothetical protein SORBIDRAFT_02g027070 [Sorghum bicolor]
 gi|241923745|gb|EER96889.1| hypothetical protein SORBIDRAFT_02g027070 [Sorghum bicolor]
          Length = 400

 Score =  272 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 187/315 (59%), Gaps = 6/315 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
                  +P L     GKVR+ Y   +   + + TDR SAFD+ +A IP+KG+VLN+ + 
Sbjct: 88  ETRLDLAVPGLRLAAKGKVRDVYESGE-HLVLVTTDRQSAFDRVLASIPFKGQVLNETSL 146

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF+ T  I  N  +  PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R  
Sbjct: 147 WWFNQTRHITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNY 206

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LPD M  NQKL   ++TPTTK+    +  D P++P+EII  G++++  +    S A
Sbjct: 207 CGNALPDGMVKNQKLSANILTPTTKA----ADHDVPVTPDEIIKSGLMSKEDFHEAGSKA 262

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LSLF  G K+ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G
Sbjct: 263 LSLFAYGQKVALENGLILVDTKYEFGKTADGTIVLIDEVHTPDSSRYWIANSYEDRFKSG 322

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++
Sbjct: 323 LEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILETQ 382

Query: 301 LPPLERIRNNLRKYT 315
            P  ERI  N+ +  
Sbjct: 383 EPIHERISRNVAQAL 397


>gi|303289162|ref|XP_003063869.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454937|gb|EEH52242.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 285

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 122/286 (42%), Positives = 170/286 (59%), Gaps = 5/286 (1%)

Query: 31  RITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQ 90
            + + TDR SAFD+++A IP+KG VLNQ + +WF +T  I  N  L  PDPNV + ++ +
Sbjct: 1   MLAVTTDRQSAFDRHLASIPFKGAVLNQTSAWWFDNTKHIVPNAWLSSPDPNVTIMKKCE 60

Query: 91  MFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSES 150
           +FPIE +VRGY+ G+T TSL T Y  G R      L D M  NQKLP  ++TPTTK  E 
Sbjct: 61  VFPIEFVVRGYMTGSTSTSLWTHYNAGGRDYCGNALADGMVKNQKLPANIVTPTTKEKE- 119

Query: 151 ASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK 210
               D+PIS  +I+  G + +   +      L++F     +A   GLILVD+KYEFG D 
Sbjct: 120 ---HDRPISLEDIVKEGWMRKEDLDYCVEKTLAVFSHAQGVAANRGLILVDTKYEFGRDA 176

Query: 211 KQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN-IPD 269
              I L DEI+TPDSSRYW  ++Y +    G  P  +DK+F+R W   RC+PY+D  IP+
Sbjct: 177 DGVIRLIDEINTPDSSRYWLADSYAERHAAGREPAMIDKEFLRLWFSERCDPYKDETIPE 236

Query: 270 IPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYT 315
            P  +++  SQ YI  YE ITG  F+   +++   ERI  N++   
Sbjct: 237 APAELVVELSQRYIKLYEMITGETFVPPPTDVDVGERIAKNVKDAL 282


>gi|153004018|ref|YP_001378343.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter sp. Fw109-5]
 gi|152027591|gb|ABS25359.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter sp. Fw109-5]
          Length = 320

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 113/311 (36%), Positives = 174/311 (55%), Gaps = 11/311 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +  +P L   Y GKVR+NY   D   + + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 14  TLRQLDLPSLGELYRGKVRDNYSRGD-RIVMVTTDRVSAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    D+   H +D PDP+V+V ++ +  PIE+++RGY+ G+        Y+ GK   Y
Sbjct: 73  WFEKVKDVAPTHVVDLPDPSVMVVKRAKPLPIEIVIRGYITGSLWRD----YQAGKAGAY 128

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PIS  E++ +G++    W   ++ A 
Sbjct: 129 GIEWPKGLRKDQRFDRPIITPSTKAEYGK--HDEPISEQELLSQGLVAPELWREATAVAE 186

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF RG + AL  GLILVD+KYE G+     +++ DEIHTPDSSRYW  + YE  F  G 
Sbjct: 187 RLFARGQEWALSRGLILVDTKYEMGV-VDGKLVVIDEIHTPDSSRYWVADGYEDRFARGA 245

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+            P + +++ +  ++ YI  +E++TG  F ++    
Sbjct: 246 EQEMLDKENIRQWLIKEHGFSGHGAPPPLSDDVRVMLARKYIEVFERLTGETFASEVGS- 304

Query: 302 PPLERIRNNLR 312
              +RIR NL 
Sbjct: 305 -VEDRIRRNLA 314


>gi|186475230|ref|YP_001856700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phymatum STM815]
 gi|184191689|gb|ACC69654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phymatum STM815]
          Length = 296

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPDKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH               +      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLKHVVPNHLTGVAPETVVAPDEAEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + + QKLP P+ TP  K+       D+ I+  E+  R
Sbjct: 121 WKDY-----QATGAVCGVQLPEGLQNAQKLPEPIFTPAAKAEMGH--HDENITYEEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDQNGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P+ ++ +T++ Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDEVVTKTAEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGQKL 295


>gi|229495572|ref|ZP_04389305.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas endodontalis ATCC 35406]
 gi|229317555|gb|EEN83455.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas endodontalis ATCC 35406]
          Length = 316

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/322 (37%), Positives = 179/322 (55%), Gaps = 14/322 (4%)

Query: 1   MRILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           +  L +    +P   + Y GKVR+ YFL       IATDR+SAFD  +   IPYKG+VLN
Sbjct: 3   IETLLRTDYNLPGQQSVYHGKVRDVYFLEGDLVAMIATDRISAFDVILPAGIPYKGQVLN 62

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI       T+DI  N  +  PDP V +G + + F +E+++RGY+ G+        Y+ G
Sbjct: 63  QIAAKQLDATADIVPNWKIATPDPMVTIGHKCEPFKVEMVIRGYITGSAW----RAYQEG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R I    L + + +NQ+  +P+ITPTTK+ E     D+ IS  EII  G+++   +  +
Sbjct: 119 ARSICGIPLAEGLRENQRFEHPIITPTTKADEG---HDENISREEIISSGLVSEEDYTLL 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF RG K+A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E +E+ 
Sbjct: 176 EQYTQDLFARGSKIAEEMGLILVDTKYEFGK-KDGKIYLIDEIHTPDSSRYFYAEGFEER 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W+  +    ++   +P++ +   L  ++ YI  YE +TG KF+
Sbjct: 235 FAKGEPQRQLSKEFVRKWLTEQGFMGKEGQKVPEMTDEYCLSVAERYIELYEHVTGEKFV 294

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               +    +RI  N+  +  +
Sbjct: 295 HA-EQDHLAQRIEKNITDFLKK 315


>gi|227538572|ref|ZP_03968621.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241491|gb|EEI91506.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sphingobacterium spiritivorum ATCC 33300]
          Length = 325

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 118/322 (36%), Positives = 181/322 (56%), Gaps = 14/322 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + +          +Y GKVR+ Y ++D     +ATDR+SAFD  +   IPYKG+VLN
Sbjct: 7   MNAIRETNFNFENQTAFYRGKVRDVYTIADRYLAMVATDRISAFDVVLPRAIPYKGQVLN 66

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  ++ PDP+V +G+  + F +E+++RGYL+G+        Y  G
Sbjct: 67  QIAAKFLKATEDILPNWVVEVPDPSVTIGKMCEPFKVEMVIRGYLSGHAWRE----YSAG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R++    L + + +N KLP P+ITPTTK++      D+ IS  +I+ +GI++   +  +
Sbjct: 123 RREVCGEKLVEGLKENDKLPEPIITPTTKAAVG---HDEDISRADILKKGIVSEEDYIQL 179

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE  
Sbjct: 180 EKYTKALFQRGTEIAKERGLILVDTKYEFGK-RDGVIYLIDEIHTPDSSRYFYADGYEDR 238

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G     L K+F+R W++      +D   +P++ + I+   S+ YI  YE ITG +F 
Sbjct: 239 QSNGEPQKQLSKEFVRKWLIENGFQGKDGQQVPEMTDEIVNSISERYIELYEHITGERFE 298

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
               E   L R+ +N+      
Sbjct: 299 YPK-EGEVLGRVEHNISTALKT 319


>gi|301108181|ref|XP_002903172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phytophthora infestans T30-4]
 gi|262097544|gb|EEY55596.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phytophthora infestans T30-4]
          Length = 342

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 185/313 (59%), Gaps = 8/313 (2%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHT 67
            +P      +GKVR+ Y   D   + ++TDR SAFD+ +A +P+K  VL   + +WF+ T
Sbjct: 36  ELPAFKQI-TGKVRDVYVFED-RVLLVSTDRQSAFDRALASVPFKSRVLTLTSVWWFNQT 93

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
             I +NH L  P P+ ++ ++  +FP+E +VRGY+ G+T TS+ T YKNG R    + L 
Sbjct: 94  KHIVANHLLGVPHPSAMLCKKCTVFPVEFVVRGYITGSTSTSMWTNYKNGSRDFCGHKLQ 153

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           D    +QKLP  ++TPTTK  E     D+ IS  EI+  G +T+ QW+      L LF  
Sbjct: 154 DGYKQHQKLPQNLVTPTTKDDE----HDELISGVEIVSSGRMTQEQWDYCEKKTLELFAF 209

Query: 188 GCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           G + A + GLILVD+KYEFG D+    I+L DEIHTPDSSRYW  ++YE+   EG +P  
Sbjct: 210 GQEQAAKRGLILVDTKYEFGYDEATGEILLIDEIHTPDSSRYWLADSYEQRMAEGKSPEN 269

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W   RC+PY D + P+ P+ ++   S+ YI  YE ITG +F     E+ P +
Sbjct: 270 IDKEFLRLWFKERCDPYNDAVLPEAPKELVSELSRRYILLYELITGSEFEFPAVEIKPED 329

Query: 306 RIRNNLRKYTHRH 318
            +   +RK     
Sbjct: 330 ELVEGVRKTLLSQ 342


>gi|256424474|ref|YP_003125127.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chitinophaga pinensis DSM 2588]
 gi|256039382|gb|ACU62926.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Chitinophaga pinensis DSM 2588]
          Length = 309

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 181/311 (58%), Gaps = 12/311 (3%)

Query: 6   KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF 64
              +P    +Y GKVR+ Y + D   +  A+DR+SAFD  +   IPYKG+VLNQ+     
Sbjct: 5   NFKLPGQTAFYKGKVRDVYTIGDKLMVMAASDRISAFDVVLPRPIPYKGQVLNQVAAIML 64

Query: 65  HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             T DI  N   + P PNV +G + + FP+E++VRG L G+   +    YK+GKR++   
Sbjct: 65  EATKDIVPNWVKNVPLPNVTIGLKCETFPVEMVVRGNLTGHAWRT----YKSGKRELCGV 120

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            +P+ + +N   P P+ITPTTK+ E     D+ IS  +II +G++T+  +E +  Y L+L
Sbjct: 121 TMPEGLKENDFFPSPIITPTTKAHEG---HDEDISREDIIAKGLVTKEDYEQLEKYTLAL 177

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           F RG +LA   GLILVD+KYEFG      I + DEIHTPDSSRY+  E YE+  + G   
Sbjct: 178 FARGKELAAARGLILVDTKYEFGKIGD-TIYVIDEIHTPDSSRYFYAEGYEEKQKNGEPQ 236

Query: 245 IGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSEL 301
             L K+F+R W++      +D   +P++ +  +   S+ YI  +E ITG +F+  D S+ 
Sbjct: 237 KQLSKEFVREWLMANGFQGKDGQQVPEMTDEFVKTVSERYIELFENITGQQFVKQDVSKA 296

Query: 302 PPLERIRNNLR 312
              ++I + L+
Sbjct: 297 DAEQKIIDTLK 307


>gi|74318686|ref|YP_316426.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thiobacillus denitrificans ATCC 25259]
 gi|74058181|gb|AAZ98621.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Thiobacillus denitrificans ATCC 25259]
          Length = 665

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 93/304 (30%), Positives = 149/304 (49%), Gaps = 27/304 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           + L +++I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KGEVL +++
Sbjct: 372 QPLFESHIASLPLIHRGKVRDIYAVGDDKLLIVTTDRLSAFDVVMPTPIPGKGEVLTRVS 431

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     +  N TL             D      +V Q+L+  PIE IVRGYL G+  
Sbjct: 432 AFWFDKLRAVVPNQTLAIAPEAVVAEDEKDQVAGRAIVVQKLKALPIEAIVRGYLVGSGW 491

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    +LP P+ TP+TK++      D+ I+  ++  R 
Sbjct: 492 KEYQRSQ-----SVCGIALPAGLMQADRLPEPIFTPSTKAALG--AHDENIAFEQMAER- 543

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +   +L+L++   + A   G+I+ D+K+EFG+D    ++  DE  TPDSSR
Sbjct: 544 -IGAELAAQVRDVSLALYQAAAEYARTRGIIIADTKFEFGLDAAGQLMWIDEALTPDSSR 602

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y      G  P   DK F+R+W+       +   P +P +I+ RTS+ Y  A  
Sbjct: 603 FWPADQYRP----GSNPPSFDKQFVRDWLEASGWNKQAPGPALPADIVARTSEKYREAMV 658

Query: 288 KITG 291
           ++ G
Sbjct: 659 RLLG 662


>gi|312797156|ref|YP_004030078.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Burkholderia rhizoxinica HKI 454]
 gi|312168931|emb|CBW75934.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase (EC
           6.3.2.6) [Burkholderia rhizoxinica HKI 454]
          Length = 329

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 93/307 (30%), Positives = 147/307 (47%), Gaps = 27/307 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
            +L ++ +  LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+ 
Sbjct: 34  SVLYESTLKSLPLLGRGKVRDNYAVGDDKLLIVTTDRLSAFDVILGEPIPDKGRVLNQMA 93

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF   + +  NH              +       +V ++LQ   +E +VRGYLAG+  
Sbjct: 94  NFWFDKLAHMVPNHLTGVAPESVVAPDEVPQVAGRAVVVRRLQPILVEAVVRGYLAGSGW 153

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +   +LP  + + Q+LP P+ TP  K+       D+ I+  E+  R 
Sbjct: 154 KDY-----QASGSVCGVVLPSGLQNAQRLPEPIFTPAAKADIGH--HDENITFAEVEQR- 205

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++SL++     A   G+I+ D+K+EFG+D    + L DE+ T DSSR
Sbjct: 206 -IGAELAARIRDISISLYKTAAHYAATRGIIIADTKFEFGLDDDGKLYLMDEVLTADSSR 264

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R G  P   DK F+R+W+  +        P +P  +I +T+  Y  A E
Sbjct: 265 FWPADQY----RVGTHPPSFDKQFVRDWLEAQPWNKAPPAPKLPREVIDKTAAKYREALE 320

Query: 288 KITGLKF 294
           ++TG   
Sbjct: 321 RLTGQPL 327


>gi|323527243|ref|YP_004229396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1001]
 gi|323384245|gb|ADX56336.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1001]
          Length = 296

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 121 WKDY-----QATGSVCGVQLPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P+ ++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDEVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|239818054|ref|YP_002946964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus S110]
 gi|239804631|gb|ACS21698.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus S110]
          Length = 301

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 97/310 (31%), Positives = 158/310 (50%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + I  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KGE+L Q+
Sbjct: 1   MTTVHTSSIQSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGEILTQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +C NH              +       ++ ++L   P+E +VRGYLAG+ 
Sbjct: 61  ALWWFDRLGQLCPNHLTGEAPESVVTPEEVPQVTGRSMLVKRLTPIPVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                       R +    LP+ +++  KLP P+ TP  K++      D+ IS + ++  
Sbjct: 121 WKEYQE-----SRSVCGVPLPEGLTNASKLPRPIFTPAAKAAAGE--HDENISYDRVVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     + I   +L ++E   ++AL  G+I+ D+K+EFG+D+   ++L DE+ TPDSS
Sbjct: 173 -IVGPKLAQQIRETSLEIYETAAQIALGKGMIIADTKFEFGLDEAGTLVLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQT 281
           RYW VE Y+ +   G  P   DK F+R+W+       +        P +P  +I +T+  
Sbjct: 232 RYWPVEGYQAALAAGANPPSYDKQFVRDWLEATKINGKPWDKTPPAPRLPAEVIEKTAAK 291

Query: 282 YIAAYEKITG 291
           Y  A E++TG
Sbjct: 292 YREALERLTG 301


>gi|209518347|ref|ZP_03267172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. H160]
 gi|209501266|gb|EEA01297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. H160]
          Length = 296

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 148/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN +
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNAM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAPDEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+  E+  R
Sbjct: 121 WKDY-----QATGSVCGVQLPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYEEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNNGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|330818177|ref|YP_004361882.1| SAICAR synthetase [Burkholderia gladioli BSR3]
 gi|327370570|gb|AEA61926.1| SAICAR synthetase [Burkholderia gladioli BSR3]
          Length = 296

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 148/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY +     + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGTDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   S I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLSHIVPNHLTGDAPESVVAADEVEQVAGRGVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QASGAVCGVELPAGLQNAQKLPEPIFTPAAKAEMGH--HDENISYEECERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ RTS  Y  A 
Sbjct: 232 RFWPADEY----QVGTNPPSFDKQFVRDWLETQDWKKEPPAPKLPDDVVARTSAKYQEAL 287

Query: 287 EKITGLKF 294
           E+ITG   
Sbjct: 288 ERITGQTL 295


>gi|197121583|ref|YP_002133534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter sp. K]
 gi|196171432|gb|ACG72405.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter sp. K]
          Length = 319

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 112/311 (36%), Positives = 173/311 (55%), Gaps = 12/311 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +  +P L   Y GKVR+NY   D   + + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 14  TLQQLDLPGLGELYRGKVRDNYSRGD-RIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    DI   H ++ PDP+V+V ++ +  PIE+++RGY+ G+          +     Y
Sbjct: 73  WFDKVKDIAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYITGSLWRDYQAGKAD-----Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PI   EI+ +G++T + W+  ++ A 
Sbjct: 128 GISWPAGLRKDQRFDQPIITPSTKAEYGK--HDEPIGEAEILRQGLVTPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI     +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGI-ADGKLVVIDEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+            P + +++ +  ++ YI  +EK+TG  F ++    
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYIEVFEKLTGETFASEVGS- 303

Query: 302 PPLERIRNNLR 312
               RI  NLR
Sbjct: 304 -VAARIERNLR 313


>gi|226505168|ref|NP_001149086.1| LOC100282707 [Zea mays]
 gi|195624604|gb|ACG34132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zea mays]
          Length = 319

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 185/315 (58%), Gaps = 6/315 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
                  +  L     GKVR+ Y       + + TDR SAFD+ +A IP+KG+VLN+ + 
Sbjct: 7   ETRLDLSVSGLRLAAKGKVRDVYESG-QHLVLVTTDRQSAFDRVLASIPFKGQVLNETSL 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF+ T  I  N  +  PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R  
Sbjct: 66  WWFNQTRHITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNY 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LPD M  N+KL   ++TPTTK+    +  D P++P+EII  G++++  +    S A
Sbjct: 126 CGNALPDGMVKNEKLSSNILTPTTKA----ADHDVPVTPDEIIESGLMSKEDFHEAGSKA 181

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LSLF  G K+ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G
Sbjct: 182 LSLFAYGQKVALENGLILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSG 241

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++
Sbjct: 242 LEPENVDKEFLRLWFKDNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQ 301

Query: 301 LPPLERIRNNLRKYT 315
            P  ERI  N+ +  
Sbjct: 302 EPIHERISRNVAQAL 316


>gi|310823408|ref|YP_003955766.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
 gi|309396480|gb|ADO73939.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
          Length = 318

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 170/311 (54%), Gaps = 11/311 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L K ++P L ++Y GKVR+ Y   D     + TDRLSAFD  +  IP+KGEVLN++  +
Sbjct: 13  TLRKTHLPALGSHYQGKVRDTYRKED-RLTLVTTDRLSAFDHVLTTIPFKGEVLNRLATF 71

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T  I  NH LD PD NV V +  Q F +E++VRGYL G+        Y+ G    Y
Sbjct: 72  WFERTRHIVPNHVLDVPDANVTVARACQPFALEMVVRGYLTGSLWRD----YQKGTHTAY 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +++ P P+ITP+TK+       D PIS  EI+ RG+ +   W  +S  AL
Sbjct: 128 GLPFPAGLRKDERFPMPLITPSTKAEYGQ--HDAPISEAEILARGLASPRDWSRLSEAAL 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF  G + A E GLILVD+KYEFG      + + DE+HTPDSSRYW  E YE  F +G 
Sbjct: 186 GLFAEGQRQARERGLILVDTKYEFGKVGN-ELYVIDEMHTPDSSRYWVAEEYEARFAKGE 244

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+   R        P IP+ + +  +  Y++AYE++TG     +    
Sbjct: 245 DQQMLDKENIRQWLIRERGFSGEGTPPPIPDEVRVELAVKYLSAYERLTGNSLRLEP--G 302

Query: 302 PPLERIRNNLR 312
               RI  NLR
Sbjct: 303 DVHARIEKNLR 313


>gi|220936047|ref|YP_002514946.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|254783984|sp|B8GP39|PUR7_THISH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|219997357|gb|ACL73959.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 296

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 91/305 (29%), Positives = 155/305 (50%), Gaps = 28/305 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           + L ++++  LP  + GKVR+ Y + D   + + TDR+SAFD  +   IP KGEVL +I+
Sbjct: 3   QPLLQSHLTSLPLIHRGKVRDLYAVGDDHLLIVTTDRVSAFDVILPTPIPGKGEVLTKIS 62

Query: 61  QYWFHHTSDICSNHTLDY--------------PDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           ++WF     I  N   D                +   LV ++L+  PIE +VRGYL G+ 
Sbjct: 63  EFWFRKLEHIVPNQLADMSLAEAVPDAAERAPLEGRSLVVKRLKALPIEAVVRGYLIGSG 122

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        ++    LP  +    +LP P+ TP+TK++      D+ +  +     
Sbjct: 123 WKDYQK-----TGQVCGNPLPAGLQLADRLPEPIYTPSTKAAVG--DHDENVDFDYTAEL 175

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       +   AL+L++   + AL  G+I+ D+K+EFG+D +  + L DE  TPDSS
Sbjct: 176 --VGPELAAQVRQTALALYKAAAEYALARGIIIADTKFEFGLDDEGVLHLIDEALTPDSS 233

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  +TY      GI+P   DK F+R+++ T     +   P++P +++ +T++ Y  A 
Sbjct: 234 RFWPADTYRP----GISPPSFDKQFVRDYLETLDWNKQAPGPELPPDVVQKTTEKYREAL 289

Query: 287 EKITG 291
            ++TG
Sbjct: 290 LRLTG 294


>gi|220916346|ref|YP_002491650.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954200|gb|ACL64584.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 319

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 111/311 (35%), Positives = 173/311 (55%), Gaps = 12/311 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +  +P L   Y GKVR+NY   D   + + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 14  TLQQLDLPGLGELYRGKVRDNYSRGD-RIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    DI   H ++ PDP+V+V ++ +  PIE+++RGY+ G+          +     Y
Sbjct: 73  WFDKVKDIAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYVTGSLWRDYQAGKAD-----Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PI   EI+ +G++T + W+  ++ A 
Sbjct: 128 GISWPAGLRKDQRFDQPIITPSTKAEYGK--HDEPIGEAEILKQGLVTPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI     +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGI-ADGKLVVIDEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+            P + +++ +  ++ Y+  +EK+TG  F ++    
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYVEVFEKLTGETFASEVGS- 303

Query: 302 PPLERIRNNLR 312
               RI  NLR
Sbjct: 304 -VAARIERNLR 313


>gi|114776739|ref|ZP_01451782.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Mariprofundus ferrooxydans PV-1]
 gi|114552825|gb|EAU55256.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Mariprofundus ferrooxydans PV-1]
          Length = 293

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 100/305 (32%), Positives = 154/305 (50%), Gaps = 28/305 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M  +  A I  L   +SGKVR+ Y + +   + + TDRLSAFD  +   IP KG+VLN +
Sbjct: 1   MDAMMHADIKSLKLLHSGKVRDMYEIDENHLLIVTTDRLSAFDVVLPTPIPGKGQVLNAV 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPN--------------VLVGQQLQMFPIELIVRGYLAGN 105
           + +WF   + I  NHT                      +V ++LQ  PIE IVRGYL G+
Sbjct: 61  SDFWFEKLAHILPNHTATMTLEEAIPDADERERVRSHAIVVKRLQPLPIEAIVRGYLIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             +         +  +    LP+ +    KLP P+ TP+TK++      D+ I  + +  
Sbjct: 121 GWSEYQK-----QGSVCGIALPEGLPLAGKLPEPLFTPSTKAAVGE--HDENIDFDRMC- 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
            GI+       +   +L L++     AL  G+I+ D+K+EFG+D+  N+ L DE+ TPDS
Sbjct: 173 -GIVGTELATKMRDVSLQLYKEAAAFALTKGIIIADTKFEFGLDQDGNLTLIDEVLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W V  Y+     GI+P   DK F+R+W+ T     +   P +P +I  +TS  Y  A
Sbjct: 232 SRFWPVSDYQP----GISPPSFDKQFVRDWLETLTWNKQSPGPAVPADIAEKTSAKYAEA 287

Query: 286 YEKIT 290
             ++T
Sbjct: 288 LARLT 292


>gi|194705918|gb|ACF87043.1| unknown [Zea mays]
          Length = 397

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 186/315 (59%), Gaps = 6/315 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
                  +  L     GKVR+ Y       + + TDR SAFD+ +A IP+KG+VLN+ + 
Sbjct: 85  ETRLDLSVSGLRLAAKGKVRDVYESG-QHLVLVTTDRQSAFDRVLASIPFKGQVLNETSL 143

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF+ T  I  N  +  PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R  
Sbjct: 144 WWFNQTRHITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNY 203

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LPD M  N+KL   ++TPTTK+    +  D P++P+EII  G++++  +    S A
Sbjct: 204 CGNVLPDGMVKNEKLSSNILTPTTKA----ADHDVPVTPDEIIESGLMSKEDFHEAGSKA 259

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LSLF  G K+ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G
Sbjct: 260 LSLFAYGQKVALENGLILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSG 319

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++
Sbjct: 320 LEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQ 379

Query: 301 LPPLERIRNNLRKYT 315
            P  ERI  N+ +  
Sbjct: 380 EPIHERISRNVAQAL 394


>gi|194701314|gb|ACF84741.1| unknown [Zea mays]
          Length = 351

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 130/315 (41%), Positives = 186/315 (59%), Gaps = 6/315 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
                  +  L     GKVR+ Y       + + TDR SAFD+ +A IP+KG+VLN+ + 
Sbjct: 39  ETRLDLSVSGLRLAAKGKVRDVYESG-QHLVLVTTDRQSAFDRVLASIPFKGQVLNETSL 97

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF+ T  I  N  +  PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R  
Sbjct: 98  WWFNQTRHITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNY 157

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
              +LPD M  N+KL   ++TPTTK+    +  D P++P+EII  G++++  +    S A
Sbjct: 158 CGNVLPDGMVKNEKLSSNILTPTTKA----ADHDVPVTPDEIIESGLMSKEDFHEAGSKA 213

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LSLF  G K+ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G
Sbjct: 214 LSLFAYGQKVALENGLILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSG 273

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           + P  +DK+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++
Sbjct: 274 LEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQ 333

Query: 301 LPPLERIRNNLRKYT 315
            P  ERI  N+ +  
Sbjct: 334 EPIHERISRNVAQAL 348


>gi|288942240|ref|YP_003444480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Allochromatium vinosum DSM 180]
 gi|288897612|gb|ADC63448.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Allochromatium vinosum DSM 180]
          Length = 293

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 99/305 (32%), Positives = 153/305 (50%), Gaps = 28/305 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +P L     GKVR+ Y + D   + +A+DRLSAFD  +   IP KGEVL ++
Sbjct: 1   MPALYQSNLPHLELIARGKVRDLYRIDDDHLLVVASDRLSAFDVVLPDPIPGKGEVLARL 60

Query: 60  TQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAGN 105
           +++WF  T+DI  NH  D P                  +V ++ +  P+E IVRGYL G+
Sbjct: 61  SRFWFGRTADIIPNHLTDIPVSAVVTDPQALAELGDRAMVVRRFKPLPVEAIVRGYLIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                 T        +    LP  +    +LP P+ TP+TK+       D+ +     + 
Sbjct: 121 GWKDYQT-----TGSVCGIALPPGLRQADRLPEPIFTPSTKAELG--AHDENVDFAHTVD 173

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
              + R   E +   +L+++ R    ALE GLI+ D+K+EFG+D    + L DE  TPDS
Sbjct: 174 L--IGRELAERVRDASLAIYTRCAAYALERGLIIADTKFEFGLDDDGRLYLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y+     G++P   DK F+R+++ T         P +P  II RT+  Y  A
Sbjct: 232 SRFWPADDYQP----GMSPPSFDKQFVRDYLETLDWDKTAPGPALPPEIIERTAAKYREA 287

Query: 286 YEKIT 290
            E++T
Sbjct: 288 EERLT 292


>gi|319942515|ref|ZP_08016825.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sutterella wadsworthensis 3_1_45B]
 gi|319803918|gb|EFW00836.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sutterella wadsworthensis 3_1_45B]
          Length = 297

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 99/310 (31%), Positives = 153/310 (49%), Gaps = 27/310 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  LSK++IP L   YSGKVR+ Y + +   + +A+DR+SAFD  +   IP KG+VL  +
Sbjct: 1   MSGLSKSHIPSLKQIYSGKVRDCYAVGEDKLLLVASDRISAFDVILGDPIPGKGKVLTAL 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           T +WF    D+  NH              +D      +V ++L+   IE + RGY+ G  
Sbjct: 61  TNFWFEKLKDVIPNHLTGIAPESVVKPEEVDQVKGRAVVSKRLKPILIECVARGYIIGGG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  +   QKLP P+ TP  K+       D+ I    ++  
Sbjct: 121 WKDY-----LATGKVCGVELPAGLKQAQKLPEPIFTPAAKAELG--THDENIPYERVVEM 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
                    TI +  L L++R  + AL  G+I+ D+K+EFG+D   N++L DE+ TPDSS
Sbjct: 174 --YGEKVASTIRNATLELYKRAAEYALTRGIIIADTKFEFGLDDDGNVLLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++Y      G +P   DK +IR+W+ T+        P +PE +I +T+  Y  A 
Sbjct: 232 RFWPADSY----EVGTSPKSFDKQYIRDWLETQPWNKTPPAPKLPEEVIEKTADKYREAL 287

Query: 287 EKITGLKFIA 296
            ++TG     
Sbjct: 288 RRLTGTDIEP 297


>gi|307730880|ref|YP_003908104.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1003]
 gi|307585415|gb|ADN58813.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1003]
          Length = 296

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 121 WKDY-----QATGSVCGVQLPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDDVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|319796439|ref|YP_004158079.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus EPS]
 gi|315598902|gb|ADU39968.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus EPS]
          Length = 301

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 97/310 (31%), Positives = 159/310 (51%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + I  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KGE+L Q+
Sbjct: 1   MTTVHTSSIQSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGEILTQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +C NH              +       ++ ++L   P+E +VRGYLAG+ 
Sbjct: 61  ALWWFERLGQLCPNHLTGDAPESVVTAEEVPQVTQRSMLVKRLTPIPVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                       R +    LP+ +++  KLP P+ TP  K++      D+ IS + ++  
Sbjct: 121 WKEYQE-----SRSVCGVPLPEGLTNASKLPRPIFTPAAKAAAGE--HDENISYDRVVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     + I   +++++E   ++AL  G+I+ D+K+EFG+D+   ++L DE+ TPDSS
Sbjct: 173 -IVGPKLAQQIRETSIAIYETAAQIALTKGMIIADTKFEFGLDEAGTLVLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQT 281
           RYW VE YE +   G  P   DK F+R+W+       +        P +P  +I +T+  
Sbjct: 232 RYWPVEGYEAALAAGTNPPSYDKQFVRDWLEATKINGKPWDKTPPAPRLPAEVIEKTAAK 291

Query: 282 YIAAYEKITG 291
           Y  A E++TG
Sbjct: 292 YREALERLTG 301


>gi|295677570|ref|YP_003606094.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1002]
 gi|295437413|gb|ADG16583.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1002]
          Length = 296

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN +
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNAM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAPDEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 121 WKDY-----QATGSVCGVQLPAGLQNAQKLPEPIFTPAAKAEMGH--HDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|291612499|ref|YP_003522656.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sideroxydans lithotrophicus ES-1]
 gi|291582611|gb|ADE10269.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sideroxydans lithotrophicus ES-1]
          Length = 294

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 95/306 (31%), Positives = 146/306 (47%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M  L ++ +  L   + GKVR+ Y +     + + TDRLSAFD  +   IP KGEVL  +
Sbjct: 1   MSALHESNLTSLKFLHRGKVRDLYEVDADHLLIVQTDRLSAFDVILPTPIPGKGEVLTAV 60

Query: 60  TQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAGN 105
           + +WF     I  NH                        V ++L+  PIE IVRGYL G+
Sbjct: 61  SNFWFKKLGHIIPNHLSGIDPESVVKTEAEKAQVRGRAFVTKKLKPLPIEAIVRGYLVGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          +    LP  + + QKLP P+ TP+TK++      D+ IS  E   
Sbjct: 121 GWKDYKK-----TGAVCGIQLPTGLQEAQKLPQPLFTPSTKAAVGE--HDENISFEE--A 171

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
           R +L  +  E + +  L+L+      AL  G+I+ D+K+EFG D    + L DE  TPDS
Sbjct: 172 RKLLGADMAEQVKNATLALYIEAADYALTKGIIIADTKFEFGTDAAGKLYLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y    + G  P   DK F+R+W+ +     +   P +P +++ +T++ Y  A
Sbjct: 232 SRFWPADQY----KVGSNPPSFDKQFVRDWLESSGWNKQPPAPQVPADVLHKTAEKYREA 287

Query: 286 YEKITG 291
              +TG
Sbjct: 288 QRLLTG 293


>gi|294507528|ref|YP_003571586.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase
           [Salinibacter ruber M8]
 gi|294343856|emb|CBH24634.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Salinibacter ruber M8]
          Length = 324

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 178/315 (56%), Gaps = 12/315 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
            + +    +L   Y GKVR+NY   D  RI + TDR+SAFD  +   IP+KG++LNQ   
Sbjct: 13  TIEQTGFDDLGEIYHGKVRDNYRQGD-RRILVTTDRISAFDHVLPQTIPFKGQILNQTAA 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           Y+F  T D+  NH L  PDPNV + ++    PIE +VRGYLAG+           G R +
Sbjct: 72  YFFDATEDLVPNHVLSVPDPNVTIAKECTPIPIEFVVRGYLAGHAWREYDR----GTRTL 127

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LPD + ++++LP P++TPTTK+ E     DQ +S  E +    L    ++ ++ +A
Sbjct: 128 CGQSLPDGLRESEQLPEPILTPTTKAEEG---HDQDVSRKEALANTGLAPATYDQLAEWA 184

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+L+ RG K+A E GL+LVD+KYEFG     +++L DE+HTPDSSRY+  + YE    EG
Sbjct: 185 LALYRRGHKMATEQGLLLVDTKYEFGRTPDGDLVLIDEVHTPDSSRYYYADGYEDRLAEG 244

Query: 242 ITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
                L K+F+R W++      R  D +P +P+    + ++ Y+  +EK+TG  F  D  
Sbjct: 245 RPQRQLSKEFVREWLMDHGFQGRAGDEMPTLPDAFRAKVTRRYVELFEKVTGQTFEPDTH 304

Query: 300 ELPPLERIRNNLRKY 314
              P  RI + L  Y
Sbjct: 305 P-NPEARIHSALGDY 318


>gi|296157278|ref|ZP_06840114.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. Ch1-1]
 gi|295892614|gb|EFG72396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. Ch1-1]
          Length = 296

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 151/308 (49%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLHSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +   +LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 121 WKDY-----QATGSVCGVVLPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|326799933|ref|YP_004317752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobacterium sp. 21]
 gi|326550697|gb|ADZ79082.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobacterium sp. 21]
          Length = 318

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 124/324 (38%), Positives = 186/324 (57%), Gaps = 14/324 (4%)

Query: 1   MRILSKAYI--PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  + + +   P+   +Y GKVR+ Y + +     + +DR+SAFD  +   IPYKG+VLN
Sbjct: 1   MNAIKETHFTFPKQTAFYKGKVRDVYTIDNQYLAMVVSDRISAFDVVLPRAIPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DI  N  +D PDP+V +G+  + F +E+++RGYL+G+        Y  G
Sbjct: 61  QIAAKFLKATEDILPNWVIDVPDPSVTIGKIAEPFKVEMVIRGYLSGHAWRE----YAAG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    LP+ + +N KLP P+ITPTTK++      D+ IS  EI+ +GI++   +  +
Sbjct: 117 RRSVCGESLPEGLKENDKLPKPIITPTTKATVG---HDEDISRTEILKQGIVSEGDYVKL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LFERG ++A   GLILVD+KYEFG      IIL DEIHTPDSSRY+  E Y++ 
Sbjct: 174 EKYTHALFERGTEIAAAQGLILVDTKYEFGKIGD-QIILIDEIHTPDSSRYFYKEGYDEL 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            +EG     L K+F+R W++      +   ++P + + ++   S+ YI  YE ITG KFI
Sbjct: 233 QKEGKPQRQLSKEFVRKWLIENGFQGKEGQSVPMMDDELVASISERYIELYEHITGEKFI 292

Query: 296 ADNSELPPLERIRNNLRKYTHRHL 319
                    ER+ NN+ K   R L
Sbjct: 293 R-YEIQHIEERVENNINKALDRLL 315


>gi|170693445|ref|ZP_02884604.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia graminis C4D1M]
 gi|170141600|gb|EDT09769.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia graminis C4D1M]
          Length = 296

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ NE+  R
Sbjct: 121 WKDY-----QATGSVCGVELPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYNEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDDVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|91785088|ref|YP_560294.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia xenovorans LB400]
 gi|91689042|gb|ABE32242.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia xenovorans LB400]
          Length = 296

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLHSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 121 WKDY-----QATGSVCGVELPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|83814469|ref|YP_445636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinibacter ruber DSM 13855]
 gi|83755863|gb|ABC43976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinibacter ruber DSM 13855]
          Length = 324

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 120/315 (38%), Positives = 178/315 (56%), Gaps = 12/315 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
            + +    +L   Y GKVR+NY   D  RI + TDR+SAFD  +   IP+KG++LNQ   
Sbjct: 13  TIEQTGFDDLGEIYHGKVRDNYRQGD-RRILVTTDRISAFDHVLPQTIPFKGQILNQTAA 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           Y+F  T D+  NH L  PDPNV + ++    PIE +VRGYLAG+           G R +
Sbjct: 72  YFFDATEDLVPNHVLSVPDPNVTIAKECTPIPIEFVVRGYLAGHAWREYDR----GTRTL 127

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LPD + ++++LP P++TPTTK+ E     DQ +S  E +    L    ++ ++ +A
Sbjct: 128 CGKSLPDGLRESEQLPEPILTPTTKAEEG---HDQDVSRKEALANTGLAPATYDQLAEWA 184

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+L+ RG K+A E GL+LVD+KYEFG     +++L DE+HTPDSSRY+  + YE    EG
Sbjct: 185 LALYRRGHKMATEQGLLLVDTKYEFGRTPDGDLVLIDEVHTPDSSRYYYADGYEDRLAEG 244

Query: 242 ITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
                L K+F+R W++      R  D +P +P+    + ++ Y+  +EK+TG  F  D  
Sbjct: 245 RPQRQLSKEFVREWLMDHGFQGRAGDEMPTLPDAFRAKVTKRYVELFEKVTGQTFEPDTH 304

Query: 300 ELPPLERIRNNLRKY 314
              P  RI + L  Y
Sbjct: 305 P-NPEARIHSALGDY 318


>gi|212550923|ref|YP_002309240.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
 gi|229485672|sp|B6YRK7|PUR7_AZOPC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|212549161|dbj|BAG83829.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
          Length = 323

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 125/320 (39%), Positives = 182/320 (56%), Gaps = 14/320 (4%)

Query: 1   MRILSKAY--IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLN 57
           M  L+      P   + Y GKVR+ Y +     + IATDR+SAFD  ++  IPYKG+VLN
Sbjct: 1   MNYLTTTNYCFPCQTHLYHGKVRDVYTVGSDMLVIIATDRISAFDVVLSRGIPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   TSDI  N  L  PDP V +G   + F +E+++RGYL G+        YK G
Sbjct: 61  QIAAKFLDSTSDILPNWKLAEPDPMVTIGLLCEPFKVEMVIRGYLTGSAWRK----YKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +R +    LP+ M +N+K P P+ITPTTK+ +     D+ IS  EII R ++++  +E +
Sbjct: 117 ERTLCAVTLPEGMKENEKFPNPIITPTTKAYKG---HDENISKEEIIERFLVSKEDYEQL 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y  +LF+RG ++A   GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ 
Sbjct: 174 EYYTRALFQRGTEIASSKGLILVDTKYEFGK-KDGRIYLIDEIHTPDSSRYFYSEDYQER 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++ +    ++   +P++        S+ YI  YE I G +FI
Sbjct: 233 FEKGEGQKQLSKEFVRQWLMKQNFQGKEGQIVPEMTPEYCQIVSERYIELYETIVGEQFI 292

Query: 296 ADNSELPPLERIRNNLRKYT 315
             ++      RI+ N+  Y 
Sbjct: 293 RASTS-NISARIKKNIETYL 311


>gi|86157539|ref|YP_464324.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774050|gb|ABC80887.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 319

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 109/311 (35%), Positives = 172/311 (55%), Gaps = 12/311 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +  +P L   Y GKVR+NY   D   + + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 14  TLRQLDLPGLGELYRGKVRDNYSRGD-RIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    D+   H ++ PDP+V+V ++ +  PIE+++RGY+ G+          +     Y
Sbjct: 73  WFDKVKDLAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYITGSLWRDYQAGKAD-----Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+    VITP+TK+       D+PI  +E++ +G++  + W+  ++ A 
Sbjct: 128 GIAWPAGLRKDQRFDEAVITPSTKAEYGK--HDEPIGEDELLKQGLVAPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI     +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGI-ADGKLVVIDEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W+            P + +++ +  ++ YI  +EK+TG  F ++    
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYIEVFEKLTGETFASEVGS- 303

Query: 302 PPLERIRNNLR 312
               RI  NLR
Sbjct: 304 -VAARIERNLR 313


>gi|325473536|gb|EGC76729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola F0402]
          Length = 316

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 141/311 (45%), Positives = 204/311 (65%), Gaps = 5/311 (1%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
              ++ +P LP+  +GKVR+ Y   +G R+ + TDR+SAFD+ +  +PYKG+VLNQ++ +
Sbjct: 7   AFRESNLP-LPSKQTGKVRDWYSPEEGKRLIVTTDRISAFDRVLTALPYKGQVLNQLSLW 65

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF +T DI  NH +  PDPN ++  +++  PIE+IVRGY+ G T T+L   Y  G+R IY
Sbjct: 66  WFENTKDIIKNHIISCPDPNCIIVTEVKPLPIEVIVRGYITGVTSTALWYRYSLGERNIY 125

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
            Y  P+ +  NQ LP P+ITPTTK     +G D+ ++ +E++ +G L++ QW+ +   AL
Sbjct: 126 GYDFPEGLKKNQALPKPIITPTTKG--GPTGHDERLTCDEVVSQGYLSKEQWDFVQKAAL 183

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LFERG K A E GLILVD+KYEFG++K  NI+L DE+HTPDSSRYW+++TYE+  +EG 
Sbjct: 184 ALFERGQKSAKEAGLILVDTKYEFGVNKDNNILLIDEVHTPDSSRYWKLDTYEQRLKEGK 243

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P   DK+F+R     +       IP++ EN+     Q YI AYEK+T  KF+    E P
Sbjct: 244 EPENFDKEFVRMAYAAKGYRGDGEIPELDENVWNEAIQLYITAYEKLTKSKFVP--GEYP 301

Query: 303 PLERIRNNLRK 313
             ERI  NL+K
Sbjct: 302 VEERIVKNLKK 312


>gi|297539566|ref|YP_003675335.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera sp. 301]
 gi|297258913|gb|ADI30758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera sp. 301]
          Length = 300

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 93/313 (29%), Positives = 157/313 (50%), Gaps = 29/313 (9%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   L +  I  L   + GKVR+ Y +   T + ++TDRLSAFD  +   I  KG +L Q
Sbjct: 1   MNTPLLETSIQSLKRIHQGKVRDIYDIDADTMLLVSTDRLSAFDVILPTGIANKGAMLTQ 60

Query: 59  ITQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAG 104
           +  +WF    ++  NH                       +V ++L+  PIE IVRGYL G
Sbjct: 61  MANFWFEKLKNVVPNHLTGIDPKSVVSNVAEQAQLGSRAVVVKKLKALPIEAIVRGYLVG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +            K  +    LP  + +  KLP P+ TP++K++      D+ IS  +  
Sbjct: 121 SGWKEY-----KAKGTVCGIELPAGLQEASKLPTPIFTPSSKAAVGE--HDENISLQQCA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
               + ++  E ++  A++L+++  + AL  G+I+ D+K+EFG+D    + + DE+ TPD
Sbjct: 174 DL--IGKDMAEQVAKVAIALYQQAAEYALTRGIIIADTKFEFGLDANGVLHVMDEVLTPD 231

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  ++Y      G  P   DK F+R+W+ +         P +P ++  +TS+ Y+ 
Sbjct: 232 SSRFWPADSY----AVGSNPPSYDKQFVRDWLESTGWNKVAPAPALPADVAQKTSEKYME 287

Query: 285 AYEKITGLKFIAD 297
           A+E++TG   +AD
Sbjct: 288 AFERLTGHPLVAD 300


>gi|253998201|ref|YP_003050264.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylovorus sp. SIP3-4]
 gi|313200271|ref|YP_004038929.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylovorus sp. MP688]
 gi|253984880|gb|ACT49737.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylovorus sp. SIP3-4]
 gi|312439587|gb|ADQ83693.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylovorus sp. MP688]
          Length = 299

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 95/310 (30%), Positives = 144/310 (46%), Gaps = 29/310 (9%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           M   L ++ I  LP    GKVR+ Y + D T + + TDRLSAFD  +   I  KG VL Q
Sbjct: 1   MTAPLMRSSINSLPLINQGKVRDIYDIDDKTMLLVTTDRLSAFDVILPTPIQDKGAVLTQ 60

Query: 59  ITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYLAG 104
           I  +WF     I  NH                       LV ++L+  PIE IVRGYL G
Sbjct: 61  IANFWFDKLGHIVPNHLTGIAPESVVSDPAEKAQLARRALVVKKLKPLPIEAIVRGYLVG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +    LP  + +   LP P+ TP++K+       D+ I+  +  
Sbjct: 121 SGWKEY-----KASGTVCGIALPAGLQEASPLPQPLFTPSSKAEMG--DHDENITLEKCA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              +L +   E ++  ++ L+      AL  G+I+ D+K+EFG+D    + L DE  TPD
Sbjct: 174 --QLLGKELAEKVARISIQLYTEAAAYALTRGIIIADTKFEFGLDAAGELYLIDEALTPD 231

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y      G  P   DK ++R+W+ +         P++P ++  +T+  Y  
Sbjct: 232 SSRFWPAEQY----AVGSNPPSFDKQYVRDWLESTGWNKVAPGPELPADVAQKTADKYRE 287

Query: 285 AYEKITGLKF 294
           AY K+TG + 
Sbjct: 288 AYRKLTGSEL 297


>gi|332531646|ref|ZP_08407543.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hylemonella gracilis ATCC 19624]
 gi|332039009|gb|EGI75438.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hylemonella gracilis ATCC 19624]
          Length = 303

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 92/309 (29%), Positives = 153/309 (49%), Gaps = 28/309 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + +  LP    GKVR+NY + +   + +A+DR+SAFD  +   IP KGE+L ++ 
Sbjct: 3   SALHTSSLRSLPLLARGKVRDNYAVGEDRILMVASDRISAFDVIMGEPIPGKGELLTKMA 62

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I  NH              +       ++ Q+L+  P+E +VRGYLAG+  
Sbjct: 63  LFWFDKLGHIVPNHLTGAAPESVVQPDEVGQVRGRAMLVQRLKPIPVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  + +  KLP P+ TP  K+       D+ IS  + +   
Sbjct: 123 KEYQESQA-----VCGVKLPAGLKNASKLPEPIYTPAHKAEMGE--HDENISFEKTVEL- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   +++L+    ++AL+ G+I+ D+K+EFG+D +  ++L DE+ TPDSSR
Sbjct: 175 -IGAELAAKIRDVSIALYTTASEIALKRGIIIADTKFEFGLDPQGRLVLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE YE++F+ G  P   DK F+R+W+       +        P +P  ++ +T+  Y
Sbjct: 234 YWPVEGYEQAFKAGANPPSYDKQFLRDWLEQAQVDGKPWGKTPPAPALPAEVVAQTAAKY 293

Query: 283 IAAYEKITG 291
             A  ++TG
Sbjct: 294 QEALTRLTG 302


>gi|226941992|ref|YP_002797066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Laribacter hongkongensis HLHK9]
 gi|226716919|gb|ACO76057.1| Pur7 [Laribacter hongkongensis HLHK9]
          Length = 292

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 97/305 (31%), Positives = 149/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L+   +  L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I
Sbjct: 1   MNGLTTTDLTSLKKIYSGKVRDLYEIDDQRMLMIATDRLSAFDVILPDPIPEKGKLLTAI 60

Query: 60  TQYWFHHTSDICSNHTLD-------------YPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    D+  NH                  +   +V ++L+  PIE +VRGYLAG  
Sbjct: 61  SNFWFDKLKDVVPNHLTGERPEDMVSAADRPQVEGRAVVARKLKALPIEAVVRGYLAGGG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + +  KLP P+ TP+TK++      D+ IS       
Sbjct: 121 WKEYRK-----TGGVCGIALPAGLQEASKLPEPIFTPSTKAAVG--DHDENISFERCAD- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ R     +   AL L+    + A   G+I+ D+K+EFG+D+   ++L DE  TPDSS
Sbjct: 173 -IIGREMAGQVRDTALRLYRVASEYAASRGIIICDTKFEFGLDENGTLVLMDEALTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++Y +    GI+P   DK F+R+W+ T         P +P+ +  +T+  Y  A 
Sbjct: 232 RFWPADSYRE----GISPPSFDKQFVRDWLETTGWDKVSPAPRVPDEVAQKTADKYREAL 287

Query: 287 EKITG 291
            ++ G
Sbjct: 288 VRLAG 292


>gi|187925247|ref|YP_001896889.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phytofirmans PsJN]
 gi|187716441|gb|ACD17665.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phytofirmans PsJN]
          Length = 296

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ I+ NE+  R
Sbjct: 121 WKDY-----QATGSVCGVELPPGLQNAQKLPEPIFTPAAKAEMGH--HDENITYNEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVTKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|160896448|ref|YP_001562030.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Delftia
           acidovorans SPH-1]
 gi|160362032|gb|ABX33645.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Delftia
           acidovorans SPH-1]
          Length = 307

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 152/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+ 
Sbjct: 8   SALHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMA 67

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     IC NH              +       ++ ++L+   IE +VRGYLAG+  
Sbjct: 68  LFWFDKLGHICPNHLTGEAPESVVTPAEVPQVTGRSMLVKRLKPVLIEAVVRGYLAGSGW 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      R +    LP+ +++  KLP P+ TP  K+       D+ I+    +   
Sbjct: 128 KEYQE-----SRSVCGVPLPEGLTNAAKLPEPIYTPAAKAEMG--DHDENITYERTVEM- 179

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   A+ +++    +ALE G+I+ D+K+EFG+D+   ++L DE+ TPDSSR
Sbjct: 180 -VGEKLASQIRDTAIRIYKEAAAIALEKGMIIADTKFEFGLDENGELVLMDEVLTPDSSR 238

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE Y ++   G  P   DK F+R+W+       +    +   P +P+ +  +T+  Y
Sbjct: 239 YWPVEGYAQALANGENPPSYDKQFVRDWLEQAQVNGKPWDKKAPAPRLPQEVTEKTAAKY 298

Query: 283 IAAYEKIT 290
             A +++T
Sbjct: 299 REALQRLT 306


>gi|42526200|ref|NP_971298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola ATCC 35405]
 gi|41816312|gb|AAS11179.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola ATCC 35405]
          Length = 316

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 142/311 (45%), Positives = 204/311 (65%), Gaps = 5/311 (1%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
              ++ +P LP+  +GKVR+ Y   +G R+ + TDR+SAFD+ +  +PYKG+VLNQ++ +
Sbjct: 7   AFRESNLP-LPSKQTGKVRDWYSPEEGKRLIVTTDRISAFDRVLTALPYKGQVLNQLSLW 65

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF +T DI  NH +  PDPN ++  +++  PIE+IVRGY+ G T T+L   Y  G+R IY
Sbjct: 66  WFENTKDIIKNHIISCPDPNCIIVTEVKPLPIEVIVRGYITGVTSTALWYRYSLGERNIY 125

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
            Y  P+ +  NQ LP P+ITPTTK     +G D+ ++ +E++ +G L++ QW+ +   AL
Sbjct: 126 GYDFPEGLKKNQALPKPIITPTTKG--GPTGHDERLTCDEVVSQGYLSKEQWDFVQKAAL 183

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LFERG K A E GLILVD+KYEFG+DK  NI+L DE+HTPDSSRYW+++TYE+  +EG 
Sbjct: 184 ALFERGQKSAKEAGLILVDTKYEFGVDKNNNILLIDEVHTPDSSRYWKLDTYEQRLKEGK 243

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P   DK+F+R     +       IP++ EN+     Q YI AYEK+T  KF+    E P
Sbjct: 244 EPENFDKEFVRMAYAAKGYRGDGEIPELDENVWNEAIQLYITAYEKLTKSKFVP--GEYP 301

Query: 303 PLERIRNNLRK 313
             ERI  NL+K
Sbjct: 302 AEERIVKNLKK 312


>gi|171057053|ref|YP_001789402.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptothrix cholodnii SP-6]
 gi|226723549|sp|B1XWZ1|PUR7_LEPCP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|170774498|gb|ACB32637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptothrix cholodnii SP-6]
          Length = 302

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 95/307 (30%), Positives = 160/307 (52%), Gaps = 28/307 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            L ++ +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KGE+L ++  
Sbjct: 4   ALLESQLHSLPLLARGKVRDNYAVGTDRILMVASDRLSAFDVIMGEGIPGKGELLTRVAL 63

Query: 62  YWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           YWF     I  NH              +D      ++ ++L+  P+E +VRGYLAG+   
Sbjct: 64  YWFDRLGHIVPNHLTGADPVSVVAPDEVDQVRGRSMLVKRLKPLPVEAVVRGYLAGSGWK 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                     R +    LP  +++  +LP P+ TP TK+       D  IS   +    I
Sbjct: 124 EYQE-----TRSVCGVALPSGLTNAARLPAPIFTPATKAEMG--DHDINISFERMSE--I 174

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  +  E + + ++ L+    ++AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSRY
Sbjct: 175 IGADLAERVRAISIQLYSSAAEIALSKGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRY 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYI 283
           W +E Y+ ++ +G  P   DK F+R+W+ +     +    +   P +P+++I+ T+ TY 
Sbjct: 235 WPIEHYQSAYAQGRNPPSFDKQFVRDWLESVRIDGQPWNKQAPAPALPDDVIVHTAATYR 294

Query: 284 AAYEKIT 290
            A E++T
Sbjct: 295 EALERLT 301


>gi|158312067|ref|YP_001504575.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EAN1pec]
 gi|158107472|gb|ABW09669.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EAN1pec]
          Length = 354

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 90/307 (29%), Positives = 149/307 (48%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 54  LTHEEFAGLTHLGSGKVRELFAIGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLW 113

Query: 63  WFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF    D+  +H +               +      ++ ++L M  IE + RGYL G+  
Sbjct: 114 WFDQLGDLVPSHVISSSVDEYPAELAPYAEQLRGRSMLCRRLDMVQIECVARGYLTGSGL 173

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +  + LP  + D  +LP P+ TP+TK+       D+ IS ++    G
Sbjct: 174 KDYRR-----SGTVSGHPLPAGLEDGSRLPNPIYTPSTKAPIGE--HDENISRDD--AAG 224

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +    L +F R   LA E G++L D+K+EFG D    + LADE+ TPDSSR
Sbjct: 225 RVGAELAAELERLTLQIFGRASDLAAERGILLADTKFEFGHDADGVLRLADEVLTPDSSR 284

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + +     +       DK FIR+++++         P++P++I+  T   Y+ AYE
Sbjct: 285 FWPADAWTPGGTQ----PSYDKQFIRDYLVSTGWDRNPPAPELPDDIVESTRARYVEAYE 340

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 341 RLTGISF 347


>gi|325192643|emb|CCA27066.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase putative
           [Albugo laibachii Nc14]
          Length = 338

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 119/323 (36%), Positives = 183/323 (56%), Gaps = 15/323 (4%)

Query: 4   LSKAYIPELPNY------YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
           ++   +  L         +SGKVR+ Y   D   + IATDR SAFD+ +A IPYKG VL 
Sbjct: 18  ITSTSLEPLKTLLPPFTRHSGKVRDIYRFPD-RILLIATDRQSAFDRVLASIPYKGRVLT 76

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             + +WF  T  I  NH +  P P+ +VG+  ++FP+E +VRGY+ G+T TS+ T Y +G
Sbjct: 77  LTSLWWFDQTKHIVPNHVIASPHPSAIVGKICRVFPVEFVVRGYITGSTSTSMWTHYASG 136

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+   + L D    +QKL   ++TPTTK        D+ IS  EI+   ++ +++W+  
Sbjct: 137 CREYCGHRLVDGYVQHQKLHENLVTPTTKGET----HDELISGREIVASNLMKQSEWDYC 192

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              AL LF  G + A E GLILVD+KYEFG+D+   I++ DE+HTPDSSR+W  ++Y++ 
Sbjct: 193 CEKALELFAYGQQRAQERGLILVDTKYEFGVDETGTILIVDEMHTPDSSRFWLQKSYKER 252

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR-DNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            +    P  +DK+F+R W   RC+PY  + +P+ P  ++   S  YI  +E ITG KF  
Sbjct: 253 MQLRQAPESIDKEFLRVWFKERCDPYSVETLPEAPSELVTELSSRYILLFELITGQKFEF 312

Query: 297 DNS---ELPPLERIRNNLRKYTH 316
                  +   + +   +++Y  
Sbjct: 313 PTGLRQNVSCEQELLEGVKEYFK 335


>gi|118594430|ref|ZP_01551777.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophilales bacterium HTCC2181]
 gi|118440208|gb|EAV46835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophilales bacterium HTCC2181]
          Length = 294

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 98/306 (32%), Positives = 162/306 (52%), Gaps = 26/306 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
           +L  + I  LP  + GKVR+ Y +++   + + TDRLSAFD  +   IP+KG+VL ++  
Sbjct: 2   VLLNSSIKSLPLIHQGKVRDIYDINEHKMLIVTTDRLSAFDVIMGEPIPFKGQVLTEMAN 61

Query: 62  YWFHHTSDICSNHT------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           +WF +  DI ++ T            +D      +V ++L+  PIE IVRGY+ G+    
Sbjct: 62  FWFDYFKDIPNHLTYENPENFVLPAEIDQIHGRAVVVKKLRPIPIEAIVRGYIIGSGWKE 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                    + I    LP  +    KLP  + TP+ K+ +     D+ IS      R +L
Sbjct: 122 Y-----QASQSICNISLPKGLKQASKLPQALFTPSNKADQGQ--HDENISLEHC--RSLL 172

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +  +TIS  ++S++ +  +LA   G+I+ D+K EFG+D    + L DE+ TPDSSR+W
Sbjct: 173 GDDLTKTISEMSISIYIKASELAKAKGIIIADTKLEFGLDSNNQVTLMDEVLTPDSSRFW 232

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             ++Y    + G++P   DK ++R+W+ T+    +   P +P+ +I  TS  Y  A+EKI
Sbjct: 233 PEKSY----QMGMSPPSFDKQYVRDWLETQDWNKQAPAPTLPKTVIEETSNKYREAFEKI 288

Query: 290 TGLKFI 295
           TG   +
Sbjct: 289 TGQILV 294


>gi|284042287|ref|YP_003392627.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Conexibacter woesei DSM 14684]
 gi|283946508|gb|ADB49252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Conexibacter woesei DSM 14684]
          Length = 293

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 95/305 (31%), Positives = 146/305 (47%), Gaps = 21/305 (6%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
             + +LP    GKVRE Y L D T + +A+DR+S +D      IP KG+VL  ++ +WF 
Sbjct: 2   TSLSDLPLVARGKVREIYDLGD-TLLLVASDRISTYDVVHPNTIPDKGKVLTALSVFWFE 60

Query: 66  HTSDICSNHTL-------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
               I  NH +       D      LV ++L M P+E +VRGY+ G+             
Sbjct: 61  RLGAIVPNHYISATDGVPDDVRGRALVVRKLAMLPVECVVRGYITGSGWKDY-----LAT 115

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
            K+    LP  + ++++LP P+ TP+TK+       D+ I   + +      R   E + 
Sbjct: 116 GKVSGLDLPAGLQESEQLPQPLYTPSTKAEVG---HDEAIDFEQTVALLDGDRALAERVR 172

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             ++ ++ R  + A E G+IL D+K+E G D    + L DE+ TPDSSR+W V  YE   
Sbjct: 173 DVSIEVYVRAAEHARERGVILADTKFELGRDAAGELTLGDEVLTPDSSRFWPVAGYEPGH 232

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADN 298
            +       DK  +R+W  +         P+IP  ++ +T   Y+ AYE ITG  F A  
Sbjct: 233 GQ----PSFDKQIVRDWASSTDWDKSYPAPEIPAEVVDKTRARYLEAYELITGEPFDAWL 288

Query: 299 SELPP 303
               P
Sbjct: 289 ERTNP 293


>gi|72163414|ref|YP_291071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobifida fusca YX]
 gi|123628549|sp|Q47KH4|PUR7_THEFY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71917146|gb|AAZ57048.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobifida fusca YX]
          Length = 307

 Score =  262 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 93/300 (31%), Positives = 150/300 (50%), Gaps = 27/300 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SAFD  +   IP KG +L Q++ +WF  
Sbjct: 12  EVPGLTHLHTGKVRDLYATESGELVMVASDRVSAFDWVLPTEIPDKGRLLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            SDI  NH +    P           LV ++L M P+E + RGYL G+            
Sbjct: 72  LSDIIDNHVISDTPPPGAPDDWAGRTLVCRRLDMVPVECVARGYLTGSGLAEY-----TA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + D  +L  P+ TP TK+       D+ +S   +  R        E +
Sbjct: 127 TGAVCGVRLPEGLVDGSRLDPPIFTPATKAEVGE--HDENVSLETVAERH--GPALAERL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+L+ERG ++A E G++L D+K+EFG D   +++LADE+ TPDSSR+W  E +   
Sbjct: 183 REVTLALYERGREIAEERGILLADTKFEFGWDSDGSLVLADEVLTPDSSRFWPKEEWRPG 242

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK  IR+W+ +  + +        P +P+ ++  T   YI  +E++TG  
Sbjct: 243 RPQ----PSFDKQIIRDWLSSAESGWDRTSETPPPPLPDTVVEHTRARYIEVFERLTGQT 298


>gi|117929336|ref|YP_873887.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidothermus cellulolyticus 11B]
 gi|117649799|gb|ABK53901.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidothermus cellulolyticus 11B]
          Length = 284

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 87/292 (29%), Positives = 145/292 (49%), Gaps = 21/292 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
               YSGKVR+ Y L DG  + +ATDR+SA+D  +   IP KG +L  ++ +WF   +D+
Sbjct: 6   YRLIYSGKVRDLYELPDGRLLFVATDRISAYDHILPTLIPDKGRILTALSLWWFDQLADV 65

Query: 71  CSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYL 125
             NH +    P       ++ ++L+M P E + RGYL G+              ++    
Sbjct: 66  VPNHVVSTDVPAEFHGRAMICERLEMIPFECVARGYLTGSGLADYQR-----TGQVCGVP 120

Query: 126 LPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLF 185
           LP  + D  +LP P+ TP TK+       D+ +          L       ++   L+++
Sbjct: 121 LPPGLVDGDRLPEPIFTPATKAPRG--THDENVPLA--AVEKALGAETAARLAELTLTIY 176

Query: 186 ERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPI 245
            +    AL +G+I+ D+K EFG      ++LADE+ TPDSSR+W  E++     +     
Sbjct: 177 RQAHDRALASGIIVADTKVEFGRRADGTLVLADEVLTPDSSRFWPAESWRPGRAQ----P 232

Query: 246 GLDKDFIRNWILTRCNP--YRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             DK ++R+W+ +           P +PE+++ +T   YI AYE+ITG ++ 
Sbjct: 233 SFDKQYVRDWLRSTGWDPAGSAPPPPLPEDVVAQTRARYIEAYERITGRRWE 284


>gi|300310008|ref|YP_003774100.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Herbaspirillum seropedicae SmR1]
 gi|124483480|emb|CAM32613.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase protein
           [Herbaspirillum seropedicae]
 gi|300072793|gb|ADJ62192.1| phosphoribosylaminoimidazole-succinocarboxamide synthase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 298

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 97/309 (31%), Positives = 148/309 (47%), Gaps = 28/309 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L K+ I  LP   +GKVRENY + D   + + TDRLSAFD  +   IP KG+VLNQ+
Sbjct: 1   MSSLYKSSITSLPLLGAGKVRENYAVGDDKLLIVTTDRLSAFDVIMNEPIPGKGKVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF     I  NH              ++      +V ++L+   +E +VRGY+ G+ 
Sbjct: 61  SDFWFDKLGHIVPNHLTGVDPESVVSPAEVEQVRGRAVVAKRLKPILVEAVVRGYIIGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP  +    KL  P+ TP  K+       D+ IS  E   R
Sbjct: 121 WKDY-----QATGAICGIRLPAGLQQASKLEQPIFTPAAKADLGE--HDENISFEETEKR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       I   A+ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGAELAHKIRDVAIQLYKEAADYAATRGIIIADTKFEFGLDDNGVLHLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAA 285
           R+W  ++Y    + GI+P   DK F+R+++ T +        P +P ++I +T   Y  A
Sbjct: 232 RFWPADSY----QVGISPPSFDKQFVRDYLETVQGWRKTPPAPPLPADVIEKTGAKYREA 287

Query: 286 YEKITGLKF 294
            E++TG K 
Sbjct: 288 LERLTGNKL 296


>gi|302877284|ref|YP_003845848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallionella capsiferriformans ES-2]
 gi|302580073|gb|ADL54084.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallionella capsiferriformans ES-2]
          Length = 294

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 92/307 (29%), Positives = 146/307 (47%), Gaps = 28/307 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP  + GKVR+ Y +     + + TDRLSAFD  +   IP KGEVL  +
Sbjct: 1   MSALHESNLTSLPLLHRGKVRDLYEVDAQHLLIVQTDRLSAFDVILDDPIPGKGEVLTTL 60

Query: 60  TQYWFHHTSDICSNHTL--------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
           + +WF     I  NH                        V ++L+  PIE IVRGYL G+
Sbjct: 61  SNFWFKKLGHIIPNHLSGIAPESVVKGDAEQAQVRGRSFVTKKLKPLPIEAIVRGYLVGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  + + QKLP P+ TP+TK++      D+ IS  +   
Sbjct: 121 GWKDYQK-----TGTICGLALPAGLREAQKLPEPLFTPSTKAAVG--DHDENISYAQ--A 171

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             +L   +   +    ++L+      A   G+I+ D+K+EFG+D+   + L DE  TPDS
Sbjct: 172 VELLGEARAAQVRDATVALYVEAANYAASRGIIIADTKFEFGVDEAGTLYLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  E+Y    + G  P   DK F+R+W+       +   P +P++++ +T+  Y  A
Sbjct: 232 SRFWPAESY----QVGSNPPSFDKQFVRDWLEASDWNKQAPAPRVPQDVLQKTADKYHEA 287

Query: 286 YEKITGL 292
            +++T  
Sbjct: 288 LQRLTAE 294


>gi|284993125|ref|YP_003411680.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geodermatophilus obscurus DSM 43160]
 gi|284066371|gb|ADB77309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geodermatophilus obscurus DSM 43160]
          Length = 287

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 84/295 (28%), Positives = 149/295 (50%), Gaps = 25/295 (8%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVRE Y   +   + +A+DR+SA+D  +   IP KG VL Q++ +WF   + +
Sbjct: 5   LPLVARGKVREVYDAGEDRLLLVASDRISAYDHVLPTPIPDKGRVLTQLSVWWFDQLAPV 64

Query: 71  CSN-----------HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            ++                     ++ ++L+M P+E + RGYL+G+              
Sbjct: 65  LASSGASHHLLSASDVPAPVAGRAMLVRRLEMLPVECVARGYLSGSGTVEYQR-----TG 119

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            I +  LP  + +  +LP PV TP+TK+ +     D+ I    ++    +   + E +  
Sbjct: 120 SIRDVPLPAGLVEGSELPEPVFTPSTKAEQGE--HDEAIDFAAVVA--AVGSERAEQLRE 175

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L+L+ RG ++AL+ G++L D+K+EFG+     ++L DE+ TPDSSR+W    +     
Sbjct: 176 LTLALYRRGAEIALDAGIVLADTKFEFGLGPDGGLVLGDEVLTPDSSRFWPATLWSP--- 232

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++R+W+ +         P++P +++  T + Y+ AYE++TG  F
Sbjct: 233 -GGVQPSYDKQYVRDWLTSSGWDRVSPPPELPADVVEATRERYVTAYERLTGTAF 286


>gi|53802674|ref|YP_112562.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylococcus capsulatus str. Bath]
 gi|81823726|sp|Q60CQ5|PUR7_METCA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53756435|gb|AAU90726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylococcus capsulatus str. Bath]
          Length = 297

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 91/306 (29%), Positives = 150/306 (49%), Gaps = 28/306 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ +  L     GKVR+ Y   D   + + TDRLSAFD  +   IP KG VL +++
Sbjct: 5   ETLFESSLSSLRLKARGKVRDIYEAGDDLMLIVTTDRLSAFDVILPDPIPGKGRVLTRVS 64

Query: 61  QYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIELIVRGYLAGNT 106
           ++WF    D   NH    P              +   +V ++L+  P+E +VRGYL G+ 
Sbjct: 65  RFWFERLKDRVPNHLSGTPLEAVLPDPAEREQVEGRAMVVKRLRPLPVEAVVRGYLIGSG 124

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  +   ++LP  + TP+TK+       D+ I  ++++  
Sbjct: 125 WKDYQR-----SGAVCGIGLPSGLRLAERLPDALFTPSTKAEMG--SHDENIGFDQVV-- 175

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
           G++ R   E +   AL L+      AL+ G+I+ D+K+EFG+D+   +   DE  TPDSS
Sbjct: 176 GLIGRELAERMREVALGLYREAAAYALDRGIIIADTKFEFGVDEAGVLHWIDEALTPDSS 235

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y      GI+P   DK F+R+++ T     +   P +P +I+ RT++ Y  A 
Sbjct: 236 RFWPADGYRP----GISPPSFDKQFVRDYLETLEWDKKPPAPHLPPDILARTAEKYREAE 291

Query: 287 EKITGL 292
            ++TG 
Sbjct: 292 RRLTGE 297


>gi|34495620|ref|NP_899835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromobacterium violaceum ATCC 12472]
 gi|39931753|sp|Q7P1P8|PUR7_CHRVO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|34101475|gb|AAQ57844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromobacterium violaceum ATCC 12472]
          Length = 284

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 94/297 (31%), Positives = 147/297 (49%), Gaps = 27/297 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +  L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I+ +WF   
Sbjct: 1   MTSLKKIYSGKVRDLYEIDDQRMLMIATDRLSAFDVILDDPIPAKGQILTAISNFWFDKL 60

Query: 68  SDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            D+  NH              L   +   +V ++L+  PIE +VRGYLAG+         
Sbjct: 61  KDVVPNHLTGDQPEDVVAAADLPQVEGRAVVAKRLKAVPIEAVVRGYLAGSGWKEYRQ-- 118

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
                 +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+     
Sbjct: 119 ---SGSVCGIALPAGLKEADKLPEPIFTPSTKAAVG--DHDENISFAQCEA--IVGAELA 171

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A+ L++   + A   G+I+ D+K+EFG+D+   + L DE  TPDSSR+W  ++Y
Sbjct: 172 AKVRDTAILLYQTAAEYAATRGIIICDTKFEFGLDENGTLTLMDEALTPDSSRFWPADSY 231

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           +     G  P   DK F+R+W+       +   P +P ++  +T+  Y  A EK+ G
Sbjct: 232 QP----GSNPPSFDKQFVRDWLEASGWNKQAPAPAVPLDVREKTAAKYREALEKLAG 284


>gi|288920469|ref|ZP_06414777.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EUN1f]
 gi|288348121|gb|EFC82390.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EUN1f]
          Length = 303

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 91/307 (29%), Positives = 147/307 (47%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 3   LTHEEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLW 62

Query: 63  WFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF    D+  +H +               +      ++ ++L M  IE + RGYL G+  
Sbjct: 63  WFDQLRDLVPSHVISSSVDEYPAELAPYKEQLRGRSMLCRRLDMVQIECVARGYLTGSGL 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +  + LP  + D  KLP  + TP+TK+       D+ IS ++    G
Sbjct: 123 KDYRR-----TGAVSGHPLPPGLEDGSKLPTTIYTPSTKAPIGE--HDENISRDD--AAG 173

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +     +    L +F R   LA E G++L D+K+EFG D    + LADE+ TPDSSR
Sbjct: 174 RVGKELAAELEHLTLQIFGRASDLAAERGILLADTKFEFGHDTDGVLRLADEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + +     +       DK FIRN+++          P++P +I+  T   Y+ AYE
Sbjct: 234 FWPADAWTPGGAQ----PSYDKQFIRNYLVDTGWDRNPPAPELPADIVESTRARYVEAYE 289

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 290 RLTGISF 296


>gi|296124081|ref|YP_003631859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces limnophilus DSM 3776]
 gi|296016421|gb|ADG69660.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces limnophilus DSM 3776]
          Length = 304

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 93/306 (30%), Positives = 157/306 (51%), Gaps = 31/306 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
            ++++++P +     GKVR+ Y   +   + +ATDR+SAFD  +   IP KG++L Q++ 
Sbjct: 15  AVTQSHLPGMTP-RQGKVRDVYDFGNQ-LLFVATDRISAFDWILPTGIPDKGKLLTQMSC 72

Query: 62  YWFHHTS-------------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF                  + +   L   +   LV Q+ ++ PIE +VRGYLAG+   
Sbjct: 73  FWFDLLKVRHHLVSTNPATLPLPAGTDLSLLEGRSLVVQKTRVIPIECVVRGYLAGSGWK 132

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                     + I    LP  + +  KLP P+ TP TK+       D+ IS  ++     
Sbjct: 133 EY-----RASQTICGISLPPGLVECDKLPVPIFTPATKAESG---HDENISFEQMQRD-- 182

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +     E +   +LS++ +    AL+ G++L D+K+EFG+  +  IIL DE+ TPDSSR+
Sbjct: 183 IDPQLAEKLRDLSLSIYRQAADYALKKGIVLADTKFEFGLLGE-EIILIDEVLTPDSSRF 241

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W ++ Y     +       DK F+R+W+ T+        P +PE+++L+T   Y+ AYE+
Sbjct: 242 WPLDQYRPGHGQ----PSFDKQFVRDWLETQPWDKNSPPPPLPEDVVLQTRAKYVEAYER 297

Query: 289 ITGLKF 294
           +TG  F
Sbjct: 298 LTGSTF 303


>gi|258405235|ref|YP_003197977.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfohalobium retbaense DSM 5692]
 gi|257797462|gb|ACV68399.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfohalobium retbaense DSM 5692]
          Length = 303

 Score =  260 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 86/314 (27%), Positives = 153/314 (48%), Gaps = 30/314 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M+ + +  +  +     GKVR+ Y + +   + + TDR+SAFD  +   IP KG VLNQ+
Sbjct: 1   MQTVQQTELSGIELVSRGKVRDMYAVDEDKLLIVTTDRMSAFDVILPDPIPGKGIVLNQL 60

Query: 60  TQYWFHHTSDICSNH---------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W    +D+ SNH                 +      ++ ++ Q  PIE IVRGYL+G
Sbjct: 61  TLFWMDRFADLVSNHTLNADASSYPAFLAPHAEQLRGRSVLARRAQPLPIECIVRGYLSG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP+ + ++Q+LP P+ TP+TK+       D+ I+ ++  
Sbjct: 121 SGWKDYQR-----TGTVCGHSLPEGLRESQQLPEPLFTPSTKAEIG--DHDENITLSQ-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++  ++   + S +L ++ R    A + G+I+ D+K+EFG+     ++L DE+ TPD
Sbjct: 172 ASDLVGADRMAQVQSLSLQMYSRARDYARQCGIIIADTKFEFGLIDD-ELVLIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y     +       DK ++R+W+       +   P +P ++I +T   Y  
Sbjct: 231 SSRFWPEEQYTLGQGQ----PSFDKQYLRDWLTGSGWNKQAPGPALPPDVIAQTRDKYHQ 286

Query: 285 AYEKITGLKFIADN 298
           AY  +TG      +
Sbjct: 287 AYTLLTGETLALPD 300


>gi|325107818|ref|YP_004268886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces brasiliensis DSM 5305]
 gi|324968086|gb|ADY58864.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces brasiliensis DSM 5305]
          Length = 302

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 97/315 (30%), Positives = 162/315 (51%), Gaps = 35/315 (11%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ I  LP   SGKVR+ Y L D   + +ATDR+SAFD  +   IP KG +L Q+
Sbjct: 1   MSTLLQSEIAGLPK-RSGKVRDVYDLGDS-LLIVATDRISAFDWILPNGIPEKGRILTQL 58

Query: 60  TQYWFHHTS-------------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF                  +     +D      ++ ++ ++ PIE +VRGYLAG+ 
Sbjct: 59  SLHWFKLLGVENHLISTDPSLLPLPPGTDVDALQGRSMIVRKSEVIPIECVVRGYLAGSG 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                       R +    LP  + +++KLP P+ TP+TK+ E     D PIS   +  +
Sbjct: 119 WVDYQK-----NRTVSGVELPAGLQESEKLPEPIFTPSTKAEEG---HDMPISLEAVSEQ 170

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGI-----DKKQNIILADEIH 221
             +  +  E +   +++++++    A E+GLIL D+K+EFG      +++  IIL DE+ 
Sbjct: 171 --IGGDVAEDLKQRSIAIYQKAADYAREHGLILADTKFEFGFWKATPEEQPRIILIDEVL 228

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSRYW  + Y      G +    DK ++R+W+L          P +P++++  T+  
Sbjct: 229 TPDSSRYWPADDY----EVGRSQNSFDKQYVRDWLLQTDWDRNSPPPQLPDDVVANTAAK 284

Query: 282 YIAAYEKITGLKFIA 296
           Y  AY+ +TG +F++
Sbjct: 285 YREAYQLLTGREFVS 299


>gi|188591312|ref|YP_001795912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cupriavidus taiwanensis LMG 19424]
 gi|229564389|sp|B2AHE3|PUR7_CUPTR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|170938206|emb|CAP63192.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
           [Cupriavidus taiwanensis LMG 19424]
          Length = 302

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 151/312 (48%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+ 
Sbjct: 3   NALYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMA 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+  
Sbjct: 63  NFWFRKLAHIVPNHETGIAPETVVAADEVEQVRGRAVVVKRLKPILVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    LP  + + QKLP P+ TP  K+       D+ IS  E+  R 
Sbjct: 123 KDY-----QATGKVCGIELPPGLQNAQKLPEPIFTPAAKAEMGE--HDENISFAEVEAR- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +   ++ L++   + A   G+I+ D+K+EFG+D    + L DE+ T DSSR
Sbjct: 175 -IGIALARQMREISIRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTLMDEVLTADSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P+++I +T+  Y
Sbjct: 234 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPDDVIEKTAAKY 289

Query: 283 IAAYEKITGLKF 294
             A  ++TG + 
Sbjct: 290 REALTRLTGEEL 301


>gi|264680783|ref|YP_003280693.1| phosphoribosylaminoimidazole-succinocarboxamide [Comamonas
           testosteroni CNB-2]
 gi|299531974|ref|ZP_07045374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni S44]
 gi|262211299|gb|ACY35397.1| phosphoribosylaminoimidazole-succinocarboxamide [Comamonas
           testosteroni CNB-2]
 gi|298720149|gb|EFI61106.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni S44]
          Length = 305

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 151/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+ 
Sbjct: 6   SALHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGVLLTQMA 65

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     IC NH              +   +   ++ ++L+   IE +VRGYLAG+  
Sbjct: 66  LFWFDKLGHICPNHLTGEAPESVVKPEEVKQVEGRSMLVKRLKPVLIEAVVRGYLAGSGW 125

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +++  KLP P+ TP  K+       D+ I+    +   
Sbjct: 126 KEYQESQ-----SVCGVKLPAGLTNAAKLPEPIYTPAAKAEMG--DHDENITYERTVEM- 177

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   A+ +++   ++AL  G+I+ D+K+EFG+ +   ++L DE+ TPDSSR
Sbjct: 178 -VGEQLAAQIRDTAIRIYKEAAEIALTKGMIIADTKFEFGLTEDGTLVLMDEVLTPDSSR 236

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE YE +  +G  P   DK F+R+W+       +    +   P +P+ +I RT+  Y
Sbjct: 237 YWPVEGYEDALAKGENPPSYDKQFVRDWLEQAQVNGKAWDKKAPAPRLPKEVIDRTAAKY 296

Query: 283 IAAYEKIT 290
             A +++T
Sbjct: 297 REALDRLT 304


>gi|329908776|ref|ZP_08274954.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327546609|gb|EGF31579.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 309

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 94/310 (30%), Positives = 147/310 (47%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ IP LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 12  MTSLYQSEIPSLPLLGRGKVRDNYAVGDDQILIVTTDRLSAFDVVMNEAIPAKGRVLNQM 71

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF   + I  NH              +D      +V ++LQ   +E +VRGYL G+ 
Sbjct: 72  SNFWFEKLAAIVPNHLTGVTPESVVQANEIDQVRGRAVVAKRLQPIMVEAVVRGYLIGSG 131

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  +    KL  P+ TP  K+       D+ IS  ++  R
Sbjct: 132 WKDY-----QATGAVCGVALPAGLRQADKLAAPIFTPAAKAELGE--HDENISFADMEQR 184

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       +   +++L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 185 --IGAELAAKMRDVSIALYQAAADYAATRGIIIADTKFEFGLDADGTMYLMDEVLTADSS 242

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAA 285
           R+W  ++Y      G +P   DK F+R+++ T    P     P +P ++I +T   Y  A
Sbjct: 243 RFWPADSYAP----GSSPPSFDKQFVRDYLETLTDWPKTAPAPTLPADVIAKTGAKYREA 298

Query: 286 YEKITGLKFI 295
            E++TG    
Sbjct: 299 LERLTGGTLE 308


>gi|221069907|ref|ZP_03546012.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni KF-1]
 gi|220714930|gb|EED70298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni KF-1]
          Length = 305

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 151/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+ 
Sbjct: 6   SALHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGVLLTQMA 65

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     IC NH              +   +   ++ ++L+   IE +VRGYLAG+  
Sbjct: 66  LFWFDKLGHICPNHLTGEAPESVVKPEEVKQVEGRSMLVKRLKPVLIEAVVRGYLAGSGW 125

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +++  KLP P+ TP  K+       D+ I+    +   
Sbjct: 126 KEYQESQ-----SVCGVKLPAGLTNAAKLPEPIYTPAAKAEMG--DHDENITYERTVEM- 177

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   A+ +++   ++AL  G+I+ D+K+EFG+ +   ++L DE+ TPDSSR
Sbjct: 178 -VGEQLAAQIRDTAIRIYKEAAEIALTKGMIIADTKFEFGLTEDGALVLMDEVLTPDSSR 236

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE YE +  +G  P   DK F+R+W+       +    +   P +P+ +I RT+  Y
Sbjct: 237 YWPVEGYEDALAKGENPPSYDKQFVRDWLEQAQVNGKAWDKKAPAPRLPKEVIDRTAAKY 296

Query: 283 IAAYEKIT 290
             A +++T
Sbjct: 297 REALDRLT 304


>gi|239980937|ref|ZP_04703461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
 gi|291452800|ref|ZP_06592190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
 gi|291355749|gb|EFE82651.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
          Length = 300

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 97/301 (32%), Positives = 154/301 (51%), Gaps = 27/301 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  EVPGLVHLHTGKVRDLYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L+M P+E + RGYL G+            
Sbjct: 72  LADLVPNHVLSTTLPEGAPADWKGRTLVCKSLEMAPVECVARGYLTGSGLVEYEE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP  + +  +LP  + TP TK++      D+ +S  E+     +       +
Sbjct: 127 SRTVCGLALPPGLVNGSELPAAIFTPATKAAVG--DHDENVSYEEVARL--VGPETAAEL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E GLIL D+K+EFG D    +ILADE+ TPDSSRYW  +T+E  
Sbjct: 183 RQTTLAVYSRALDVARERGLILADTKFEFGHDADGTLILADEVLTPDSSRYWPADTWEPG 242

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P +PE ++ RT   YI AYE++TG+ 
Sbjct: 243 RAQ----PSFDKQFVRDWLTSEASGWDRHAEQPPPALPEEVVDRTRAKYIEAYERLTGVS 298

Query: 294 F 294
           +
Sbjct: 299 W 299


>gi|94309449|ref|YP_582659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cupriavidus metallidurans CH34]
 gi|166230836|sp|Q1LR36|PUR7_RALME RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|93353301|gb|ABF07390.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Cupriavidus metallidurans CH34]
          Length = 302

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 94/309 (30%), Positives = 152/309 (49%), Gaps = 32/309 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            L ++ I  LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+  
Sbjct: 4   ALYESSIQSLPLLGKGKVRDNYAVGDDKLLIVTTDRLSAFDVILGEPIPAKGRVLNQMAN 63

Query: 62  YWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+   
Sbjct: 64  FWFKKLAHIVPNHETDVTAESVVAPNEVEQVKGRAVVVKRLKPILVEAVVRGYLAGSGWK 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                      K+    LP  + + QKLP P+ TP  K+       D+ IS +E+  R  
Sbjct: 124 DY-----QATGKVCGIALPAGLQNAQKLPEPIFTPAAKAEMGE--HDENISFDEVEAR-- 174

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           + +     +   ++ L++     A   G+I+ D+K+EFG+D+   + L DE+ T DSSR+
Sbjct: 175 IGKELAAKMRDISIRLYKEAADYAATRGIIIADTKFEFGLDENGTLTLMDEVLTADSSRF 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYI 283
           W  ++Y    + G  P   DK F+R+W+       +  P     P +PE+++ +T+  Y 
Sbjct: 235 WPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPEDVVQKTADKYK 290

Query: 284 AAYEKITGL 292
            A  ++TG 
Sbjct: 291 EALTRLTGE 299


>gi|145589994|ref|YP_001156591.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048400|gb|ABP35027.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 298

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 98/309 (31%), Positives = 147/309 (47%), Gaps = 32/309 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L    I  LP    GKVR+ Y L D   + I TDRLSAFD  +   IP KG +LNQ+
Sbjct: 1   MPALYATSIKSLPLLSKGKVRDVYALGDDKLLMITTDRLSAFDVVMGEPIPEKGILLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFDKLGKVIPNHLTGIDPATVVPADEVEQVKGRAVVAKRLKPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  + + QKLP P+ TP  K+       D+ IS  ++I  
Sbjct: 121 WKDYKE-----TGKVCGITLPAGLENAQKLPEPIFTPAAKADVGE--HDENISFEKVIEL 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       I   ++ L++   + A   G+I+ D+K+EFG+D    ++L DEI T DSS
Sbjct: 174 --IGEKLANQIREVSIRLYKEASEYAATRGIIIADTKFEFGLDDAGQLVLMDEILTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQT 281
           R+W  ETY      G  P   DK F+R+W+ T     +  P     P +P ++I +T+Q 
Sbjct: 232 RFWPAETYY----VGSNPPSYDKQFVRDWLETAQVNGKLWPKTAPAPQLPADVIEKTAQK 287

Query: 282 YIAAYEKIT 290
           Y  A  ++T
Sbjct: 288 YREALARLT 296


>gi|283782062|ref|YP_003372817.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pirellula
           staleyi DSM 6068]
 gi|283440515|gb|ADB18957.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pirellula
           staleyi DSM 6068]
          Length = 294

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 91/308 (29%), Positives = 148/308 (48%), Gaps = 31/308 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L    I +LP    GKVR+ + L D   + +ATDR+SAFD  +   IP KG VL Q+
Sbjct: 1   MSALLSTEISDLP-VRRGKVRDVFDLGD-CLLMVATDRISAFDWVMPNGIPDKGRVLTQV 58

Query: 60  TQYWFHHT-------------SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF                  + +   +       +V ++  + PIE +VRGYL G+ 
Sbjct: 59  SNWWFSRLGVENHLLSTEVPADRLPTGTDVAALAGRSVVVRKASIVPIECVVRGYLDGSG 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                       + +    LP  +    KLP P+ TP TK        DQ IS   +   
Sbjct: 119 WKEYKQ-----TQSVCGVTLPAGLLQGSKLPEPIFTPATKEESG---HDQNISFERMCE- 169

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ R     +   +++++++   +ALE G+++ D+K E+G  +   +IL DE+ TPDSS
Sbjct: 170 -IVGRETSRELRDRSIAIYKQAADVALERGIVIADTKMEWGRFEG-RLILCDEVLTPDSS 227

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+    +       DK F+R+W+ T         P++P  ++ RT + YI A+
Sbjct: 228 RFWPADKYQPGGPQ----PSFDKQFVRDWLETTGWDKNSPPPNLPTEVVTRTREKYIEAF 283

Query: 287 EKITGLKF 294
           E++TG  F
Sbjct: 284 EQLTGQHF 291


>gi|121596214|ref|YP_988110.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax sp. JS42]
 gi|222112441|ref|YP_002554705.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax ebreus TPSY]
 gi|120608294|gb|ABM44034.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax sp. JS42]
 gi|221731885|gb|ACM34705.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax ebreus TPSY]
          Length = 306

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 97/308 (31%), Positives = 151/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+ 
Sbjct: 7   SALHTSALTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMA 66

Query: 61  QYWFHHTSDICSNHTLD-------------YPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I  NH                      ++ Q+L+  PIE +VRGYLAG+  
Sbjct: 67  LFWFGKLGHIVPNHLTGEAPESVVTPAEAPQVRGRSMLVQRLKPIPIEAVVRGYLAGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      R +    LPD +++  KLP  + TP  K++      D+ IS    +   
Sbjct: 127 KEYQE-----SRSVCGVPLPDGLTNAAKLPQTIYTPAAKAAMGE--HDENISFERTVE-- 177

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           I+  +    I   ++ L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSSR
Sbjct: 178 IVGLDLATRIRDISIQLYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSR 237

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE Y ++  +G  P   DK F+R+W+       +        P +P  ++ +T+  Y
Sbjct: 238 YWPVEGYAEALAKGENPPSYDKQFVRDWLEQAQVGGKPWNKTAPAPRLPREVVEKTAAKY 297

Query: 283 IAAYEKIT 290
             A E++T
Sbjct: 298 REALERLT 305


>gi|302535728|ref|ZP_07288070.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. C]
 gi|302444623|gb|EFL16439.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. C]
          Length = 300

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 88/301 (29%), Positives = 151/301 (50%), Gaps = 27/301 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y   DG  + +A+DR+SA D  +   IP KG +L Q++ +WF  
Sbjct: 12  QVPGLAHLHTGKVRDLYRDEDGNLVMVASDRISAADWVLPTEIPEKGRILTQLSLWWFEQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L M P+E + RGYL G+     +      
Sbjct: 72  LADLVPNHVLGTDLPAGAPADWEGRTLVCKSLDMVPVECVARGYLTGSGLKEYVQ----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP  K+       D+ +S  E+             +
Sbjct: 127 TRTVCGLALPEGLVDGSELPAPIFTPAAKAEVG--DHDENVSYEEVAR--TTGAETAALL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E G+IL D+K+EFG D+   ++ ADE+ TPDSSR+W  + ++  
Sbjct: 183 RQTTLAVYGRARDIARERGIILADTKFEFGFDEDGTLVAADEVLTPDSSRFWPADQWQPG 242

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+ +  + +        P +P+ ++ +T   Y+ AYE++TG  
Sbjct: 243 RTQ----PSFDKQYVRDWLASPASGWDSKGELPPPVLPQEVVAQTRAKYVEAYERLTGQT 298

Query: 294 F 294
           +
Sbjct: 299 W 299


>gi|118581469|ref|YP_902719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelobacter propionicus DSM 2379]
 gi|166230830|sp|A1ATJ1|PUR7_PELPD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|118504179|gb|ABL00662.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelobacter propionicus DSM 2379]
          Length = 296

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 90/304 (29%), Positives = 143/304 (47%), Gaps = 31/304 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           +     P L     GKVR+ Y L + T + + +DR+SAFD  +   IP KG VL +I+ +
Sbjct: 5   VMHTDFPGLKLLARGKVRDIYDLGE-TLLLVTSDRISAFDVIMNEPIPDKGFVLTEISSF 63

Query: 63  WFHHTSDICSNHTLDYPDP---------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF    DI SNH +                      ++ ++ +  P+E IVRGY++G+  
Sbjct: 64  WFRQMEDIVSNHIISTDVDEFPAACRPHADLLRGRSMLVKKARPLPVECIVRGYVSGSGW 123

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        I    LP  + ++ +LP P+ TP+TK+       D+ IS   +    
Sbjct: 124 KEY-----QSSGSICGISLPPGLRESDRLPEPIFTPSTKAELG--THDENISFERMTEL- 175

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
              R   E    Y L ++ R  +LA + G+I+ D+K+EFG+ +   +I+ DE  TPDSSR
Sbjct: 176 -CGRELAEQARDYTLKIYGRARELADQKGIIIADTKFEFGVFEG-ELIIIDECMTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y     +       DK F+R+++           P +P  II +T+Q Y  A  
Sbjct: 234 FWLKDDYRPGGPQ----PSFDKQFLRDYLEGLDWNKTAPAPALPAEIIAKTAQMYREALS 289

Query: 288 KITG 291
           +ITG
Sbjct: 290 RITG 293


>gi|58651789|emb|CAI50969.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [uncultured bacterium]
          Length = 296

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 96/308 (31%), Positives = 158/308 (51%), Gaps = 32/308 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L +  +P +     GKVR+ Y + D   + +ATDR+SAFD      IP KG++L Q++
Sbjct: 3   EALCETRLPGIEPVARGKVRDIYDVGDA-LLIVATDRISAFDWVNPVGIPDKGKILTQMS 61

Query: 61  QYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
            YWF  T D+C NH +               +  +   ++  +  MFP+E +VRGYLAG+
Sbjct: 62  LYWFEVTRDLCRNHLISSRLADFPSEFRNAPEQFEGRSMLVHKCAMFPVEFVVRGYLAGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          +    LP  + ++ KL  P+ TP TK+   ++G D  I P+E   
Sbjct: 122 GWKEYREH-----GTVCGIPLPKGLQESSKLDTPIFTPATKA---SNGHDINIPPDE--A 171

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             I+ +   +  S  A++++ER   +A   G+IL D+K+EFG+ +   ++LADE+ TPDS
Sbjct: 172 GKIIGQEWAKAASGKAIAIYERARDIAGSKGIILCDTKFEFGLFEGA-LMLADEVLTPDS 230

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SRYW  + Y+    +       DK ++R+W+ T         P +P ++I +T + Y+ A
Sbjct: 231 SRYWPADEYQPGRGQ----PSYDKQYVRDWLETTGWDKNSPPPALPADVITKTREKYVEA 286

Query: 286 YEKITGLK 293
           Y ++TG  
Sbjct: 287 YRRLTGRD 294


>gi|297172488|gb|ADI23460.1| phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [uncultured nuHF1 cluster bacterium HF0770_35I22]
          Length = 332

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 141/318 (44%), Positives = 206/318 (64%), Gaps = 2/318 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
             L +A+  ELPNY  GKVR++Y L DG RI I+TDR SAFD  +A +P+KG+VLNQI++
Sbjct: 15  NCLDEAHFDELPNYDRGKVRDSYNLPDGRRIMISTDRQSAFDVILASVPFKGQVLNQISK 74

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+ IC NH + +PDPN+++ + L+M PIE+IVR Y+ G+T+TS+   Y+ G+R +
Sbjct: 75  FWFDSTNHICPNHVIKFPDPNIVITKNLKMLPIEIIVRDYMTGSTETSIWPMYQKGERHM 134

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +   D    NQKL   +ITPTTK+ +     D PI+  EII + +L++  W+ +S  A
Sbjct: 135 YGHAFDDGFVKNQKLKTTIITPTTKAIQGE--HDAPITATEIIEKKLLSQETWDEVSKKA 192

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF  G K++ +NGLILVD+KYEFGID    + +ADEIHTPDSSR+W   +Y+      
Sbjct: 193 LALFSEGRKISSQNGLILVDTKYEFGIDDTGVVTIADEIHTPDSSRFWVKASYKPRMLAK 252

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P  LDK+F+R WI  +C+PY D IP IP+  ++  S+ Y+  +E++TG KF+      
Sbjct: 253 EEPESLDKEFLRLWISQKCDPYTDPIPAIPQKTLVEFSKKYVRLFEQVTGQKFLNPPENE 312

Query: 302 PPLERIRNNLRKYTHRHL 319
              +RI  +L      + 
Sbjct: 313 SIKKRIYKSLSAEFPEYF 330


>gi|218887900|ref|YP_002437221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758854|gb|ACL09753.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 298

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 88/310 (28%), Positives = 156/310 (50%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+++++  I E P    GKVR+ Y +   T + + TDR+SAFD  +   IPYKG +LN I
Sbjct: 1   MQVVTQTDIKEYPLLSRGKVRDIYEIDAQTLLIVTTDRMSAFDVIMGEPIPYKGVILNSI 60

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W +  + +  NH +++                +   ++ ++ +  P+E IVRG++ G
Sbjct: 61  TLFWMNRFAGLVKNHLIEHDVNRFPAPLAPYRDMLEGRAVIVRKAKPLPVECIVRGHITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++ KL  P+ TP+TK+       D+ IS  +  
Sbjct: 121 SGWKDY-----KATGAVCGHKLPAGLPESAKLETPLFTPSTKAELG--AHDENISIGQ-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              +L  +    +   ++++F +G + A   G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AAKLLGDDLAARVQELSIAIFSQGREYAEGRGIIIADTKFEFGL-VDGEVILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y     +       DK ++R+W+ ++        P +PE++I  T + Y  
Sbjct: 231 SSRFWPAEGYAPGKGQ----PSFDKQYLRDWLASQPWDKTPPPPALPEHVIAETGKKYRE 286

Query: 285 AYEKITGLKF 294
           AYE +TG K 
Sbjct: 287 AYEILTGSKL 296


>gi|146283124|ref|YP_001173277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas stutzeri A1501]
 gi|145571329|gb|ABP80435.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Pseudomonas stutzeri A1501]
          Length = 291

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 90/304 (29%), Positives = 150/304 (49%), Gaps = 28/304 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           MR+ +   +  L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KG++L  I
Sbjct: 1   MRMTTPTAL-SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILAEPIPEKGKILTAI 59

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF     +  NH              L   +   +V ++L+   +E IVRGY+ G+ 
Sbjct: 60  SNFWFDKLKGLIPNHFTGDKVEDVVPADELPLVEGRAVVAKRLKPVAVEAIVRGYIVGSG 119

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + +  KLP P+ TP+TK++      D+ IS  +    
Sbjct: 120 WKEYQK-----SGTVCGIQLPAGLKEAAKLPQPIFTPSTKAAVG--DHDENISFEQCEA- 171

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ +     +   +++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSS
Sbjct: 172 -IIGKELAAQVRDVSIALYSAAVEYAATRGIIIADTKFEFGLDENGTLTLMDEVLTPDSS 230

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++YE+    G  P   DK F+R+W+ +     +   P +P  +  RT+  Y  A 
Sbjct: 231 RFWPADSYEE----GKNPPSFDKQFVRDWLESTGWNKQPPAPAVPAEVAQRTADKYREAL 286

Query: 287 EKIT 290
            ++T
Sbjct: 287 TRLT 290


>gi|113866597|ref|YP_725086.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha H16]
 gi|123134396|sp|Q0KE53|PUR7_RALEH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|113525373|emb|CAJ91718.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Ralstonia eutropha H16]
          Length = 302

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 150/312 (48%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+ 
Sbjct: 3   NALYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMA 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+  
Sbjct: 63  NFWFRKLAHIVPNHETGIAPETVVAPEEVEQVKGRAVVVKRLRPILVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    LP  + + QKLP P+ TP  K+       D+ IS  E+  R 
Sbjct: 123 KDY-----QATGKVCGIELPAGLQNAQKLPEPIFTPAAKAEMGE--HDENISFAEVEAR- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +   ++ L++   + A   G+I+ D+K+EFG+D    + L DE+ T DSSR
Sbjct: 175 -IGIALARQMRDISIRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTLMDEVLTADSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P+ +I +T+  Y
Sbjct: 234 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPDEVIEKTAAKY 289

Query: 283 IAAYEKITGLKF 294
             A  ++TG + 
Sbjct: 290 REALTRLTGEEL 301


>gi|73540262|ref|YP_294782.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha JMP134]
 gi|123625794|sp|Q475J5|PUR7_RALEJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|72117675|gb|AAZ59938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha JMP134]
          Length = 302

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 152/312 (48%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+ 
Sbjct: 3   NALYQSSISSLPLLGHGKVRDNYAVGEDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMA 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF   + I  NH              ++      +V ++L+   +E +VRGYLAG+  
Sbjct: 63  NFWFRKLAHIVPNHETGVAAETVVAPAEVEQVKGRAVVVKRLKPILVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    LP  + + QKLP P+ TP  K+       D+ IS  E+  R 
Sbjct: 123 KDY-----QATGKVCGIELPAGLQNAQKLPEPIFTPAAKAEMGE--HDENISFGEVEER- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +   ++ L++   + A   G+I+ D+K+EFG+D+   + L DE+ T DSSR
Sbjct: 175 -IGIALARQMRDISIRLYKEAAEFAATRGIIIADTKFEFGLDENGTLTLMDEVLTADSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P+++I +T+  Y
Sbjct: 234 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPDDVIEKTAAKY 289

Query: 283 IAAYEKITGLKF 294
             A  ++TG + 
Sbjct: 290 REALTRLTGEEL 301


>gi|149924685|ref|ZP_01913035.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Plesiocystis pacifica SIR-1]
 gi|149814442|gb|EDM74033.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Plesiocystis pacifica SIR-1]
          Length = 323

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 117/296 (39%), Positives = 178/296 (60%), Gaps = 5/296 (1%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           YSGKVREN+   D   I + +DR+SAFD  +  IP+KG+VLN + ++WF  T+D   NH 
Sbjct: 32  YSGKVRENFTRGDERVIIV-SDRVSAFDHVLGTIPFKGQVLNGLARHWFAQTADQFPNHL 90

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
              PD  V V  + +   +E++VRGYL G++ TS+   Y++G R    + LP+ ++ +QK
Sbjct: 91  RSVPDAQVTVASECEPIKVEMVVRGYLTGSSSTSIWRAYESGSRSFCGHTLPEGLARHQK 150

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           LP  ++TP TK+++     DQ  S  E++  G++T   ++ +    L+LF RG +LA E 
Sbjct: 151 LPTNLVTPATKAAKGE--HDQNASKAELVEMGLITAELFDELEQRCLALFARGQELAAER 208

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYE G      I+L DEIHTPDSSRYW ++ Y+ S   G  P  LDK+++R W
Sbjct: 209 GLILVDTKYELGRRPDGEIVLIDEIHTPDSSRYWYIDGYDASMAAGEDPRSLDKEYVRRW 268

Query: 256 ILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNL 311
           ++ +        P + + + +  +  YI  +E++TG  F+ D    PPLER+R  L
Sbjct: 269 LVEQGFRGEGTPPALSDEVRIEAAARYIETFEQVTGTDFVPDLR--PPLERLRAAL 322


>gi|121606756|ref|YP_984085.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas naphthalenivorans CJ2]
 gi|189038225|sp|A1VU36|PUR7_POLNA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|120595725|gb|ABM39164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas naphthalenivorans CJ2]
          Length = 305

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 152/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
            +L  + +  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+ 
Sbjct: 6   SVLHTSALTSLPLLARGKVRDNYAVGNDRLLMVASDRLSAFDVILGEPIPGKGALLTQMA 65

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     IC NH              +       ++ ++L+  P+E +VRGYLAG+  
Sbjct: 66  LFWFDKLGSICPNHLTGEAPESVVTAAEIPQVAGRSMLVKRLKPIPVEAVVRGYLAGSGW 125

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  + +  KLP P+ TP  K+       D+ IS  +++   
Sbjct: 126 VEYQQSQ-----SVCGVPLPAGLKNASKLPEPIFTPAAKAEVGE--HDENISYEQVV--K 176

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           ++       I + +++++E     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR
Sbjct: 177 VVGPELAAQIKTLSIAIYETAAAFALTKGIIIADTKFEFGLDENGTLTLMDEVLTPDSSR 236

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE YE +F  G  P   DK F+R+W+       +        P +P ++I +T+  Y
Sbjct: 237 YWPVEGYEAAFAAGQNPPSYDKQFVRDWLEAVRINGKPWDKTPPSPHLPPDVISKTAAKY 296

Query: 283 IAAYEKIT 290
             A  ++T
Sbjct: 297 QEAMARLT 304


>gi|146306696|ref|YP_001187161.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina ymp]
 gi|145574897|gb|ABP84429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina ymp]
          Length = 289

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 87/294 (29%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KG++L  I+ +WF   + 
Sbjct: 8   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILEQPIPEKGKILTAISNFWFDKLAG 67

Query: 70  ICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           +  NH              L   +   +V ++L+   +E IVRGY+ G+           
Sbjct: 68  VVPNHFTGDKVEDVVPAAELPLVEGRAVVAKRLKPVAVEAIVRGYIVGSGWKEYQK---- 123

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+       
Sbjct: 124 -SGTVCGIALPAGLKEAAKLPQPIFTPSTKAAVG--DHDENISFEQCEA--IIGAELAAK 178

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++Y +
Sbjct: 179 VRDTAIKLYTTAVEYAATRGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRFWPADSYAE 238

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+ +     +   P +P ++  +T+  Y  A  ++T
Sbjct: 239 ----GSNPPSFDKQFVRDWLESTGWNKQPPAPAVPADVAQKTADKYREALTRLT 288


>gi|309780641|ref|ZP_07675383.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Ralstonia
           sp. 5_7_47FAA]
 gi|308920564|gb|EFP66219.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Ralstonia
           sp. 5_7_47FAA]
          Length = 307

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 94/312 (30%), Positives = 147/312 (47%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG VL Q++
Sbjct: 8   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGRVLAQMS 67

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF+    I   H              +D      +V ++L+   +E +VRGYLAG+  
Sbjct: 68  DFWFNKLRHIVPTHETGIAPETVVAPDEVDQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    L   + + QKLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 128 KDY-----QATGAVCGVHLAPGLQNAQKLPEPIFTPAAKAEMGE--HDENISFDEVERR- 179

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 180 -IGPDLAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 238

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    R G  P   DK F+R+W+       +  P     P +P ++I +T+  Y
Sbjct: 239 FWPADSY----RVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPADVIEKTADKY 294

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 295 REALARLTGESL 306


>gi|77918656|ref|YP_356471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelobacter carbinolicus DSM 2380]
 gi|123574547|sp|Q3A5Q6|PUR7_PELCD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|77544739|gb|ABA88301.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelobacter carbinolicus DSM 2380]
          Length = 296

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 155/307 (50%), Gaps = 31/307 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           I+ +   P L     GKVR+ Y L +   + + +DR+SAFD  +   IPYKG VL QI++
Sbjct: 4   IVLQTDFPNLKLVNKGKVRDIYDLGE-HLLIVTSDRISAFDVVMNEGIPYKGFVLTQISK 62

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF   SDI  +H +               D  +   ++ ++ +  PIE IVRGYLAG+ 
Sbjct: 63  FWFDAFSDIVPHHLVSTEVDDFPAETRPYRDQLEGRSMLVRKAEPLPIECIVRGYLAGSG 122

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                      +  +    LP  M ++QKLP P+ TP+TK+       D+ IS  +    
Sbjct: 123 WKEYRQ-----QGTVCGIALPPGMVESQKLPEPIFTPSTKAELG--AHDENISFEKATEL 175

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
                +        AL+++ R        G+I+ D+K+EFG+ +   ++  DE  TPDSS
Sbjct: 176 --CGGDIAAQAREVALTIYGRARDEMAAKGIIVADTKFEFGL-RDGRLMWIDEALTPDSS 232

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R+G      DK F+R+++ T     +   P +P++I+L+TS+ Y+ A 
Sbjct: 233 RFWPQDEY----RQGGAQPSFDKQFLRDYLETLDWNKQAPAPTLPDDIVLKTSEKYLEAL 288

Query: 287 EKITGLK 293
            +ITGLK
Sbjct: 289 FRITGLK 295


>gi|91974632|ref|YP_567291.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB5]
 gi|91681088|gb|ABE37390.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB5]
          Length = 305

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 143/314 (45%), Gaps = 30/314 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P L     GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTMLTSDLP-LNKIGRGKVRDIYAVDDERLLLVTTDRISAFDVVMAETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPD------------------PNVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAWWFDQLGGVVPHHMISADAAEIIDAVPALKDHRAALAGRAMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+               +    LP  + ++++L  P+ +P TK+       D+ I+  
Sbjct: 120 ITGSAWKEY-----AASGTLAGETLPAGLQESERLAPPIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R I+      T+ S   +++ +G  +A E G+I+ D+K+EFG D    IIL DE+ 
Sbjct: 172 RM--REIVGDETAYTLESMTRAVYTQGEAIAREQGIIIADTKFEFGRDANGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  ++Y     +        +D++               P +P  ++  TS  
Sbjct: 230 TPDSSRFWAADSYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAEVVAATSAR 289

Query: 282 YIAAYEKITGLKFI 295
           Y+ AY ++TG   +
Sbjct: 290 YLDAYRRLTGTDLV 303


>gi|332704304|ref|ZP_08424392.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332554453|gb|EGJ51497.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 298

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 85/307 (27%), Positives = 147/307 (47%), Gaps = 30/307 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M+ + +  I E P  + GKVR+ Y +     + + TDR+SAFD  +   +P KG +LNQI
Sbjct: 1   MKTVIQTDIKEFPLLHRGKVRDIYGIDAERLLIVTTDRISAFDVVLPDPVPLKGAILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH L               +      ++ ++ +  PIE IVRGY+ G
Sbjct: 61  TLFWMDKFKDLVENHVLASETKDFPPELAPYAEELAGRSVLVKRAKPLPIECIVRGYITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++  LP P+ TP+TK+       D+ I+  +  
Sbjct: 121 SGWKDYRK-----TGTVSGHKLPVGLQESAMLPTPLFTPSTKAEIGQ--HDENITVEQ-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            + +  R+    +   ++ ++ R    A   G+I+ D+K+EFG      ++L DE+ TPD
Sbjct: 172 AKDMAGRDMVAQVEKLSIEIYSRARDYARSRGIIIADTKFEFGTI-DGKLLLIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W ++ Y     +       DK F+R+W+       +   P +P  +I +T   Y+ 
Sbjct: 231 SSRFWPMDGYAPGQGQ----PSFDKQFVRDWLEQIGFNKQPPAPHLPLEVIEKTRDKYLE 286

Query: 285 AYEKITG 291
           AYE++TG
Sbjct: 287 AYERLTG 293


>gi|326442334|ref|ZP_08217068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces clavuligerus ATCC 27064]
          Length = 300

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/301 (28%), Positives = 152/301 (50%), Gaps = 27/301 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  I +A+DR+SA+D  +   IP KG VL +++ +WF  
Sbjct: 12  QVPGLLHLHTGKVRDLYRNEAGDLIMVASDRISAYDWVLPSEIPDKGRVLTRLSLWWFDR 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  +H +    P           LV + L+M P+E + RGYL G+            
Sbjct: 72  LADLVPHHVVSTDLPDGAPADWEGRTLVCRSLRMVPVECVARGYLTGSGLVEYDE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ +SD  +LP P+ TP TK++      D+ ++  E+  +  +       +
Sbjct: 127 SRTVCGITLPEGLSDGSELPAPIFTPATKAAVG--DHDENVTYEEVARQ--VGAETAAVL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + G+IL D+K+EFG  +   +++ADE+ TPDSSR+W   +++  
Sbjct: 183 RQTTLAVYGRARDIARDRGIILADTKFEFGHTEDGTLVIADEVLTPDSSRFWPAASWQPG 242

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+         R     P +P+ ++  T   Y+ AYE +TG  
Sbjct: 243 RPQ----PSYDKQYVRDWLTSPASGWDRRGEQPPPALPDEVVAATRAKYLEAYEMLTGTP 298

Query: 294 F 294
           +
Sbjct: 299 W 299


>gi|269926127|ref|YP_003322750.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789787|gb|ACZ41928.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 296

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/309 (27%), Positives = 147/309 (47%), Gaps = 31/309 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           + +++  +P +   + GKVR+ Y L D   + +ATDR+SAFD  +   IP KG+VL+QI+
Sbjct: 3   KAVTETNLPGINLIHRGKVRDTYDLGDS-LLMVATDRISAFDWVLPTPIPDKGKVLSQIS 61

Query: 61  QYWFHHTSDICSNHTL--------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
            +WF   +DI  NH +              D      ++ ++      E +VRGY+ G+ 
Sbjct: 62  VFWFEKLADIVPNHFITDDINNYSHLLPYSDVLRGRSMIVKKANRIDYECVVRGYITGSG 121

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                      +  +    +P+ + D  KLP P+ TP  K+ E     D+ I+    I  
Sbjct: 122 WAEYKK-----QGTVAGKPMPEGLRDGDKLPEPIFTPARKNEEG---HDENITYE--ILE 171

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +  +    +   ++ L++ G   A   G+I+ D+K+EFG      + L DE+ TPDSS
Sbjct: 172 SEVGSDLASQLRDISIQLYQDGRDYAETRGVIIADTKFEFGF-VDGQLTLIDELLTPDSS 230

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W    Y      G +   LDK ++R+W+           P++P+ ++  T Q Y+ AY
Sbjct: 231 RFWLESEYRP----GESLPSLDKQYVRDWLTQSGWDKNSQPPELPDEVVEATRQRYLEAY 286

Query: 287 EKITGLKFI 295
             +TG +  
Sbjct: 287 RMLTGKELE 295


>gi|320169740|gb|EFW46639.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capsaspora owczarzaki ATCC 30864]
          Length = 299

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 87/310 (28%), Positives = 157/310 (50%), Gaps = 31/310 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +P L     GKVR+ Y + D + + +ATDR+SAFD  +   IP KG++LNQI
Sbjct: 1   MSALVESNLPALTLLARGKVRDVYRIDDKSLLFVATDRISAFDVVMNNGIPGKGKILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           + +WF    ++   H +               D  +   ++ + L M PIE IVRGY+AG
Sbjct: 61  SLFWFDLLKEVVPCHLITAEIDEMPEVVRQYRDQLEGRSMLVRSLNMLPIESIVRGYVAG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               I    LP  ++++ +LP  + TP+TK+       D+ I P++  
Sbjct: 121 SGWKEYQQ-----SNTICGIALPAGLTESARLPQALFTPSTKAELG--THDENIHPDKAA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTP 223
               + ++  + +++ AL L+ +  + AL  G+I+ D+K+EFGI  + N ++  + + TP
Sbjct: 174 EM--IGKDLADRMAATALELYTKASEYALTRGIIIADTKFEFGIHPETNALILGDEVLTP 231

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W  + Y     +       DK ++R+++ +     +D +  +PE+++  T   Y 
Sbjct: 232 DSSRFWPKDKYATGRAQ----DSYDKQYVRDYLESIKFNKKDPV-TLPEDVVQNTLAKYQ 286

Query: 284 AAYEKITGLK 293
             +  +TG K
Sbjct: 287 EVFTILTGRK 296


>gi|254384075|ref|ZP_04999420.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Mg1]
 gi|194342965|gb|EDX23931.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Mg1]
          Length = 300

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 90/301 (29%), Positives = 147/301 (48%), Gaps = 27/301 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y   DG  + +A+DR+SAFD  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYRDEDGNLVMVASDRMSAFDWVLPTEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             D+  NH +    P           L+   L M P+E + RGYL G+            
Sbjct: 72  LRDLVPNHVISTELPAGAPADWAGRTLICTSLDMVPVECVARGYLTGSGLVEYDQ----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + +  +LP P+ TP  K+       D+ +S  E+             +
Sbjct: 127 TRTVCGLALPEGLVNGSELPAPIFTPAAKAEVGE--HDENVSYEEVAR--TTGPETAALL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E G+IL D+K+EFG DK   ++  DE+ TPDSSR+W  + +E  
Sbjct: 183 RQTTLAVYGRARDIARERGIILADTKFEFGFDKDGRLVAGDEVLTPDSSRFWPADQWEPG 242

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+         +     P +P+ ++ +T   Y+ AYE++TGL 
Sbjct: 243 RAQ----PSYDKQFVRDWLASPASGWDRKGELPPPALPQEVVEQTRAKYVEAYERLTGLA 298

Query: 294 F 294
           +
Sbjct: 299 W 299


>gi|317486972|ref|ZP_07945782.1| saicar synthetase [Bilophila wadsworthia 3_1_6]
 gi|316921847|gb|EFV43123.1| saicar synthetase [Bilophila wadsworthia 3_1_6]
          Length = 298

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 92/310 (29%), Positives = 154/310 (49%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M++ +K  I E P    GKVR+ Y + D T + + TDR+SAFD  +   +PYKG +LNQI
Sbjct: 1   MKVTTKTDIKEFPLLNRGKVRDIYDIDDSTLLIVTTDRMSAFDVIMNEPVPYKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTLDYPDP---------------NVLVGQQLQMFPIELIVRGYLAG 104
           T +W    + +  NH ++                     ++ ++ +  P+E IVRGY+ G
Sbjct: 61  TLFWMKKFAHLVKNHLIESDVDKFPAALAPYREELEGRSVLVKKAKPLPVECIVRGYITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  Y LP+ + ++ +L  P+ TP+TK+       D+ IS     
Sbjct: 121 SGWKDY-----KATGSVCGYKLPEGLLESARLEQPLFTPSTKAELGE--HDENISTAR-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              IL ++  + I + AL+LF+ G   A   G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AAEILGKDIADQIENIALALFKEGRAWAESRGIIIADTKFEFGM-VDGELILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y+    +       DK ++R+W+  +        P +P+ ++  T   Y+ 
Sbjct: 231 SSRFWPAEGYKAGQSQ----PSFDKQYLRDWLSGQPWDKTPPPPALPKEVVEATQNKYLE 286

Query: 285 AYEKITGLKF 294
           AY  +TG + 
Sbjct: 287 AYRILTGSEL 296


>gi|187927594|ref|YP_001898081.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           pickettii 12J]
 gi|187724484|gb|ACD25649.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           pickettii 12J]
          Length = 307

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 147/312 (47%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG VL Q++
Sbjct: 8   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGRVLAQMS 67

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF+    I   H              +D      +V ++L+   +E +VRGYLAG+  
Sbjct: 68  DFWFNKLRHIVPTHETGIAPETVVAPNEVDQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    L   + + QKLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 128 KDY-----QATGAVCGVHLAPGLQNAQKLPEPIFTPAAKAEMGE--HDENISFDEVERR- 179

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 180 -IGPDLAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 238

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P ++I +T+  Y
Sbjct: 239 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPADVIEKTADKY 294

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 295 REALTRLTGESL 306


>gi|212702427|ref|ZP_03310555.1| hypothetical protein DESPIG_00444 [Desulfovibrio piger ATCC 29098]
 gi|212674088|gb|EEB34571.1| hypothetical protein DESPIG_00444 [Desulfovibrio piger ATCC 29098]
          Length = 298

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 96/310 (30%), Positives = 150/310 (48%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           MRI +K  I   P    GKVR+ Y + D T + + TDR+SAFD  +   IPYKG +LNQI
Sbjct: 1   MRITTKTEISAYPLLSRGKVRDIYDIDDKTLLIVTTDRMSAFDVIMDKPIPYKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTLDYPDP---------------NVLVGQQLQMFPIELIVRGYLAG 104
           T +W     DI  NH ++                     ++ ++ +  P+E IVRGY++G
Sbjct: 61  TLFWMDKFKDIIPNHLVESDVDRFPAALAPWKDELEGRAVLVRKAKPLPVECIVRGYISG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  Y LP  M ++ KL   + TP+TK+       DQ IS +E  
Sbjct: 121 SGWKDYQK-----TGTLCGYQLPAGMRESDKLETALFTPSTKAELGQ--HDQNISADEAA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
               L  N    +    L+++E G   A   G+I+ D+K+EFG      + L DE+ TPD
Sbjct: 174 RL--LGENVARKVQETTLAIYEAGRAYAASRGIIVADTKFEFGF-VDGELRLIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + YE    +       DK ++R+W+ ++    +   P +P  ++  T++ Y  
Sbjct: 231 SSRFWPADQYEPGRSQ----PSFDKQYLRDWLTSQPWDMQPPAPALPAEVVDATARRYRE 286

Query: 285 AYEKITGLKF 294
           AY  +TG +F
Sbjct: 287 AYHILTGKEF 296


>gi|327481476|gb|AEA84786.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas stutzeri DSM 4166]
          Length = 289

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 87/294 (29%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KG++L  I+ +WF     
Sbjct: 8   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILAEPIPEKGKILTAISNFWFDKLKG 67

Query: 70  ICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           +  NH              L   +   +V ++L+   +E IVRGY+ G+           
Sbjct: 68  LIPNHFTGDKVEDVVPADELPLVEGRAVVAKRLKPVAVEAIVRGYIVGSGWKEYQK---- 123

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+ +     
Sbjct: 124 -SGTVCGIQLPAGLKEAAKLPQPIFTPSTKAAVG--DHDENISFEQCEA--IIGKELAAQ 178

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   +++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++YE+
Sbjct: 179 VRDVSIALYSAAVEYAATRGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRFWPADSYEE 238

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+ +     +   P +P  +  +T+  Y  A  ++T
Sbjct: 239 ----GKNPPSFDKQFVRDWLESTGWNKQPPAPAVPAEVAQKTADKYREALTRLT 288


>gi|223997140|ref|XP_002288243.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975351|gb|EED93679.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 377

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 126/296 (42%), Positives = 182/296 (61%), Gaps = 7/296 (2%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           +GKVR+ Y L +     + TDR S FD+ +A +P+KG+VLN  + YWF  T DI  NH L
Sbjct: 86  TGKVRDRYDL-NSKLALVTTDRQSGFDRMLALVPFKGQVLNLTSAYWFEVTKDIVPNHLL 144

Query: 77  DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKL 136
             P PNV V ++   FPIE +VR Y+ G+T TS+   Y++G R    + LPD M  NQKL
Sbjct: 145 SVPHPNVSVVKKCTPFPIEFVVRSYMTGSTSTSIWKNYQDGVRNYCGHDLPDGMKKNQKL 204

Query: 137 PYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENG 196
              ++TPTTK  E     D+PIS  +II  G + +  ++  +  AL++F +G ++A E G
Sbjct: 205 EMTILTPTTKEEE----HDRPISEADIISEGWMKQEDFDVCAKAALAVFAKGQEIAAERG 260

Query: 197 LILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWI 256
           LILVD+KYEFG D+   I L DE++TPDSSRYW  ++Y+    EG  P  +DK+F+R W 
Sbjct: 261 LILVDTKYEFGKDENGVINLIDEVNTPDSSRYWLADSYQTMIAEGKEPENIDKEFLRLWF 320

Query: 257 LTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPLERIRNN 310
              C+PY+D + P+ P+++++  S+ YI  YE ITG  F   D +E    E I+ +
Sbjct: 321 RDNCDPYKDEVLPEAPKDLVVELSRRYIKLYETITGKSFEFQDGAEGAIAEAIQKS 376


>gi|119899163|ref|YP_934376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Azoarcus
           sp. BH72]
 gi|166229528|sp|A1K9I4|PUR7_AZOSB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|119671576|emb|CAL95489.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Azoarcus
           sp. BH72]
          Length = 311

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 95/318 (29%), Positives = 143/318 (44%), Gaps = 38/318 (11%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   L ++ I  LP    GKVR+ Y +     + + +DRLSAFD  +   IP KG VL  
Sbjct: 1   MATPLFESTIKSLPLLGRGKVRDIYAVDADKLLIVTSDRLSAFDVILPNPIPDKGRVLTA 60

Query: 59  ITQYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGN 105
           +  +WF     I  N                       LV ++L+  PIE +VRGY+ G+
Sbjct: 61  MANFWFAKLGHIVPNQLTGIDPESVVAADEREQVKGRALVVKRLKPLPIEAVVRGYVIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  +    KLP P+ TP +K+       D+ IS  +   
Sbjct: 121 GWKDYQD-----TGAICGIALPAGLKQAAKLPAPIFTPASKAEVG--DHDENISFAQAQA 173

Query: 166 R------------GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN 213
                        G       E     A++L+ +    A   G+I+ D+K+EFGID    
Sbjct: 174 NCDAVLAEALAGTGKTGAGLAEEARQAAIALYSQAADYAAGRGIIIADTKFEFGIDAAGT 233

Query: 214 IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPEN 273
           + L DE  TPDSSR+W  ++Y +    GI+P   DK ++R+++ T     +   PD+P +
Sbjct: 234 LHLIDEALTPDSSRFWPADSYRE----GISPPSYDKQYVRDYLETLDWNKKAPGPDLPAD 289

Query: 274 IILRTSQTYIAAYEKITG 291
           ++ RT+  Y  AYEK+TG
Sbjct: 290 VVERTAAKYREAYEKLTG 307


>gi|149927703|ref|ZP_01915955.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Limnobacter sp. MED105]
 gi|149823529|gb|EDM82759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Limnobacter sp. MED105]
          Length = 298

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 94/310 (30%), Positives = 155/310 (50%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  + +  +  LP  + GKVREN+ + D   + +A+DRLSAFD  +   IP KG VL Q+
Sbjct: 1   MSTVFETKLTSLPLLHRGKVRENFSVGDDKMLIVASDRLSAFDVILDQPIPEKGMVLTQM 60

Query: 60  TQYWFHHTSDICSNHTLD-------------YPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
            Q+WF   +D+  NH                      +V ++L+  PIE +VRGYL G+ 
Sbjct: 61  AQFWFDILADVVPNHLTGISPETVVSAEEAPQIKGRSMVVKKLKALPIEAVVRGYLIGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  M    KL  P+ TP TK++      D+ I  + +   
Sbjct: 121 WKDY-----QATGAVCGIKLPPGMQMAAKLNEPIFTPATKAAMGE--HDENIDFDTMSD- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            ++  +  + I   +++L+ +    A   G+I+ D+K+EFG+D+   + L DE+ T DSS
Sbjct: 173 -VVGSDLAKQIRDVSIALYTKASDYAARQGIIIADTKFEFGLDENGTLTLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAA 285
           R+W  + Y    + GI+P   DK F+R+++ +      +   P +P++II +T+  Y  A
Sbjct: 232 RFWPADQY----QVGISPPSYDKQFVRDYLESVPGWNKKAPAPTLPQDIIDKTAAKYRQA 287

Query: 286 YEKITGLKFI 295
           YE +TG  +I
Sbjct: 288 YEILTGRLWI 297


>gi|297193447|ref|ZP_06910845.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces pristinaespiralis ATCC 25486]
 gi|197718278|gb|EDY62186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces pristinaespiralis ATCC 25486]
          Length = 299

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 87/301 (28%), Positives = 153/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYQNEAGDLVMVASDRMSAYDWVLPTEIPDKGRVLTQLSLWWFER 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             D+  NH +    P           +V + L+M P+E + RGYL G+            
Sbjct: 72  LEDLIGNHVISTELPPGAPADWAGRTMVCKSLRMVPVECVARGYLTGSGLAEYRE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ +SD  +LP P+ TP TK++      D+ +S  E+  +  +       +
Sbjct: 127 SRTVCGLALPEGLSDGSELPAPIFTPATKAAVGE--HDENVSYEEVARQ--VGAETAAHL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + G+IL D+K+EFG D    +++ADE+ TPDSSR+W   +++  
Sbjct: 183 RQSTLAVYSRARDIARDRGIILADTKFEFGFDGDA-LVIADEVLTPDSSRFWPAASWQPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+ +  + +        P +P+ ++  T   Y+ AYE +TG  
Sbjct: 242 RAQ----PSYDKQYVRDWLTSPESGWDRKSEQPPPALPQEVVDATRAKYVEAYELLTGAT 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|253997342|ref|YP_003049406.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera mobilis JLW8]
 gi|253984021|gb|ACT48879.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera mobilis JLW8]
          Length = 300

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 90/306 (29%), Positives = 151/306 (49%), Gaps = 28/306 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L +  I  L   + GKVR+ Y +   T + ++TDRLSAFD  +   I  KG +L Q+  +
Sbjct: 5   LLETSIHSLKRIHQGKVRDIYDIDANTMLLVSTDRLSAFDVILPTGIANKGAMLTQMANF 64

Query: 63  WFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           WF    D+  NH                       +V ++L+  PIE IVRGYL G+   
Sbjct: 65  WFEKLKDVVPNHLTGIEPTSVVTDQAEKAQLANRSVVVKKLKALPIEAIVRGYLVGSGWK 124

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                    K  + +  LP  + +  KLP P+ TP++K++      D+ IS  +      
Sbjct: 125 EY-----KAKGTVCDIPLPAGLQEASKLPAPLFTPSSKAAVGE--HDENISLAQCAAL-- 175

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  +    ++  A++L+ +  + AL  G+I+ D+K+EFG+D+   + + DE+ TPDSSR+
Sbjct: 176 IGEDMAAQVAKAAIALYTQAAEYALTRGIIIADTKFEFGLDENGVLHVMDEVLTPDSSRF 235

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  E+Y      G  P   DK ++R+W+           P +P ++  +TS+ Y+ A+E+
Sbjct: 236 WPAESYI----VGKNPPSYDKQYVRDWLEASGWDKTPPAPALPTDVASKTSEKYMEAFER 291

Query: 289 ITGLKF 294
           +TG   
Sbjct: 292 LTGQPL 297


>gi|17545293|ref|NP_518695.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum GMI1000]
 gi|22001853|sp|Q8Y1W3|PUR7_RALSO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|17427585|emb|CAD14104.1| probable phosphoribosylaminoimidazole-succinocarboxamide synthase
           (saicar synthetase) protein [Ralstonia solanacearum
           GMI1000]
          Length = 302

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 94/312 (30%), Positives = 145/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG VL Q++
Sbjct: 3   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGRVLAQMS 62

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H               D      +V ++L+   +E +VRGYLAG+  
Sbjct: 63  DFWFRKLRHIVPTHETGIAPEAVVQPGEADQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 123 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 175 -IGPELAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 234 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 289

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 290 REALTRLTGETL 301


>gi|319764779|ref|YP_004128716.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans BC]
 gi|330826995|ref|YP_004390298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans K601]
 gi|317119340|gb|ADV01829.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans BC]
 gi|329312367|gb|AEB86782.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans K601]
          Length = 306

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 151/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+ 
Sbjct: 7   SALHTSALTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMA 66

Query: 61  QYWFHHTSDICSNHTLD-------------YPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     +  NH                      ++ ++L+  PIE +VRGYLAG+  
Sbjct: 67  LFWFDKLGHVVPNHLTGEAPESVVTPAEAPQVRGRSMLVKRLKPIPIEAVVRGYLAGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      R +    LPD +++  +LP+ + TP  K++      D+ I+    +   
Sbjct: 127 KEYQE-----SRSVCGVPLPDGLTNAARLPHSIYTPAAKAAMGE--HDENITFERTVEM- 178

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    I   ++ L+E    +AL  G+I+ D+K+EFG+DK   ++L DE+ TPDSSR
Sbjct: 179 -VGPDLAARIRDVSIQLYEAAAAIALAKGMIIADTKFEFGLDKDGTLVLMDEVLTPDSSR 237

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE Y ++   G  P   DK F+R+W+       +        P +P  ++ +T+  Y
Sbjct: 238 YWPVEGYAEALARGENPPSYDKQFVRDWLEQAQVGGKPWNKTAPAPRLPREVVEKTAAKY 297

Query: 283 IAAYEKIT 290
             A +++T
Sbjct: 298 REALQRLT 305


>gi|289644471|ref|ZP_06476548.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           symbiont of Datisca glomerata]
 gi|289505726|gb|EFD26748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           symbiont of Datisca glomerata]
          Length = 371

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 143/307 (46%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 68  LTHEEFAGLTHLGSGKVREMFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLW 127

Query: 63  WFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF   +D+  +H +                      ++ ++L M PIE + R YL G+  
Sbjct: 128 WFDQLADLVPSHVISTDVAEYPDELAPYAEQLRGRSMLCRRLAMVPIECVARSYLTGSGL 187

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       ++  + LP  + D  +LP  + TP+TK+       D+ IS  +     
Sbjct: 188 KDYQR-----TGEVSGHALPAGLVDGSRLPATIYTPSTKAPIGE--HDENISRAQ--AAS 238

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +    LS+FER   +A E G+I+ D+K+EFG D    + L DE+ TPDSSR
Sbjct: 239 QVGSEVAAELEKLTLSIFERAVAVAAERGIIVADTKFEFGHDADGVLRLGDEVLTPDSSR 298

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  E +     +       DK FIR+++ +         P +P  ++  T   Y+ AYE
Sbjct: 299 FWPAEQWRPGGSQ----PSYDKQFIRDYLASTGWDRTAPGPQLPPEVVEATRARYVEAYE 354

Query: 288 KITGLKF 294
           ++TG  F
Sbjct: 355 RLTGTSF 361


>gi|51246354|ref|YP_066238.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Desulfotalea psychrophila LSv54]
 gi|81826771|sp|Q6AK95|PUR7_DESPS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|50877391|emb|CAG37231.1| probable phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Desulfotalea psychrophila LSv54]
          Length = 296

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 91/308 (29%), Positives = 153/308 (49%), Gaps = 31/308 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLS--DGTRITIATDRLSAFDQNIACIPYKGEVLNQI 59
             +     P+L   +SGKVR+ Y +   D   + +ATDR+SA+D  ++ IP KG +L Q+
Sbjct: 3   EAMLTTDFPQLNLVHSGKVRDMYAIPGHDDKLLMVATDRISAYDVILSAIPGKGAILTQL 62

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           + +WF   +DI  NH +               +      ++ ++ +  PIE IVRGY++G
Sbjct: 63  SLFWFDLLADIVDNHMITADVTEYPEACAPYAEQLRGRSILVKRTKPLPIECIVRGYISG 122

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +   +           +  + LP+ M ++ K P P+ TP+TK+       D+ IS   + 
Sbjct: 123 SFWKAYQQ-----DTNVCGFQLPEGMQESDKFPEPIFTPSTKAELG--DHDENISFERMQ 175

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              I+   + E I+  + +L+ R    A   G+I+ D+K+E G +    IIL DE+ TPD
Sbjct: 176 E--IVGVEKAEQIARISKALYTRAADYARTKGVIIADTKFELG-EVDGKIILIDEVLTPD 232

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + YE    +       DK ++R+++ +         P +PE II++T   Y  
Sbjct: 233 SSRFWAADKYEPGKSQ----ESFDKQYLRDYLSSLDWDKNPPAPPLPEEIIVKTKARYDE 288

Query: 285 AYEKITGL 292
           A E+ITG 
Sbjct: 289 AVERITGK 296


>gi|284034540|ref|YP_003384471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kribbella
           flavida DSM 17836]
 gi|283813833|gb|ADB35672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kribbella
           flavida DSM 17836]
          Length = 291

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 88/304 (28%), Positives = 153/304 (50%), Gaps = 21/304 (6%)

Query: 1   MRILSKA-YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           M  L +A  IP   + +SGKVR+ Y L  G  + +A+DR+SAFD  ++  IP KG+VL  
Sbjct: 1   MTTLPQAVDIPGAKHLHSGKVRDLYELESGELLMVASDRISAFDWILSTPIPDKGKVLTA 60

Query: 59  ITQYWFHHT---SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
           ++ +WF      + I S           ++ ++L+MFP+E + RGYL+G           
Sbjct: 61  MSLWWFEQLDVPNHIRSTDVPAEVAGRAVICEKLEMFPVECVARGYLSGTGLLDY----- 115

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
           +   ++    LP  + +  +LP P+ TP TK+       D+ +S + ++    +      
Sbjct: 116 DATGEVCGIPLPSGLVEGSRLPEPIFTPATKADLGE--HDENVSYDAVVA--TVGVETAG 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+++ +   +A ++G++L D+K+EFG      I+LADE+ TPDSSR+W    + 
Sbjct: 172 ALRDLTLAIYAKAHAMAEQHGIVLADTKFEFGARPDGTIVLADEVLTPDSSRFWPAAQWS 231

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
              ++       DK  +R+W+           +  P + + +I RT   Y+ AYE++TG 
Sbjct: 232 PGRQQ----PSYDKQIVRDWLQFESGWDRASGEAPPPLSDEVIERTRSAYVDAYERLTGR 287

Query: 293 KFIA 296
            F A
Sbjct: 288 TFTA 291


>gi|86743048|ref|YP_483448.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. CcI3]
 gi|86569910|gb|ABD13719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. CcI3]
          Length = 303

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 91/307 (29%), Positives = 150/307 (48%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 3   LTHEEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLW 62

Query: 63  WFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF   +D+  +H +               +      ++ ++L M  IE + RGYL G+  
Sbjct: 63  WFDQLADLVPSHVVSSNVDEYPAELTPYTEQLRGRSMLCRRLNMVQIECVARGYLTGSGL 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +  + LP  + D  KLP P+ TP+TK+       D+ IS  +    G
Sbjct: 123 KDYQR-----TGAVSGHPLPTGLVDGSKLPAPIYTPSTKAPIGE--HDENISRAD--AAG 173

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +    L +F R   LA E G++L D+K+EFG D +  + LADE+ TPDSSR
Sbjct: 174 RIGTELAAELERLTLQIFGRASVLAAERGILLADTKFEFGHDTQGTLRLADEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  +T+      G +    DK +IR+++ +         P++P +++  T   Y+ AYE
Sbjct: 234 FWPEDTWRP----GASQPSFDKQYIRDYLTSTGWDRTAPGPELPADVVEATRVRYVEAYE 289

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 290 RLTGISF 296


>gi|299067862|emb|CBJ39073.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum CMR15]
          Length = 312

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 94/312 (30%), Positives = 146/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG+VL Q++
Sbjct: 13  SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGKVLAQMS 72

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H               D      +V ++L+   +E +VRGYLAG+  
Sbjct: 73  DFWFRKLGHIVPTHETGIAPESVVQPGEADQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 132

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 133 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 184

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 185 -IGPELAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 243

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 244 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 299

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 300 REALTRLTGETL 311


>gi|171464115|ref|YP_001798228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193653|gb|ACB44614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 298

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 98/309 (31%), Positives = 148/309 (47%), Gaps = 32/309 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L    I  LP    GKVR+ Y L D   + I TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MAALYATSIKSLPLLSKGKVRDVYTLDDDKLLMITTDRLSAFDVVMGEPIPEKGVVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF+  + +  NH              +D      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  VNFWFNKLASVIPNHLTGIDPATVVVADEVDQVQGRAVVAKRLKPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        K+    LP  + + QKLP P+ TP  K+       D+ IS  +++  
Sbjct: 121 WKDYKE-----TGKVCGIALPAGLENAQKLPEPIFTPAAKAEVGE--HDESISFEKVVEL 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       I   ++ L++   + A   G+I+ D+K+EFG+D    ++L DEI T DSS
Sbjct: 174 --IGEKLANQIREVSIRLYKEASEYATTRGIIIADTKFEFGLDANGQLVLMDEILTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQT 281
           R+W  ETY      G  P   DK F+R+W+ T     +        P +P ++I +T+Q 
Sbjct: 232 RFWPAETYY----VGSNPPSYDKQFVRDWLETAMVDGKLWSKTAPAPQLPADVIEKTAQK 287

Query: 282 YIAAYEKIT 290
           Y  A  ++T
Sbjct: 288 YREALARLT 296


>gi|121997707|ref|YP_001002494.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halorhodospira halophila SL1]
 gi|166229550|sp|A1WVI0|PUR7_HALHL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|121589112|gb|ABM61692.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halorhodospira halophila SL1]
          Length = 295

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 160/301 (53%), Gaps = 27/301 (8%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           +++ +I  LP  +SGKVR+ Y + D   + +ATDRLSAFD  +   IP KG VL +++ +
Sbjct: 7   VAQTHIQSLPLLHSGKVRDIYAVDDERLLIVATDRLSAFDVILPDPIPDKGAVLTRVSNF 66

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQ-------------LQMFPIELIVRGYLAGNTKTS 109
           WF  T+ + +NH LD P  +V+  ++             LQ  P+E IVRGYLAG+   S
Sbjct: 67  WFRKTAHLAANHLLDTPPESVVAPEEADQVRDRGVVVRRLQALPVEAIVRGYLAGSGWQS 126

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                      +    LPD +  + +LP P+ TPTTK++      D+PIS  + + R  +
Sbjct: 127 YQR-----DGTVSGVALPDGLRQSDRLPEPIFTPTTKAAVG--DHDEPISFAQTVER--I 177

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +  E I + AL +F    + A   GLI+ D+K EFG+  +   ++ DE+ TPDSSR+W
Sbjct: 178 GADLAERIRTIALEVFALATEYAESRGLIIADTKLEFGVTPEGEPVIIDELLTPDSSRFW 237

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             + ++     G TP   DK +IR+ +       R   P + +++I +T++ Y  A   +
Sbjct: 238 PADAWQP----GATPPAFDKQYIRDHLEALGWDKRPPAPHLTDDVIRQTAEKYREAERLL 293

Query: 290 T 290
           T
Sbjct: 294 T 294


>gi|91790458|ref|YP_551410.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas sp. JS666]
 gi|122967235|sp|Q122N0|PUR7_POLSJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|91699683|gb|ABE46512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas sp. JS666]
          Length = 302

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 89/308 (28%), Positives = 148/308 (48%), Gaps = 28/308 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            L  + +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KG +L Q+  
Sbjct: 4   ALHTSALTSLPLLARGKVRDNYAVGQDRLLMVASDRLSAFDVILGEPIPGKGALLTQMAL 63

Query: 62  YWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF     +C NH              L       ++ ++L+  P+E +VRGYLAG+   
Sbjct: 64  FWFAKLGHLCPNHLTGEAPESVVTAAELPQVTGRSMLVKRLKPLPVEAVVRGYLAGSGWK 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       +    LP  + +  KLP P+ TP  K+       D+ IS  ++    +
Sbjct: 124 EYQESQ-----SVCGVPLPAGLKNAGKLPEPIFTPAAKAEVGE--HDENISYEQV--EKV 174

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +       I   ++ +++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSRY
Sbjct: 175 VGPELAAQIKKISIEIYKTAAAFALTKGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRY 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYI 283
           W +E YE ++  G+ P   DK F+R+W+       +        P +P +++ +T+  Y 
Sbjct: 235 WPIEGYEAAYAAGLNPPSYDKQFVRDWLEAVRINGKPWDKTPPSPQLPPDVVAKTAAKYQ 294

Query: 284 AAYEKITG 291
            A  ++ G
Sbjct: 295 EALTRLAG 302


>gi|124265485|ref|YP_001019489.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylibium petroleiphilum PM1]
 gi|167011920|sp|A2SCG5|PUR7_METPP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|124258260|gb|ABM93254.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylibium petroleiphilum PM1]
          Length = 300

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 96/312 (30%), Positives = 152/312 (48%), Gaps = 35/312 (11%)

Query: 1   MRI---LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVL 56
           M     L ++ +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KGE+L
Sbjct: 1   MSATTPLLESRLQSLPLLARGKVRDNYAVGSDRLLMVASDRLSAFDVVMGEPIPGKGELL 60

Query: 57  NQITQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLA 103
            ++  +WF     I  NH                      ++ ++L+  P+E +VRGYLA
Sbjct: 61  TRMALFWFARLGHIVPNHLTGDAPESVVSAAERSQVTGRSMLVKRLKPLPVEAVVRGYLA 120

Query: 104 GNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
           G+              ++    LP  + +  KLP P+ TP TK+       D+ I    +
Sbjct: 121 GSGWKEY-----QHNGQVCGVKLPPGLKNASKLPSPIFTPATKAEMGE--HDENIPFERM 173

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTP 223
           +   I+     E +   A++L+E     AL  G+I+ D+K+EFG+D+   + L DE+ TP
Sbjct: 174 VE--IIGAPLAEQVRRVAIALYETAAAFALGKGIIIADTKFEFGLDEAGTLTLMDEVLTP 231

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRT 278
           DSSR+W VE Y +    GI P   DK F+R+W+       R    +   P +P +++ RT
Sbjct: 232 DSSRFWPVEGYAE----GINPPSYDKQFVRDWLEQAVVDGRPWNKQAPAPALPADVVART 287

Query: 279 SQTYIAAYEKIT 290
           +  Y  A E++T
Sbjct: 288 AAKYREALERLT 299


>gi|241662099|ref|YP_002980459.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           pickettii 12D]
 gi|240864126|gb|ACS61787.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           pickettii 12D]
          Length = 307

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 146/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG VL Q++
Sbjct: 8   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGRVLAQMS 67

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF+    I   H              +D      +V ++L+   +E +VRGYLAG+  
Sbjct: 68  DFWFNKLRHIVPTHETGIAPETVVAPDEVDQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    L   + + QKLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 128 KDY-----QATGAVCGVHLAPGLQNAQKLPEPIFTPAAKAEMGE--HDENISFDEVERR- 179

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 180 -IGPDLAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 238

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +        P +P ++I +T+  Y
Sbjct: 239 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWSKTAPAPQLPADVIEKTADKY 294

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 295 REALTRLTGESL 306


>gi|86747828|ref|YP_484324.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris HaA2]
 gi|86570856|gb|ABD05413.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris HaA2]
          Length = 305

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 82/310 (26%), Positives = 143/310 (46%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P LP    GKVR+ Y +     + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTMLSSDLP-LPKIGRGKVRDIYAVDADRLLLVTTDRISAFDVVMAETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPD------------------PNVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FP+E ++RGY
Sbjct: 60  SAWWFDQLGGVVPHHMISADTAEIVDAVPALQDHRATLAGRTMLCRRTTVFPVECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+               +    LP+ + +++ LP P+ +P TK+       D+ I+  
Sbjct: 120 ITGSAWKEY-----AATGTLAGEPLPEGLQESEHLPAPIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R I+      T+ S   +++ +G  +A E G+I+ D+K+EFG D    IIL DE+ 
Sbjct: 172 RM--RAIVGDEDAYTLESMTRAVYTQGEAIAREQGIIIADTKFEFGRDADGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  + Y+    +        +D +               P +P+ ++  TS  
Sbjct: 230 TPDSSRFWAADAYQPGRPQPSFDKQPLRDHLDAERRAGRWNGEAPPPKLPDVVVAATSAR 289

Query: 282 YIAAYEKITG 291
           Y+ AY ++TG
Sbjct: 290 YLDAYRRLTG 299


>gi|300705063|ref|YP_003746666.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum CFBP2957]
 gi|299072727|emb|CBJ44080.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum CFBP2957]
          Length = 329

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 145/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG+VL Q++
Sbjct: 30  SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGKVLAQMS 89

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H                      +V ++L+   +E +VRGYLAG+  
Sbjct: 90  DFWFRKLRHIVPTHETGIAPESVVQPGEAGQVHGRAIVVKRLKPILVEAVVRGYLAGSGW 149

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 150 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 201

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 202 -IGPELAAQIRDVSIRLYKEAADFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 260

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 261 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 316

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 317 REALTRLTGETL 328


>gi|207728034|ref|YP_002256428.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar
           synthetase) protein [Ralstonia solanacearum MolK2]
 gi|206591278|emb|CAQ56890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar
           synthetase) protein [Ralstonia solanacearum MolK2]
          Length = 308

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 145/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG+VL Q++
Sbjct: 9   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGKVLAQMS 68

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H                      +V ++L+   +E +VRGYLAG+  
Sbjct: 69  DFWFRKLRHIVPTHETGIAPESVVQPGEAGQVHGRAIVVKRLKPILVEAVVRGYLAGSGW 128

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 129 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 181 -IGPELAAQIRDVSIRLYKEAADFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 239

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 240 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 295

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 296 REALTRLTGETL 307


>gi|120603222|ref|YP_967622.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris DP4]
 gi|120563451|gb|ABM29195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris DP4]
          Length = 298

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 152/310 (49%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M++++   I E P    GKVR+ Y + + T + + TDR+SAFD  +   IPYKG +LNQI
Sbjct: 1   MQVVTSTDIKEYPLRSRGKVRDIYDIDESTLLIVTTDRMSAFDVIMNEPIPYKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W    + +  NH +               D  +   ++ ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDRFAGLVKNHLVERDVDRFPAPLQAYRDMLEGRAVLVRKAKPLPIECIVRGHITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  Y LP  + ++ KL   + TP+TK+       D+ I+  +  
Sbjct: 121 SGWKDY-----KSSGTVCGYSLPAGLLESAKLEKALFTPSTKAELGE--HDENITLAQ-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              +L ++  + +   AL +F +G + A   G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AEAMLGKDLLDKVERLALDIFTQGREYAEGRGIIIADTKFEFGL-VDGELILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W    Y     +       DK ++R+W+  +        P +P ++I  T + Y+ 
Sbjct: 231 SSRFWPAAGYTPGKGQ----PSFDKQYLRDWLSAQPWDKTPPPPALPADVIAETRKKYLE 286

Query: 285 AYEKITGLKF 294
           AYE +TG   
Sbjct: 287 AYEILTGRTL 296


>gi|316932028|ref|YP_004107010.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris DX-1]
 gi|315599742|gb|ADU42277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris DX-1]
          Length = 305

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 83/314 (26%), Positives = 148/314 (47%), Gaps = 30/314 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P L     GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTMLSSDLP-LTKIGRGKVRDIYAVDDDRLLLVTTDRISAFDVVMGETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAWWFDQLGGVVPHHMISADTDEIIAAVPALSEHRAVIAGRTMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+               +    L + ++++++L  P+ +P TK+       D+ I+  
Sbjct: 120 ITGSAWKEY-----AASGTLAGEKLAEGLTESERLVPPIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R I+  +   T+ S   +++ +G ++A E G+I+ D+K+EFG D+   IIL DE+ 
Sbjct: 172 RM--REIIGDDDAYTLESMTRAVYTQGEEIAREQGIIIADTKFEFGRDQDGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  +TY     +        +D++               P +P  I+  TS+ 
Sbjct: 230 TPDSSRFWAADTYTPGRPQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAEIVEATSKR 289

Query: 282 YIAAYEKITGLKFI 295
           Y+ AY  +TG + +
Sbjct: 290 YLEAYRLLTGTELV 303


>gi|319788093|ref|YP_004147568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317466605|gb|ADV28337.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 317

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 94/324 (29%), Positives = 148/324 (45%), Gaps = 47/324 (14%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLS-------------------DGTRITIATDRLSAF 42
             L ++ +P LP  + GKVR+ + L                    DG  + +ATDRLSAF
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDLPRECIPEAALAAAGPGAVSADGYLLMVATDRLSAF 62

Query: 43  DQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQ 87
           D  +   IP KGE+L QI+ +WF  T+ +  NH                       +V +
Sbjct: 63  DVVLPDPIPGKGEMLCQISNFWFGKTAHLMPNHLTGIDVAAVLPEGVDPALYAKRAVVTR 122

Query: 88  QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKS 147
           +L+  P+E I RGYL G+              K+    LP  +   ++LP P+ TP+TK+
Sbjct: 123 KLKPVPVEAIARGYLIGSGWKDYQR-----TGKVSGIALPPGLRQAEQLPEPIFTPSTKA 177

Query: 148 SESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFG 207
           +      D+ I  + ++    +  +  E +    L L+      A E G++L D+K+EFG
Sbjct: 178 AVG--DHDENIDFDAMVR--AVGADLAERVRDATLRLYRFAAAYAAERGILLADTKFEFG 233

Query: 208 IDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI 267
            D    + + DE+ TPDSSRYW  + Y    + G +P   DK  +R+++ T         
Sbjct: 234 TDADGRLYIMDEMLTPDSSRYWPADEY----QVGTSPPSYDKQIVRDYLETLDWGKTPPG 289

Query: 268 PDIPENIILRTSQTYIAAYEKITG 291
           P +P  +I RT   Y  A +K+ G
Sbjct: 290 PTLPAEVIERTRARYAEALQKLAG 313


>gi|298528260|ref|ZP_07015664.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511912|gb|EFI35814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 304

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 93/310 (30%), Positives = 157/310 (50%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M+++++  I E P    GKVR+ Y L   T + + TDR+SAFD  ++  IPYKG VLNQI
Sbjct: 1   MQVVTQTSITEFPLISRGKVRDIYELDPDTLLIVTTDRMSAFDVVMSQPIPYKGAVLNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH +               +      ++ ++    PIE IVRGY+ G
Sbjct: 61  TLFWMDMFKDLVDNHLISSNVEDFPEPLKPYSEELRGRSVMVRRAAPLPIECIVRGYITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              ++  Y LP  + ++QKL  P+ TP+TK+       D+ I   +  
Sbjct: 121 SGWKDYQR-----TGQVCGYTLPQGLVESQKLEEPLFTPSTKAEAG--AHDENIDMKQAG 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            +  + +   + +   +LS++ +  + A + G+++ D+K+EFG  +   I+L DE+ TPD
Sbjct: 174 EK--IGQEMLQQVQELSLSIYGQAREYAEKKGILIADTKFEFGT-RDGRIMLIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  +TY+    +       DK ++R+W+           PD+PE II  T++ Y+ 
Sbjct: 231 SSRFWPADTYKPGQGQSS----FDKQYLRDWLERSGWNKNPPPPDLPEEIINETTKKYLL 286

Query: 285 AYEKITGLKF 294
           AY+ +TG   
Sbjct: 287 AYKLLTGKDL 296


>gi|111226001|ref|YP_716795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           alni ACN14a]
 gi|111153533|emb|CAJ65290.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Frankia alni ACN14a]
          Length = 303

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 89/307 (28%), Positives = 150/307 (48%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 3   LTHEEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLW 62

Query: 63  WFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF   SD+  +H +               +      ++ ++L M  IE + RGYL G+  
Sbjct: 63  WFDQLSDLVPSHVISSNVDEYPAELAPYTEQLRGRSMLCRRLDMVLIECVARGYLTGSGL 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +  + LP  + D  +LP  + TP+TK+       D+ IS  +    G
Sbjct: 123 KDYQR-----TGAVSGHPLPAGLVDGSRLPSTIYTPSTKAPIGE--HDENISRAD--AAG 173

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +    L +F R   LA E G++L D+K+EFG D +  + LADE+ TPDSSR
Sbjct: 174 RVGAELAAELERLTLQIFGRASDLAAERGILLADTKFEFGHDAEGTLRLADEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  +T+     +       DK +IR+++ +      +  P++P++++  T   Y+ AYE
Sbjct: 234 FWPEDTWSPGVSQ----PSFDKQYIRDYLTSTGWDRTEPGPELPDHVVEATRARYVEAYE 289

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 290 RLTGISF 296


>gi|84497661|ref|ZP_00996483.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janibacter sp. HTCC2649]
 gi|84382549|gb|EAP98431.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janibacter sp. HTCC2649]
          Length = 327

 Score =  255 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 147/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLS--DGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWF 64
            +P   + YSGKVR+ Y     D   + +A+DR+SAFD  +   IP KG VL Q++ +WF
Sbjct: 42  EVPGFTHVYSGKVRDLYEPDGRDDQLLLVASDRISAFDFILDPPIPDKGAVLTQLSLWWF 101

Query: 65  HHTSDICSNHTLDYPD-----PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
              +D+  NH +            ++ ++L M P+E + R YL G               
Sbjct: 102 DQLADLVPNHVVSVDVPEVVAGRAVLVRKLDMVPVECVARAYLTGGGLREY-----AADG 156

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP  + D  +   P+ TP+TK+       D+P++   +     +      T+  
Sbjct: 157 TVSGLSLPGGLRDGDRFEAPLFTPSTKAPMGE--HDEPMTYEAVEAE--VGPELAATLRD 212

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
               +  RG ++A E G+++ D+K EFGID    +ILADE+ TPDSSR+W  + +E    
Sbjct: 213 LTTRILSRGNEIAGERGILIADTKVEFGIDGDGTLILADEVLTPDSSRFWPADQWEPGHT 272

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK+F+R W+L+  + +     +  P +P  ++ RT   Y+ AYE++TG  F
Sbjct: 273 Q----PSFDKEFVREWLLSPESGWDKSSGEAPPALPAEVVERTRAKYVEAYERLTGKTF 327


>gi|207742430|ref|YP_002258822.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar
           synthetase) protein [Ralstonia solanacearum IPO1609]
 gi|206593820|emb|CAQ60747.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar
           synthetase) protein [Ralstonia solanacearum IPO1609]
          Length = 308

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 145/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG+VL Q++
Sbjct: 9   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGKVLAQMS 68

Query: 61  QYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H                      +V ++L+   +E +VRGYLAG+  
Sbjct: 69  DFWFRKLRHIVPTHETGIAPESVVQPGEAGQVLGRAIVVKRLKPILVEAVVRGYLAGSGW 128

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 129 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 181 -IGPELAAQIRDVSIRLYKEAADFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 239

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 240 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 295

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 296 REALTRLTGETL 307


>gi|83746074|ref|ZP_00943129.1| Hypothetical Protein RRSL_04103 [Ralstonia solanacearum UW551]
 gi|83727257|gb|EAP74380.1| Hypothetical Protein RRSL_04103 [Ralstonia solanacearum UW551]
          Length = 329

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 93/312 (29%), Positives = 145/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG+VL Q++
Sbjct: 30  SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGKVLAQMS 89

Query: 61  QYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H                      +V ++L+   +E +VRGYLAG+  
Sbjct: 90  DFWFRKLRHIVPTHETGIAPESVVQPGEAGQVLGRAIVVKRLKPILVEAVVRGYLAGSGW 149

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 150 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 201

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 202 -IGPELAAQIRDVSIRLYKEAADFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 260

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 261 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGQPWPKTAPAPQLPADIIEKTADKY 316

Query: 283 IAAYEKITGLKF 294
             A  ++TG   
Sbjct: 317 REALTRLTGETL 328


>gi|319442486|ref|ZP_07991642.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium variabile DSM 44702]
          Length = 299

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 92/299 (30%), Positives = 160/299 (53%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + E  ++ +GKVRE Y + D T + +ATDR+SA+D  +   IP KG VL  ++ ++F  
Sbjct: 4   DLSEYTHFSAGKVREIYEIDDATLLMVATDRISAYDYVLDTDIPDKGRVLTAMSDFFFDA 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      +V ++L+M P E +VRGYL G+              
Sbjct: 64  LDFPNHLAGSADDERIPEKVLGRAMVCRKLEMLPFECVVRGYLTGSGLKEYRE-----NG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ +++  KLP P+ TP TK+       D+ +S + ++    L + + E +  
Sbjct: 119 TVCGVELPEGLTEASKLPEPLFTPATKAEIG--DHDENVSFDRVVAD--LGQERAEQLRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            ++S++ +   +A E+G+IL D+K+EFG+D + N++L DE+ TPDSSRYW  +TYE+   
Sbjct: 175 ASISIYSQAAAIAAEHGIILADTKFEFGLDAEGNLVLGDEVLTPDSSRYWPADTYEE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +    +   P++P +++  T + YI AYE+I+G +F
Sbjct: 232 -GKVQPSFDKQYVRNWLTGPKSGWDIKSQTPPPELPGSVVEATRERYIEAYERISGNRF 289


>gi|163857911|ref|YP_001632209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella petrii DSM 12804]
 gi|229485666|sp|A9HZF7|PUR7_BORPD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|163261639|emb|CAP43941.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella petrii]
          Length = 293

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 87/302 (28%), Positives = 145/302 (48%), Gaps = 27/302 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHQSSIKSLPLLGRGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W +  + I  NH              LD      +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLNKLAHILPNHSTGVRPEDVVAPDELDQVRGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    KLP P+ TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QATGAVCGIALPAGLQQASKLPQPIFTPAAKAEFGM--HDENVDFAHVVRE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLRLYTEAAQFAATKGIIIADTKFEFGLDDDGTLYLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R GI+P   DK F+R+W+ T+        P +P+ ++ +T+  Y  A +
Sbjct: 234 FWPADGY----RVGISPPSFDKQFVRDWLETQDWDKTPPAPRLPQEVLQKTAAKYREALD 289

Query: 288 KI 289
           ++
Sbjct: 290 RL 291


>gi|330504104|ref|YP_004380973.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina NK-01]
 gi|328918390|gb|AEB59221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina NK-01]
          Length = 289

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 88/294 (29%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KG++L  I+ +WF   +D
Sbjct: 8   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDIILEQPIPEKGKILTAISNFWFDKLAD 67

Query: 70  ICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           +  NH              L   +   +V ++L+   +E IVRGY+ G+           
Sbjct: 68  VVPNHFTGDKVEDVVSAAELPLVEGRAVVAKRLKPVAVEAIVRGYIVGSGWKEYQK---- 123

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+       
Sbjct: 124 -SGTVCGIALPAGLKEAAKLPQPIFTPSTKAAVG--DHDENISFEQCEA--IIGAELAAK 178

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++Y +
Sbjct: 179 VRDTAIKLYTTAVEYAATRGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRFWPADSYAE 238

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+ +     +   P +P  +  +T+  Y  A  ++T
Sbjct: 239 ----GSNPPSFDKQFVRDWLESTGWNKQPPAPAVPTEVAQKTADKYREALTRLT 288


>gi|78356054|ref|YP_387503.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78218459|gb|ABB37808.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 298

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 90/310 (29%), Positives = 150/310 (48%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+I++K  I E      GKVR+ Y +   T + + TDR+SAFD  +   IPYKG +LN I
Sbjct: 1   MQIVTKTDIAEYKLLSRGKVRDIYEVDAETLLIVTTDRMSAFDVIMGEPIPYKGVILNSI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W    +D+  NH +               D  +   ++ ++    P+E IVRG++ G
Sbjct: 61  TLFWMERFADLVPNHLIASDVKDFPQALHKYADMLEGRAVLVRKAAPLPVECIVRGHITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++ KL  P+ TP+TK+       D+ IS     
Sbjct: 121 SGWKDYQK-----TGMVCGHSLPAGLVESAKLETPLFTPSTKAELGE--HDENISVQR-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            R ++  +    I   ++ +F +G + A   G+I+ D+K+EFGI     +IL DE+ TPD
Sbjct: 172 ARELVGDDVAAQIERLSIEIFSKGREYAESRGIIIADTKFEFGII-DGAVILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W V+ Y+    +       DK ++R+W+  +        P +P+++I  T   Y  
Sbjct: 231 SSRFWPVQGYQPGKSQ----PSFDKQYLRDWLSAQDWDKTPPAPALPQDVITETRNKYAE 286

Query: 285 AYEKITGLKF 294
           AY  +TG   
Sbjct: 287 AYSILTGKTL 296


>gi|46579208|ref|YP_010016.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|46448621|gb|AAS95275.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311233042|gb|ADP85896.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio vulgaris RCH1]
          Length = 298

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 90/310 (29%), Positives = 153/310 (49%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M++++   I E P    GKVR+ Y + + T + + TDR+SAFD  +   IPYKG +LNQI
Sbjct: 1   MQVVTSTDIKEYPLRSRGKVRDIYDIDESTLLIVTTDRMSAFDVIMNEPIPYKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W    + +  NH +               D  +   ++ ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDRFAGLVKNHLVERDVDRFPAPLQAYRDMLEGRAVLVRKAKPLPIECIVRGHITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              K+  Y LP  + ++ KL   + TP+TK+       D+ I+  +  
Sbjct: 121 SGWKDY-----KSSGKVCGYSLPAGLLESAKLEKALFTPSTKAELGE--HDENITLAQ-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              +L ++  + +   AL +F +G + A   G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AETMLGKDLLDKVERLALDIFTQGREYAEGRGIIIADTKFEFGL-VDGELILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W    Y     +       DK ++R+W+  +        P +P ++I  T + Y+ 
Sbjct: 231 SSRFWPAAGYAPGKGQ----PSFDKQYLRDWLSAQPWDKTPPPPALPADVIAETRKKYLE 286

Query: 285 AYEKITGLKF 294
           AYE +TG   
Sbjct: 287 AYEILTGRTL 296


>gi|298368479|ref|ZP_06979797.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298282482|gb|EFI23969.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 287

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 93/304 (30%), Positives = 146/304 (48%), Gaps = 33/304 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +       L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI
Sbjct: 1   MSAI------SLKKIYSGKVRDLYEIDDKRILMVASDRLSAFDVILDDPIPGKGEILTQI 54

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF   + I  NH                  +   +V ++L    +E IVRGYLAG+ 
Sbjct: 55  SNFWFRKLAHIMPNHFTGDTVYDVLPESEAMALEKRAVVVKKLTPVKVEAIVRGYLAGSG 114

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ + ++Q+LP  V TP+TK++      D+ IS  E    
Sbjct: 115 WKDYRK-----TGAVCGIKLPEGLQESQQLPEAVFTPSTKAAVG--DHDENISFEECER- 166

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ +     + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSS
Sbjct: 167 -IIGKELAAEVRAKAIRLYTEAAEYAKSRGIIICDTKFEFGVDENGTLTLMDEVLTPDSS 225

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W    Y    + G  P   DK F+R+W+       +   P +P ++I +T   Y  A 
Sbjct: 226 RFWPAGQY----QVGTNPPSFDKQFVRDWLEQSGWNKQAPAPKVPADVIQKTIDKYREAL 281

Query: 287 EKIT 290
             +T
Sbjct: 282 HLLT 285


>gi|254448924|ref|ZP_05062379.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium HTCC5015]
 gi|198261461|gb|EDY85751.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium HTCC5015]
          Length = 293

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 84/302 (27%), Positives = 148/302 (49%), Gaps = 27/302 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
            L ++ I  LP    GKVR+ Y   +   + + +DR+SAFD  +   +P KG  L ++ +
Sbjct: 4   ALYESQIQSLPLIAKGKVRDIYQADEDHLLIVTSDRISAFDVILPQAVPGKGRTLTEVAR 63

Query: 62  YWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF  +  I  NH              + +     ++ ++L   PIE +VRGY+ G+   
Sbjct: 64  FWFERSEHIVPNHLSNRPLSDYLSEEEIQHLGGRGMLVKKLNALPIEAVVRGYIIGSGWK 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       I    LP+ +   ++LP  + TP TK+       D+ IS +      +
Sbjct: 124 DY-----QATGAICGIELPEGLQLAEQLPDVIFTPATKAEVG--DHDENISFDR--AADL 174

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +     E +   ++ L+    + A E G+I+ D+K+EFG+D ++ ++L DE  TPDSSR+
Sbjct: 175 VGPELAEQVRDVSIRLYREAAEYARERGIIIADTKFEFGLDDQRQLVLIDEALTPDSSRF 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  + Y    R GI+P   DK ++R+++ T         P++PE+++  T+  Y  A E+
Sbjct: 235 WPADEY----RVGISPPSFDKQYVRDYLETLDWDKTAPGPELPESVLEGTAARYREAAER 290

Query: 289 IT 290
           +T
Sbjct: 291 LT 292


>gi|260903923|ref|ZP_05912245.1| phosphoribosylamine--glycine ligase [Brevibacterium linens BL2]
          Length = 780

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 91/305 (29%), Positives = 143/305 (46%), Gaps = 29/305 (9%)

Query: 8   YIPELPNYYSGKVRENYFLS-------DGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
            +P   + YSGKVR+ Y              + +A+DR+SA+D  +   IP KG VL  +
Sbjct: 489 ELPGWTHVYSGKVRDLYIPDTAADAASAEQLLMVASDRISAYDWVLDSEIPDKGRVLTGL 548

Query: 60  TQYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + +WF   SD+  NH +    P       L+ + L M PIE + RGYL G+         
Sbjct: 549 SLWWFDQLSDVIGNHVISSDVPQAVAGRGLIVKNLSMLPIECVARGYLTGSGMADY---- 604

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
                 +    LP  + +  +L   + TP TK+       D+ +S  +I     +     
Sbjct: 605 -KATGSVCGIQLPAGLIEADRLEPAIFTPATKAELG--DHDENVSFAQITE--TIGAEAA 659

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           E      + +++R   +A E G+IL D+K+EFG      ++L DE+ TPDSSR+W+ E+Y
Sbjct: 660 EQARDLTIEIYQRAEAIARERGIILADTKFEFGTLPDGTMVLGDEVLTPDSSRFWDAESY 719

Query: 235 EKSFREGITPIGLDKDFIRNWI-LTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITG 291
           E    +       DK F+R+W+              P +P  ++ +T   YI A+EK+TG
Sbjct: 720 EAGQAQAS----FDKQFVRDWLTKESGWDKSSDTPPPALPAEVVEKTRARYIEAFEKLTG 775

Query: 292 LKFIA 296
            KF A
Sbjct: 776 QKFPA 780


>gi|223997142|ref|XP_002288244.1| succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Thalassiosira pseudonana CCMP1335]
 gi|220975352|gb|EED93680.1| succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Thalassiosira pseudonana CCMP1335]
          Length = 330

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 126/296 (42%), Positives = 182/296 (61%), Gaps = 7/296 (2%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           +GKVR+ Y L +     + TDR S FD+ +A +P+KG+VLN  + YWF  T DI  NH L
Sbjct: 39  TGKVRDRYDL-NSKLALVTTDRQSGFDRMLALVPFKGQVLNLTSAYWFEVTKDIVPNHLL 97

Query: 77  DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKL 136
             P PNV V ++   FPIE +VR Y+ G+T TS+   Y++G R    + LPD M  NQKL
Sbjct: 98  SVPHPNVSVVKKCTPFPIEFVVRSYMTGSTSTSIWKNYQDGVRNYCGHDLPDGMKKNQKL 157

Query: 137 PYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENG 196
              ++TPTTK  E     D+PIS  +II  G + +  ++  +  AL++F +G ++A E G
Sbjct: 158 EMTILTPTTKEEE----HDRPISEADIISEGWMKQEDFDVCAKAALAVFAKGQEIAAERG 213

Query: 197 LILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWI 256
           LILVD+KYEFG D+   I L DE++TPDSSRYW  ++Y+    EG  P  +DK+F+R W 
Sbjct: 214 LILVDTKYEFGKDENGVINLIDEVNTPDSSRYWLADSYQTMIAEGKEPENIDKEFLRLWF 273

Query: 257 LTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPLERIRNN 310
              C+PY+D + P+ P+++++  S+ YI  YE ITG  F   D +E    E I+ +
Sbjct: 274 RDNCDPYKDEVLPEAPKDLVVELSRRYIKLYETITGKSFEFQDGAEGAIAEAIQKS 329


>gi|256828123|ref|YP_003156851.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfomicrobium baculatum DSM 4028]
 gi|256577299|gb|ACU88435.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfomicrobium baculatum DSM 4028]
          Length = 299

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 99/313 (31%), Positives = 158/313 (50%), Gaps = 30/313 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M+I++K  I E P    GKVR+ Y +   T + + TDR+SAFD  +   IPYKG VLNQI
Sbjct: 1   MKIVTKTKIREFPLLSRGKVRDIYEIDPQTLLIVTTDRMSAFDVIMNEPIPYKGVVLNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+ +NH L               D  +   +V ++ +  PIE IVRGYL G
Sbjct: 61  TLFWMDAFKDLAANHLLATDVRDFPAALAPYADELEGRAVVVRKAKPLPIECIVRGYLTG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  Y LP  + D+ KL  P+ TP+TK+       D+ I+  +  
Sbjct: 121 SGFKDY-----KATGSVCGYKLPTGLVDSAKLETPLFTPSTKADLG--AHDENITLAD-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            +  +     + I   +L+++ RG  LA + G+I+ D+K+EFG+++K +I+L DE+ TPD
Sbjct: 172 AKSRIGEGLLKKIQELSLAIYSRGRDLAAQRGIIIADTKFEFGLNEK-DILLIDEVMTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + Y     +       DK ++R+W+ +         P +P  +I  T + Y+ 
Sbjct: 231 SSRFWPADRYVPGQSQ----PSFDKQYLRDWLSSTEWDKTPPPPALPAEVIAETQKKYLE 286

Query: 285 AYEKITGLKFIAD 297
           A+E +TG      
Sbjct: 287 AFELLTGSPLQLP 299


>gi|323451545|gb|EGB07422.1| hypothetical protein AURANDRAFT_27954 [Aureococcus anophagefferens]
          Length = 344

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 125/283 (44%), Positives = 175/283 (61%), Gaps = 7/283 (2%)

Query: 15  YYSGKVRENY--FLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICS 72
            Y+GKVR+ Y    +    +  AT R SAFD+ +A +P+KG VLNQ++ +WF  T  I  
Sbjct: 43  VYNGKVRDVYSPACAPRHVVLCATGRQSAFDRALAVVPFKGSVLNQVSAWWFAETRSITP 102

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           NH +  P P+ +V ++ + FPIE +VRGY+ G+T TS+ T YK G R      LPD +  
Sbjct: 103 NHVVAAPLPDCVVAKKCRAFPIEFVVRGYITGSTSTSMWTHYKGGARVYCGIELPDGLEK 162

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           N KL  P+ TPTTK  E     D PISP +I+  G +T+ +W+  S+ AL++F RG  +A
Sbjct: 163 NAKLAKPLCTPTTKDVE----HDVPISPADIVASGRMTQAEWDHCSATALAVFARGQAVA 218

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
              GLILVD+KYEFG+D    I+L DE+ TPDSSRYW   +YE        P  +DK+F+
Sbjct: 219 ASRGLILVDTKYEFGVDDDGTILLIDEVQTPDSSRYWLAASYEARVAAKQEPENIDKEFL 278

Query: 253 RNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKF 294
           R W   RC+PY+D  IPD P++++   S+ YI  +E ITG +F
Sbjct: 279 RLWYRERCDPYKDAVIPDAPDDLVCELSRRYILLFELITGQRF 321


>gi|328883874|emb|CCA57113.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Streptomyces venezuelae ATCC 10712]
          Length = 302

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 152/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLTHLHTGKVRDLYRNEAGDLVMVASDRMSAYDWVLPSEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            SD+  +H L    P            V + L M P+E + RGYL G+            
Sbjct: 72  LSDLVPHHVLSTEVPAGAPADWAGRTTVCKSLNMVPVECVARGYLTGSGLLEYDE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ +SD  +LP P+ TP TK++      D+ +S  E+  +  +       +
Sbjct: 127 SRTVCGLALPEGLSDGSELPAPIFTPATKAAVG--DHDENVSYEEVARQ--VGAETAALL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + G+IL D+K+EFG D +  ++LADE+ TPDSSR+W  + +E  
Sbjct: 183 RQSTLAVYGRARDIARDRGIILADTKFEFGFDGE-TLVLADEVLTPDSSRFWPADQWEPG 241

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+RNW+         R     P +P+ I+  TS  Y+ AYE +TG  
Sbjct: 242 RAQ----PSYDKQFVRNWLTSPASGWDRRSEQPPPALPQEIVEATSAKYVEAYELLTGKA 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|325964658|ref|YP_004242564.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470745|gb|ADX74430.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter phenanthrenivorans Sphe3]
          Length = 312

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 89/311 (28%), Positives = 149/311 (47%), Gaps = 35/311 (11%)

Query: 6   KAYIPELPNYYSGKVRENYF---------LSDGTRITIATDRLSAFDQNIAC-IPYKGEV 55
              +P   + YSGKVR+ Y          +     + +A+DR+SAFD  ++  IP KG +
Sbjct: 14  TLDLPGWKHLYSGKVRDLYEPVDESIVQRVGQDCVLVVASDRISAFDHVLSSEIPDKGRI 73

Query: 56  LNQITQYWFHHTS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           L Q++ +WF               +      +   +V ++L MFP+E I RGYL G+   
Sbjct: 74  LTQLSLWWFDQLDVEHHVLGSTVEDGVPAQVEGRAMVCKKLDMFPVECIARGYLTGSGLQ 133

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       +    LP+ + D  +L +P+ TP+ K+       D+ I+ + ++    
Sbjct: 134 EY-----KASGTVCSIPLPEGLVDGSRLEHPIFTPSAKAEVGE--HDENITYDAVVAM-- 184

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSR 227
           +  +    +S   L ++    K+A E G+IL D+K EFG D    +I L DE+ TPDSSR
Sbjct: 185 VGDDIAGRLSELTLKIYTTAEKIARERGIILADTKVEFGYDPVSGSITLGDEVLTPDSSR 244

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYI 283
           +W+  TY+    +       DK ++R+W+ +  + +        P +P+ ++ RT   Y+
Sbjct: 245 FWDAATYQPGKAQ----PSYDKQYVRDWLTSAESGWDKSSDTPPPALPDEVVNRTRSRYV 300

Query: 284 AAYEKITGLKF 294
            AYEKITG  F
Sbjct: 301 EAYEKITGKPF 311


>gi|241766802|ref|ZP_04764626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax delafieldii 2AN]
 gi|241362801|gb|EER58566.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax delafieldii 2AN]
          Length = 307

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 153/308 (49%), Gaps = 28/308 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+ 
Sbjct: 7   SALHTSTLTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGALLTQMA 66

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     IC NH              ++      ++ Q+LQ  P+E +VRGYLAG+  
Sbjct: 67  LFWFDKLGHICPNHLTGQAPESVVSPAEVEQVRGRSMLVQRLQPIPVEAVVRGYLAGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +++  +LP P+ TP  K++      D+ I+    +   
Sbjct: 127 KEYQESQ-----SVCGVPLPAGLTNAARLPEPIYTPAAKAAAGE--HDENITFERTVEM- 178

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + R+    I   ++++++    +AL  G+I+ D+K+EFG+     ++L DE+ TPDSSR
Sbjct: 179 -IGRDLATKIRDLSIAIYKAAAAIALTKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSR 237

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           YW VE Y ++   G  P   DK F+R+W+       +        P +P+++I +T+  Y
Sbjct: 238 YWPVEGYAQALARGENPPSYDKQFVRDWLEQAKVNGKPWDKTAPAPRLPQDVIEKTAAKY 297

Query: 283 IAAYEKIT 290
             A E++T
Sbjct: 298 REALERLT 305


>gi|225023983|ref|ZP_03713175.1| hypothetical protein EIKCOROL_00850 [Eikenella corrodens ATCC
           23834]
 gi|224943008|gb|EEG24217.1| hypothetical protein EIKCOROL_00850 [Eikenella corrodens ATCC
           23834]
          Length = 286

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 97/298 (32%), Positives = 148/298 (49%), Gaps = 28/298 (9%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
             IP L   YSGKVR+ Y +   + + +A+DRLSAFD  +   IP KGE+L QI+ +WF 
Sbjct: 2   TTIP-LKKIYSGKVRDLYEIDSRSMLIVASDRLSAFDVILNEPIPGKGEILTQISNFWFG 60

Query: 66  HTSDICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
             S I  NH                  +   +V ++L+   IE IVRGYLAG+       
Sbjct: 61  KLSHIMPNHFTGQTVYDVLPHDVAAALEKRAVVAKRLEPLKIEAIVRGYLAGSGWKEYRQ 120

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
                   +    LP+N+ + ++LP  + TP+TK++      D  IS +E     I+ + 
Sbjct: 121 -----TGAVCGIRLPENLREAEQLPEIIFTPSTKAAVG--NHDINISFDECAR--IIGQE 171

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
             E +   A++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  +
Sbjct: 172 LAEEVRRKAIALYSEAAEYARTRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPAD 231

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            Y      G  P   DK FIR+W+       +   P +P  +I +T   Y  A E +T
Sbjct: 232 QYRP----GSNPPSFDKQFIRDWLEQSGWNKQPPAPAVPAEVIEKTLAKYREALELLT 285


>gi|192288990|ref|YP_001989595.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris TIE-1]
 gi|192282739|gb|ACE99119.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodopseudomonas palustris TIE-1]
          Length = 305

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 83/314 (26%), Positives = 146/314 (46%), Gaps = 30/314 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P L     GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL Q+
Sbjct: 1   MTTMLSSDLP-LTKIGRGKVRDIYAVDDDRLLLVTTDRISAFDVVMGETIPMKGAVLTQV 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAFWFGQLGGVVPHHMISADIDEIIAAVPALQGLRAALAGRTMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+               +    L   ++++++L  P+ +P TK+       D+ I+  
Sbjct: 120 ITGSAWKEY-----AASGTLAGEKLAAGLTESERLEPPIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R I+      T+ S   +++ +G ++A E G+I+ D+K+EFG DK   IIL DE+ 
Sbjct: 172 RM--REIVGDEAAYTLESMTRAIYTQGEEVAREQGIIIADTKFEFGRDKDGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  +TY     +        +D++               P +P  I+  TS+ 
Sbjct: 230 TPDSSRFWAADTYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAEIVEATSKR 289

Query: 282 YIAAYEKITGLKFI 295
           Y+ AY ++TG   +
Sbjct: 290 YLDAYRRLTGTDLV 303


>gi|120613192|ref|YP_972870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax citrulli AAC00-1]
 gi|120591656|gb|ABM35096.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax citrulli AAC00-1]
          Length = 308

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 94/308 (30%), Positives = 152/308 (49%), Gaps = 28/308 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            L  + +  LP    GKVR+NY + D   + +A+DR+SAFD  +   IP KGE+L ++  
Sbjct: 8   ALHTSSLASLPLLARGKVRDNYAVGDDRILMVASDRISAFDVIMGEPIPGKGELLTKMAL 67

Query: 62  YWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF     +C NH                      ++ Q+L+  P+E +VRGYLAG+   
Sbjct: 68  FWFDKLGHLCPNHLTGGAPESVVSPEEAAQVRGRSMLVQRLRPIPVEAVVRGYLAGSGWK 127

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                     R +    LP+ +++  +LP P+ TP  K++      D+ I+    +    
Sbjct: 128 EY-----QATRSVCGVQLPEGLTNASRLPQPIYTPAAKAAVGE--HDENITFERTVEM-- 178

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  +    I   +++L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSSRY
Sbjct: 179 VGIDLATKIRDTSIALYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSRY 238

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRC-----NPYRDNIPDIPENIILRTSQTYI 283
           W VE YE +   G  P   DK F+R+W+                P +P  +I +T+  Y 
Sbjct: 239 WPVEGYEAALAAGENPPSYDKQFVRDWLEQAQVNGAPWNKSAPAPRLPREVIEKTAAKYR 298

Query: 284 AAYEKITG 291
            A E++TG
Sbjct: 299 EALERLTG 306


>gi|317405867|gb|EFV86150.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Achromobacter xylosoxidans C54]
          Length = 293

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 85/302 (28%), Positives = 145/302 (48%), Gaps = 27/302 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHQSSIKSLPLLGRGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W    + I  NH              +D      +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLQKLAHILPNHSTGIKAEDVVAPDEVDQVRGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    +LP P+ TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QATGAVCGIKLPAGLQQASQLPEPIFTPAAKAEFGM--HDENVDFAHVVKE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLKLYAEAARFAATKGIIIADTKFEFGLDDDGTLYLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R GI+P   DK F+R+W+ T+        P +P++++ +T+  Y  A +
Sbjct: 234 FWPADGY----RVGISPPSFDKQFVRDWLETQTWDKTPPAPRLPQDVLEKTAAKYREALD 289

Query: 288 KI 289
           ++
Sbjct: 290 RL 291


>gi|39933635|ref|NP_945911.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris CGA009]
 gi|39647481|emb|CAE26002.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris CGA009]
          Length = 305

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 83/314 (26%), Positives = 146/314 (46%), Gaps = 30/314 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P L     GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL Q+
Sbjct: 1   MTTMLSSDLP-LTKIGRGKVRDIYAVDDDRLLLVTTDRISAFDVVMGETIPMKGAVLTQV 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAFWFGQLGGVVPHHMISADIDEIIAAVPALQGHRAALAGRTMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+               +    L   ++++++L  P+ +P TK+       D+ I+  
Sbjct: 120 ITGSAWKEY-----AASGTLAGEKLAAGLTESERLEPPIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R I+      T+ S   +++ +G ++A E G+I+ D+K+EFG DK   IIL DE+ 
Sbjct: 172 RM--REIVGDEAAYTLESMTRAIYTQGEEVAREQGIIIADTKFEFGRDKDGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  +TY     +        +D++               P +P  I+  TS+ 
Sbjct: 230 TPDSSRFWAADTYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAEIVEATSKR 289

Query: 282 YIAAYEKITGLKFI 295
           Y+ AY ++TG   +
Sbjct: 290 YLDAYRRLTGTDLV 303


>gi|294667704|ref|ZP_06732916.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292602544|gb|EFF45983.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 310

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P  +I 
Sbjct: 236 MDEMLTPDSSRYWPADQYEP----GNSPPSYDKQFVRDYLETLDWGKTAPGPRLPAEVID 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|332285298|ref|YP_004417209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pusillimonas sp. T7-7]
 gi|330429251|gb|AEC20585.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pusillimonas sp. T7-7]
          Length = 293

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 85/302 (28%), Positives = 149/302 (49%), Gaps = 27/302 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           + L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   KALHQSSITSLPLLARGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W    + I  NH+ D                   +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLKKLAHILPNHSTDIDPQEVVTDQEREQVVGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +   +LP  +    +LP P+ TP  K+       D+ +  + ++ + 
Sbjct: 123 KDY-----QNTGSVCGIVLPQGLQQASRLPEPIFTPAAKAEFGE--HDENVDFDYVVKQ- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +     +TI S  L L+    + A + G+I+ D+K+EFG+D++  + L DE+ TPDSSR
Sbjct: 175 -VGSELAQTIRSTTLRLYSEAAQFAADKGIIIADTKFEFGLDEQGQLHLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W    Y      GI+P   DK F+R+W+ T+        P +P +++ +T+  Y  A  
Sbjct: 234 FWPASGY----AVGISPPSFDKQFVRDWLETQVWDKTPPAPRLPADVLEKTAAKYREAAT 289

Query: 288 KI 289
           ++
Sbjct: 290 RL 291


>gi|311108232|ref|YP_003981085.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Achromobacter xylosoxidans A8]
 gi|310762921|gb|ADP18370.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Achromobacter xylosoxidans A8]
          Length = 293

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 86/302 (28%), Positives = 145/302 (48%), Gaps = 27/302 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHQSSIKSLPLLGRGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W    + I  NH              +D      +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLQKLAHILPNHSTGIKAEDVVAPDEVDQVRGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    +LP P+ TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QATGAVCGIKLPAGLQQASQLPEPIFTPAAKAEFGM--HDENVDFAHVVKE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    K A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLKLYAEAAKFAATKGIIIADTKFEFGLDDDGTLYLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R GI+P   DK F+R+W+ T+        P +P++++ +T+  Y  A +
Sbjct: 234 FWPADGY----RVGISPPSFDKQFVRDWLETQTWDKTPPAPRLPQDVLEKTAAKYREALD 289

Query: 288 KI 289
           ++
Sbjct: 290 RL 291


>gi|238028511|ref|YP_002912742.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia glumae BGR1]
 gi|237877705|gb|ACR30038.1| SAICAR synthetase [Burkholderia glumae BGR1]
          Length = 296

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 98/309 (31%), Positives = 150/309 (48%), Gaps = 27/309 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY +     + + +DRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGTDKLLIVTSDRLSAFDVVMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF   S I  NH              ++      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  ANFWFEKLSHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + QKLP P+ TP  K+       D+ IS +E   R
Sbjct: 121 WKDY-----QATGAVCGVELPPGLQNAQKLPEPIFTPAAKAELGH--HDENISYDECERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELTATIRDISIRLYQEAADYAATRGIIIADTKFEFGLDQHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G  P   DK ++R+W+ T+  P     P +P+ +I RTS  Y  A 
Sbjct: 232 RFWPADQY----QVGTNPPSFDKQYVRDWLETQDWPKAPPAPKLPDEVIARTSAKYQEAL 287

Query: 287 EKITGLKFI 295
           E+ITG   +
Sbjct: 288 ERITGRPLV 296


>gi|302520700|ref|ZP_07273042.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SPB78]
 gi|318061655|ref|ZP_07980376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SA3_actG]
 gi|318076897|ref|ZP_07984229.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SA3_actF]
 gi|302429595|gb|EFL01411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SPB78]
          Length = 299

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 98/301 (32%), Positives = 158/301 (52%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L M P+E + RGYL G+            
Sbjct: 72  LADLVPNHVLSTKLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTGSGLVEYNE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  R  +       +
Sbjct: 127 SRTVCGLALPEGLEDGSELPGPIFTPATKAEVGE--HDENVSYEEVARR--VGAETAAQL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D +  ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYARGRDIARERGIILADTKFEFGFDGE-ELVLADEVLTPDSSRFWPADSWEPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P++P  I+ RT   Y+ AYEK+TG++
Sbjct: 242 HAQ----PSFDKQFVRDWLTSPASGWDRKSEQPPPELPAEIVERTRAKYVEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|329120290|ref|ZP_08248958.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462631|gb|EGF08954.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria bacilliformis ATCC BAA-1200]
          Length = 286

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 96/294 (32%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + + T + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKTYSGKVRDLYEIDEKTMLIVATDRLSAFDVILPEPIPGKGEILTQISNFWFAKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    IE IVRGYLAG+           
Sbjct: 65  IMPNHFTGQSVYDVLLESEARAVEKRAVVAKRLTPVKIEAIVRGYLAGSGWKEYRK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ + + +KLP  + TP+TK+     G D+ IS  E      +       
Sbjct: 121 -TGTVCGIKLPEGLHEAEKLPQVLFTPSTKAEMG--GHDENISFAECERL--IGAELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+      A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVALYTEAAAYAETRGIIICDTKFEFGLDDNGTLTLMDEVLTPDSSRFWPQDQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             R GI+P   DK F+R+W+       +   P +P  II +T+  Y  A   +T
Sbjct: 234 --RVGISPPSFDKQFVRDWLEQSGWNKQPPAPQVPAEIIGKTAAKYREALRLLT 285


>gi|326319257|ref|YP_004236929.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323376093|gb|ADX48362.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 308

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 94/309 (30%), Positives = 152/309 (49%), Gaps = 28/309 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L  + +  LP    GKVR+NY + D   + +A+DR+SAFD  +   IP KGE+L ++ 
Sbjct: 7   SALHTSSLASLPLLARGKVRDNYAVGDDRILMVASDRISAFDVIMGEPIPGKGELLTKMA 66

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     +C NH                      ++ Q+L+  P+E +VRGYLAG+  
Sbjct: 67  LFWFDKLGHLCPNHLTGDAPESVVSPEEAAQVRGRSMLVQRLRPIPVEAVVRGYLAGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      R +    LP+ +++  +LP P+ TP  K++      D+ I+    +   
Sbjct: 127 KEY-----QASRAVCGVQLPEGLTNASRLPQPIYTPAAKAAVGE--HDENITFERTVEM- 178

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    I   +++L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSSR
Sbjct: 179 -VGIDLATKIRDTSIALYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSR 237

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRC-----NPYRDNIPDIPENIILRTSQTY 282
           YW VE YE +   G  P   DK F+R+W+                P +P  +I +T+  Y
Sbjct: 238 YWPVEGYEAALDAGENPPSYDKQFVRDWLEQAQVNGAPWNKSAPAPRLPREVIEKTAAKY 297

Query: 283 IAAYEKITG 291
             A E++TG
Sbjct: 298 REALERLTG 306


>gi|261380165|ref|ZP_05984738.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           subflava NJ9703]
 gi|284797007|gb|EFC52354.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           subflava NJ9703]
          Length = 287

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ + + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIQLPEGLQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|187477394|ref|YP_785418.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella avium 197N]
 gi|115421980|emb|CAJ48501.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella avium 197N]
          Length = 293

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 84/303 (27%), Positives = 146/303 (48%), Gaps = 27/303 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +ATDR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHESSIKSLPLLGRGKVRDMYAVGDDKLLIVATDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W    + I  NH              ++      +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLKKLAHILPNHSTGIAPEDVVAPDEVEQVKGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  ++   KLP  + TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QATGAVCGIKLPAGLNQASKLPEAIFTPAAKAEFGM--HDENVDFAHVVKE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    + A   G+++ D+K+EFG+D +  + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLRLYSEAAQFAATKGIMIADTKFEFGLDDQGTLHLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y +    GI+P   DK F+R+W+ T+        P +P +++ +T+  Y  A +
Sbjct: 234 FWPADGYRE----GISPPSFDKQFVRDWLETQTWDKTPPAPRLPADVLEKTAAKYREALD 289

Query: 288 KIT 290
           ++T
Sbjct: 290 RLT 292


>gi|300692409|ref|YP_003753404.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum PSI07]
 gi|299079469|emb|CBJ52144.2| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           solanacearum PSI07]
          Length = 308

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 94/312 (30%), Positives = 144/312 (46%), Gaps = 32/312 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ I  LP    GKVRENY + D   + + TDRLSAFD  +   IP KG VL Q++
Sbjct: 9   SALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRLSAFDVILGQPIPDKGRVLAQMS 68

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I   H               D      +V ++L+   +E +VRGYLAG+  
Sbjct: 69  DFWFRKLRHIVPTHETGIAPESVVPPGEADQVRGRAIVVKRLKPILVEAVVRGYLAGSGW 128

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                       K+    L   + + +KLP P+ TP  K+       D+ IS +E+  R 
Sbjct: 129 KDY-----QATGKVCGVQLAPGLRNAEKLPEPIFTPAAKADVGE--HDENISFDEVERR- 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       I   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSSR
Sbjct: 181 -IGPELAAQIRDVSIRLYKEAADFAATRGIIIADTKFEFGLDENGTLTLMDEALTADSSR 239

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +W  ++Y    + G  P   DK F+R+W+       +  P     P +P +II +T+  Y
Sbjct: 240 FWPADSY----QVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPADIIEKTADKY 295

Query: 283 IAAYEKITGLKF 294
             A   +TG   
Sbjct: 296 REALTCLTGETL 307


>gi|21241243|ref|NP_640825.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas axonopodis pv. citri str. 306]
 gi|25008975|sp|Q8PQ58|PUR7_XANAC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21106558|gb|AAM35361.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas axonopodis pv. citri str. 306]
          Length = 310

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 150/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P ++I 
Sbjct: 236 MDEMLTPDSSRYWPADQYEP----GTSPPSYDKQFVRDYLETLDWGKTAPGPRLPADVID 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|114331198|ref|YP_747420.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosomonas eutropha C91]
 gi|114308212|gb|ABI59455.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosomonas eutropha C91]
          Length = 295

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 146/302 (48%), Gaps = 28/302 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
            L +  I  LP  + GKVR+ Y + +   + I TDR+SAFD  +   IP KG++L +I++
Sbjct: 5   TLFETNITSLPLLHRGKVRDIYVVDENNLLIIQTDRISAFDVILPTPIPEKGKILTKISR 64

Query: 62  YWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF   + I  NH  D P                  V ++L+  P+E IVRGY++G+   
Sbjct: 65  FWFEKLAHIIPNHLTDIPPESVILPGERDQVTDRAFVVKKLKPLPVEAIVRGYISGSGWR 124

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRG 167
                       I    LP+ + +  K+P   + TP+TK+       D+ IS        
Sbjct: 125 DY-----QHSGTICGVTLPEGLREADKIPDGAIFTPSTKAEAG--SHDENISYASC--EQ 175

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           IL       +S YA++L+      AL   +I+ D+K+EFG+D    + L DE  TPDSSR
Sbjct: 176 ILGAPLASVVSKYAIALYSAAADYALTRNIIIADTKFEFGLDDNDQLYLIDEALTPDSSR 235

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  E Y+     G TP   DK FIR+W+           P IP  I+++T + Y  AY+
Sbjct: 236 FWPAEGYQP----GKTPPSYDKQFIRDWLEQTGWNKTPPAPAIPAEILMQTVEKYQEAYQ 291

Query: 288 KI 289
            +
Sbjct: 292 VL 293


>gi|241758808|ref|ZP_04756921.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           flavescens SK114]
 gi|241321016|gb|EER57229.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           flavescens SK114]
          Length = 287

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH   +              +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK+       D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAEVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|320532946|ref|ZP_08033706.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134840|gb|EFW27028.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 316

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 86/304 (28%), Positives = 155/304 (50%), Gaps = 30/304 (9%)

Query: 9   IPELPNYYSGKVRENY-------FLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y       ++     + +A+DR+SA+D  +A  IP KG+VL  ++
Sbjct: 24  VPGWEHRSSGKVRDVYAPSSDGPWVGQDVLLVVASDRISAYDHILATPIPDKGKVLTALS 83

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +D+   H +    P       ++ ++L+M+P+E + RGYL G+          
Sbjct: 84  AWWFERLADVVPGHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTGSGLAEY----- 138

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
            G R + +  LP+ +++  +LP P+ TP  K+       D+ +S   +I    +  +   
Sbjct: 139 RGSRSVCDVALPEGLTEASRLPEPIFTPAAKAELGE--HDENVSFERVIQM--VGESAAT 194

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+L+ R  ++A + G+IL D+K+E G D   N++L DE+ TPDSSR+W  + +E
Sbjct: 195 ALRETTLALYSRAAEIARDRGIILADTKFELGTDAGGNLVLGDEVLTPDSSRFWPADAWE 254

Query: 236 KSFREGITPIGLDKDFIRNWILTR----CNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++R+W+ +             P +P++++ RT   Y+ AYE++TG
Sbjct: 255 P----GRITPSFDKQYVRDWLTSPASGWDRDGGQEPPPLPDDVVERTRARYLEAYERLTG 310

Query: 292 LKFI 295
               
Sbjct: 311 HPLE 314


>gi|261856472|ref|YP_003263755.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halothiobacillus neapolitanus c2]
 gi|261836941|gb|ACX96708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halothiobacillus neapolitanus c2]
          Length = 306

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 99/305 (32%), Positives = 153/305 (50%), Gaps = 29/305 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L ++ +  LP  + GKVR+ Y +     + + TDR+SAFD  +   IP KG VL  I+ +
Sbjct: 8   LLESKLSHLPLLHRGKVRDLYAVDTDRLLIVTTDRISAFDVILPTAIPDKGRVLTAISHF 67

Query: 63  WFHHTSDICSNHTLDY---------------PDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF  T  I  NH  D                 +   L+ ++L+  PIE +VRGYL G   
Sbjct: 68  WFDRTRTIVPNHLTDDQSLTDIIPDRDERALLEGRSLIVKRLKALPIEAVVRGYLIGTGY 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP ++    +LP P+ TP TK++      D+ I  +  +   
Sbjct: 128 KDY-----LATGAVCGIALPKDLPLAARLPEPIFTPATKAAVG--DHDENIDFDTTV--S 178

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           +L R   E +   A+ L++   K ALE G+I+ D+K+EFG+D +  + L DE  TPDSSR
Sbjct: 179 LLGRPLAEQVRDTAIRLYQEAAKYALERGIIIADTKFEFGLDDQGTLHLIDEALTPDSSR 238

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W V+ Y    + GI+P   DK F+R+W+ T     +   P IP++I+ +T   Y+ AY 
Sbjct: 239 FWPVDQY----KTGISPPSFDKQFVRDWLETLDWDKKAPGPTIPDDIVQQTRSRYLEAYR 294

Query: 288 KITGL 292
            +TG 
Sbjct: 295 LLTGH 299


>gi|283852930|ref|ZP_06370190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio sp. FW1012B]
 gi|283571688|gb|EFC19688.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio sp. FW1012B]
          Length = 297

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 88/310 (28%), Positives = 152/310 (49%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +++  I   P    GKVR+ Y LS  + + + TDR+SA+D  +   IP KG +LNQI
Sbjct: 1   MPAVTETDIKAYPLRSRGKVRDIYELSPESLLIVTTDRISAYDVIMPDPIPQKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH L               D      +V ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDMFRDMIPNHLLATETGDFPAGLAPYADMLAGRAVVARKARPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++  LP P+ TP+TK+       D+ I+  +  
Sbjct: 121 SGLKDYRK-----TGTVCGHALPAGLVESDILPEPLFTPSTKAELG--AHDENITLAK-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            + +L       + + +L+++ +    A E G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AKDLLGTELCAQVEATSLAMYAKARDYARERGIIIADTKFEFGLTDD-GLILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W    Y     +       DK ++R+W+ +     +   P++P +++ +T + Y+ 
Sbjct: 231 SSRFWPAAGYAPGKSQ----PSFDKQYLRDWLTSIGFSKQPPAPNLPADVVEKTREKYLK 286

Query: 285 AYEKITGLKF 294
           AYE +TG K 
Sbjct: 287 AYEVLTGKKL 296


>gi|224369671|ref|YP_002603835.1| PurC [Desulfobacterium autotrophicum HRM2]
 gi|259546850|sp|C0QH22|PUR7_DESAH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|223692388|gb|ACN15671.1| PurC [Desulfobacterium autotrophicum HRM2]
          Length = 295

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 86/308 (27%), Positives = 155/308 (50%), Gaps = 31/308 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           + + +   P++     GKVR+ Y   +   + + TDRLSAFD  +   IP KG+VL +I+
Sbjct: 3   KAVLETQFPDMNLVRKGKVRDIYDTGEA-FLMVTTDRLSAFDVVLPNGIPGKGKVLTKIS 61

Query: 61  QYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAGN 105
           ++WF   + +  NH +                      ++ ++ +  P+E IVRGY++G+
Sbjct: 62  EFWFKQMAPLVGNHLISTDVADFPDVCQPYAKVLSGRTMLVKKAEPLPVECIVRGYISGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
              S           +    LP  + ++ +LP P+ TP+TK+       D  I+ +    
Sbjct: 122 GWKSY-----QNNGTLCGITLPKGLVESDRLPEPLYTPSTKAEVG----DHDINIDFAKT 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             ++ R + E +   ++ ++ +G + AL+ G+I+ D+K+EFG+     +IL DE+ TPDS
Sbjct: 173 VDLIGRERAEKLRDLSIQIYLKGAQTALKKGIIIADTKFEFGLVDD-EVILIDEVMTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W ++TY     +       DK F+R+W+++     +   P+IP+++I  T   Y   
Sbjct: 232 SRFWPMDTYAPGGAQ----KSYDKQFVRDWLVSSGWDMKAPGPEIPQDVIAGTVAKYQEV 287

Query: 286 YEKITGLK 293
            E ITG K
Sbjct: 288 LELITGQK 295


>gi|296118913|ref|ZP_06837486.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295968011|gb|EFG81263.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 295

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 88/300 (29%), Positives = 150/300 (50%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  SGKVR+ Y + D T + + TDR+SA+D  +   IP KG VL   + ++F  
Sbjct: 4   QLSDYQHLSSGKVRDIYQVDDNTLLMVVTDRISAYDFALEPAIPDKGRVLTATSMFFFDA 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V Q+LQM P E + RGYL G+          N   
Sbjct: 64  IDFPNHLAGPIDDERIPEEVLGRAIVVQKLQMLPFECVARGYLTGSGLKEY-----NANG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LPD + +  +LP P+ TP TK+ +     D+ ++   ++    L + + E +  
Sbjct: 119 TVCGIELPDGLVEASRLPEPIFTPATKAEQG--DHDENVTFERVV--QDLGQERAEQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++    ++A   G+IL D+K+EFG+D   N++L DE+ TPDSSRYW  +TY +   
Sbjct: 175 ETLRIYSAAAQIAEAKGIILADTKFEFGLDADGNLVLGDEVLTPDSSRYWPADTYAEGVV 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           +       DK ++RNW+ +  + +        P +P+ ++  T   YI AYE+++G +F+
Sbjct: 235 Q----PSFDKQYVRNWLTSEESGWDVESETPPPTLPDEVVAATRLRYIEAYERLSGKRFV 290


>gi|58583677|ref|YP_202693.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625486|ref|YP_452858.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|166713815|ref|ZP_02245022.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|81311720|sp|Q5GVG5|PUR7_XANOR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123520832|sp|Q2NYP3|PUR7_XANOM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|58428271|gb|AAW77308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369426|dbj|BAE70584.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 310

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CIP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYLIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAECGILLADTKFEFGTDADGRLYV 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P ++I 
Sbjct: 236 MDEMLTPDSSRYWPADQY----ELGTSPPSYDKQFVRDYLETLDWGKTAPGPSLPADVID 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|291044329|ref|ZP_06570038.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
 gi|291011223|gb|EFE03219.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
          Length = 330

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 48  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 107

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 108 IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 163

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 164 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 218

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 219 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 276

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 277 --EVGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 328


>gi|330999109|ref|ZP_08322830.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Parasutterella excrementihominis YIT 11859]
 gi|329575498|gb|EGG57037.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Parasutterella excrementihominis YIT 11859]
          Length = 297

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 91/306 (29%), Positives = 154/306 (50%), Gaps = 27/306 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +    I  LP  Y GKVR++Y + D   + +A+DR+SAFD  +   IP KG++L  +
Sbjct: 1   MAEIVTTSIKSLPLVYRGKVRDSYAVGDDKLLIVASDRISAFDVILGDPIPKKGKILTAL 60

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           T +WF     I  NH               D      +V ++L+   +E + RGYL+G+ 
Sbjct: 61  TDFWFKELDGIVPNHLTGTDPESVVAPEERDQVKGRAVVAKRLKPILVECVARGYLSGSA 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                T       +I    LP  +  ++KLP P+ TP  K+       D+ I+  +++ +
Sbjct: 121 WKEYQT-----TGQICGVKLPAGLKQSEKLPEPIFTPAGKAEAGH--HDENITYEDVVKQ 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
                +    +  Y L+L+++  + A   G+I+ D+K+EFG+D    ++L DEI TPDSS
Sbjct: 174 --YGEDTASKLRDYTLALYKKAAEYAASKGIIIADTKFEFGLDDNGTVVLMDEILTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G +    DK FIR+W+ ++    +   P IP++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----KVGQSEPSFDKQFIRDWLESQPWNKKAPAPKIPQDVLDKTSSKYEEAL 287

Query: 287 EKITGL 292
            ++TG 
Sbjct: 288 IRLTGK 293


>gi|312138272|ref|YP_004005608.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Rhodococcus equi 103S]
 gi|311887611|emb|CBH46923.1| phosphoribosylaminoimidazole-succinocarboxamide synthase PurC
           [Rhodococcus equi 103S]
          Length = 294

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 88/300 (29%), Positives = 147/300 (49%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F  
Sbjct: 4   SLESYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFEK 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      LV ++L M P+E + RGYL G+          N   
Sbjct: 64  LGGTNHLAGDPLDERIPEEVLGRALVVRKLNMLPVECVARGYLTGSGLADY-----NSTG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP +K+       D+ I    ++ +  + ++    +  
Sbjct: 119 AVCGVALPEGLVEASQLPEPIFTPASKAELG--DHDENIDFATVVDK--VGQDLAVKLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R    A + G+IL D+K+EFG+D + N++LADE+ TPDSSRYW  + YE    
Sbjct: 175 DTLDIYFRAASFARDRGIILADTKFEFGLDAEGNLVLADEVLTPDSSRYWPADGYEP--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            G      DK F+RNW+    + +        P +P++I+  T   YI AYE+I+GL F 
Sbjct: 232 -GKVQPSFDKQFVRNWLTGPESGWDRASDTPPPPLPQDIVDATRARYIEAYERISGLSFE 290


>gi|325674811|ref|ZP_08154498.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Rhodococcus equi ATCC 33707]
 gi|325554397|gb|EGD24072.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Rhodococcus equi ATCC 33707]
          Length = 309

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 88/300 (29%), Positives = 147/300 (49%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F  
Sbjct: 19  SLESYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFEK 78

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      LV ++L M P+E + RGYL G+          N   
Sbjct: 79  LGGTNHLAGDPLDERIPEEVLGRALVVRKLNMLPVECVARGYLTGSGLADY-----NSTG 133

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP +K+       D+ I    ++ +  + ++    +  
Sbjct: 134 AVCGVALPEGLVEASQLPEPIFTPASKAELG--DHDENIDFATVVDK--VGQDLAVKLRD 189

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R    A + G+IL D+K+EFG+D + N++LADE+ TPDSSRYW  + YE    
Sbjct: 190 DTLDIYFRAASFARDRGIILADTKFEFGLDAEGNLVLADEVLTPDSSRYWPADGYEP--- 246

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            G      DK F+RNW+    + +        P +P++I+  T   YI AYE+I+GL F 
Sbjct: 247 -GKVQPSFDKQFVRNWLTGPESGWDRASDTPPPPLPQDIVDATRARYIEAYERISGLSFE 305


>gi|196230595|ref|ZP_03129457.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chthoniobacter flavus Ellin428]
 gi|196225525|gb|EDY20033.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chthoniobacter flavus Ellin428]
          Length = 299

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 93/307 (30%), Positives = 154/307 (50%), Gaps = 32/307 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M IL+   +P +    SGKVRE + L +   + +ATDR+SAFD  +   IP+KG VL  I
Sbjct: 5   MEILT-LDLPGIRKIASGKVREIFDLGE-HLLLVATDRISAFDCILPNPIPHKGAVLTSI 62

Query: 60  TQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYLAGN 105
           + +WF     + ++                        +V ++ +  P+E +VRGYLAG+
Sbjct: 63  SAFWFQRFGFVENHVVATEVADFPAALQPYAAQLARRAMVVKKAKPLPVECVVRGYLAGS 122

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                        + I    LP  +   +KLP  + TP+TK+       D  I+ +E   
Sbjct: 123 GWKEY-----QASQTICGIKLPAGLRQAEKLPGTIFTPSTKAESG---HDMNINWDEC-- 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
           R ++  +  E + + ++ ++E G   A E G+I+ D+K+EFG+     +IL DE  TPDS
Sbjct: 173 RRLVGDDVAEQVRTLSIRIYEEGRAYAAERGIIVADTKFEFGLLDD-RVILIDECLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y      GI+P   DK F+R+++ T         P +P +++ +TS+ Y+ A
Sbjct: 232 SRFWPADQY----ALGISPPSFDKQFVRDYLETLTWDKTPPAPALPADVVHKTSEKYLEA 287

Query: 286 YEKITGL 292
           Y ++TG 
Sbjct: 288 YSRLTGR 294


>gi|293399518|ref|ZP_06643671.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae F62]
 gi|291610087|gb|EFF39209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae F62]
          Length = 330

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 48  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 107

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 108 IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 163

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 164 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 218

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + Y  
Sbjct: 219 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQY-- 276

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 277 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 328


>gi|293607076|ref|ZP_06689419.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Achromobacter piechaudii ATCC 43553]
 gi|292814566|gb|EFF73704.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Achromobacter piechaudii ATCC 43553]
          Length = 293

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 86/303 (28%), Positives = 143/303 (47%), Gaps = 27/303 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHQSSIKSLPLLGRGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++W    + I  NH              +D      +V ++L+   +E + RGYL G+  
Sbjct: 63  EFWLQKLAHILPNHSTGVKPEDVVAPDEVDQVRGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    +LP P+ TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QATGAVCGIQLPAGLQQASQLPEPIFTPAAKAEFGM--HDENVDFAHVVKE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    K A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLKLYTEAAKFAATKGIIIADTKFEFGLDDNGTLHLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R GI+P   DK F+R+W+ T+        P +P  ++ +T+  Y  A +
Sbjct: 234 FWPADGY----RVGISPPSFDKQFVRDWLETQTWDKTPPAPRLPREVLEKTAAKYREALD 289

Query: 288 KIT 290
           ++ 
Sbjct: 290 RLI 292


>gi|313679578|ref|YP_004057317.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oceanithermus profundus DSM 14977]
 gi|313152293|gb|ADR36144.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oceanithermus profundus DSM 14977]
          Length = 323

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 115/316 (36%), Positives = 186/316 (58%), Gaps = 11/316 (3%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           + L +A +  L    +GKVR+ Y   D  R+ +ATDR+SAFD+ +  +P++G+VLNQ++ 
Sbjct: 13  QPLLEARLEGLGPREAGKVRDMYRAGD-LRVLVATDRISAFDRVLGAVPFRGQVLNQLSA 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T D+ +NH +  PDPNV + ++ +  P+E+IVRGY+ G+T TSL   Y+ G+R  
Sbjct: 72  WWFEATRDLVANHVVSVPDPNVTIAREAEPLPVEVIVRGYITGSTTTSLWYLYEQGERAP 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LP+ ++ N  LP P+ITPTTK++      D+ ++  E+  RG++    WE +   A
Sbjct: 132 YGVPLPEGLAKNDPLPEPIITPTTKAAPGE--HDERLTAAEVTERGLVEPALWERVQEVA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG ++A   GL+LVD+KYEFG+     ++L DE+HTPDSSRYW++  YE+     
Sbjct: 190 LALFARGQEVARRGGLVLVDTKYEFGL-ADGELVLIDEVHTPDSSRYWDLAAYERG---- 244

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              +  DK+ +R W   R        P +   +    ++ Y++ +E++TG +F       
Sbjct: 245 -EIVHYDKEHLRLWYAARGFRGEGEPPPLAPELARELAELYVSVFERLTGARFEPGAQPA 303

Query: 302 PPLERIRNNLRKYTHR 317
            P  RI+ N+ +    
Sbjct: 304 GP--RIQENVERALAE 317


>gi|312194087|ref|YP_004014148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EuI1c]
 gi|311225423|gb|ADP78278.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EuI1c]
          Length = 303

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 89/307 (28%), Positives = 151/307 (49%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 3   LTHVEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVILPTEIPDKGAVLTGLSLW 62

Query: 63  WFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF   +D+  +H +               +      ++  +L M  +E + RGYL G+  
Sbjct: 63  WFDQLADLVPSHVISSNVDEYPDELQPYAEQLRGRSMLCHRLDMALVECVARGYLTGSGL 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
              +         +  + LP+ + D  KLP+P+ TP+TK+       D+ IS  +   R 
Sbjct: 123 KDYVR-----TGAVSGHTLPEGLVDGSKLPHPIYTPSTKAPIGE--HDENISRADAATR- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    +    L +F R   LA E G++L D+K+EFG D    + L DE+ TPDSSR
Sbjct: 175 -IGDDLAAELEKLTLQIFGRASDLAAERGILLADTKFEFGHDPAGVLRLGDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  +++     +       DK FIR++++          P++P++I+  T   Y+ AYE
Sbjct: 234 FWPADSWAPGGAQ----PSYDKQFIRDYLVNTGWDKVSPAPELPDDIVFSTRSRYVEAYE 289

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 290 RLTGISF 296


>gi|225872360|ref|YP_002753815.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium capsulatum ATCC 51196]
 gi|225794016|gb|ACO34106.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium capsulatum ATCC 51196]
          Length = 297

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 87/306 (28%), Positives = 150/306 (49%), Gaps = 31/306 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M+ L KA +PEL     GKVR+ Y +     + IATDR+SAFD  +   IP KGEVL Q+
Sbjct: 1   MKALLKAELPELKLVSRGKVRDIYAIG-MDLLMIATDRISAFDHILPTGIPGKGEVLTQL 59

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           + +WF   +D+  NH +                      +  ++ +MFP+E +VRGY++G
Sbjct: 60  SAFWFRKLADVVPNHMISTDLAEFPEDLSEYKKILKGRSMRVKRAEMFPVECVVRGYISG 119

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +     +         I    L   M ++++L  P+ TP TK+++     D+ IS  ++ 
Sbjct: 120 SGWKDYIR-----TGSIGGITLTPGMRESERLSEPIFTPATKAADGE--HDENISFAKMA 172

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++   + E +   ++ L+ R  K A   G+++ D+K+EFG +  + I+L DE  TPD
Sbjct: 173 --NMIGGEEAEKLRDLSIELYLRASKHAEARGIVIADTKFEFGKN-DRGILLCDEALTPD 229

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + Y     +       DK ++R+++       +   P +P  ++  T + Y  
Sbjct: 230 SSRFWPRDQYRAGQSQ----PSFDKQYVRDYLEKIKWNKKAPAPPLPAEVVRGTQKRYAE 285

Query: 285 AYEKIT 290
            Y  +T
Sbjct: 286 VYFMLT 291


>gi|303256760|ref|ZP_07342774.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderiales bacterium 1_1_47]
 gi|302860251|gb|EFL83328.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderiales bacterium 1_1_47]
          Length = 297

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 91/306 (29%), Positives = 154/306 (50%), Gaps = 27/306 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +    I  LP  Y GKVR++Y + D   + +A+DR+SAFD  +   IP KG++L  +
Sbjct: 1   MAEIVTTSIKSLPLVYRGKVRDSYAVGDDKLLIVASDRISAFDVILGDPIPKKGKILTAL 60

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           T +WF     I  NH               D      +V ++L+   +E + RGYL+G+ 
Sbjct: 61  TDFWFKELDGIVPNHLTGIDPESVVAPEERDQVKGRAVVAKRLKPILVECVARGYLSGSA 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                T       +I    LP  +  ++KLP P+ TP  K+       D+ I+  +++ +
Sbjct: 121 WKEYQT-----TGQICGVKLPAGLKQSEKLPEPIFTPAGKAEAGH--HDENITYEDVVKQ 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
                +    +  Y L+L+++  + A   G+I+ D+K+EFG+D    ++L DEI TPDSS
Sbjct: 174 --YGEDTASKLRDYTLALYKKAAEYAASKGIIIADTKFEFGLDDNGTVVLMDEILTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + G +    DK FIR+W+ ++    +   P IP++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----KVGQSEPSFDKQFIRDWLESQPWNKKAPAPKIPQDVLDKTSSKYEEAL 287

Query: 287 EKITGL 292
            ++TG 
Sbjct: 288 IRLTGK 293


>gi|333025579|ref|ZP_08453643.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Tu6071]
 gi|332745431|gb|EGJ75872.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Tu6071]
          Length = 299

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 99/301 (32%), Positives = 158/301 (52%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L M P+E + RGYL G+          N 
Sbjct: 72  LADLVPNHVLSTKLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTGSGLVEY-----NA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  R  +       +
Sbjct: 127 SRTVCGLALPEGLEDGSELPGPIFTPATKAEVGE--HDENVSYEEVARR--VGAETAAQL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D +  ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYARGRDIARERGIILADTKFEFGFDGE-ELVLADEVLTPDSSRFWPADSWEPG 241

Query: 238 FREGITPIGLDKDFIRNWILT--RCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +       +     P++P  I+ RT   Y+ AYEK+TG++
Sbjct: 242 HAQ----PSFDKQFVRDWLTSPVSGWDRKSEQPPPELPAEIVERTRAKYVEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|188575052|ref|YP_001911981.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|229568633|sp|B2SM33|PUR7_XANOP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|188519504|gb|ACD57449.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 308

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CIP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAECGILLADTKFEFGTDADGRLYV 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P ++I 
Sbjct: 234 MDEMLTPDSSRYWPADQY----ELGTSPPSYDKQFVRDYLETLDWGKTAPGPSLPADVID 289

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 290 RTRAKYAEALQRLAG 304


>gi|94969285|ref|YP_591333.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Koribacter versatilis Ellin345]
 gi|94551335|gb|ABF41259.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Koribacter versatilis Ellin345]
          Length = 318

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 95/308 (30%), Positives = 155/308 (50%), Gaps = 31/308 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L    IPEL  Y SGKVR+ Y +     + IA+DR+SAFD  +A  IP KG VL QI+ 
Sbjct: 25  VLLHTDIPELELYASGKVRDIYKVDSDHLLFIASDRISAFDYVLASGIPEKGRVLTQISL 84

Query: 62  YWFHHTSDICSNH---------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF    +I  NH                        ++ Q  QM  +E +VRGYL+G+ 
Sbjct: 85  FWFDFLKNIVDNHLVTADVNKFPAELKAHEAQLHGRSMLVQHAQMIQVECVVRGYLSGSG 144

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + ++ KLP P+ TP TK+    +G D+ IS + ++  
Sbjct: 145 WKEYKK-----DGAVCGIELPKGLQESDKLPEPIFTPATKA---QTGHDENISFDRMV-- 194

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            +   +  E +   ++ +++     AL  G+I+ D+K+EFG+  K  ++LADE+ TPDSS
Sbjct: 195 QVTGGDLSEKLREVSIKIYKAAADYALTKGIIIADTKFEFGMTPK-GLVLADEVLTPDSS 253

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W V+ Y+    +       DK ++R+++       +   P +PE +  +TS+ Y+ AY
Sbjct: 254 RFWPVDKYKPGMTQ----ESFDKQYVRDYLEDIKWNKQPPAPGLPEEVQAKTSEKYVEAY 309

Query: 287 EKITGLKF 294
            ++TG   
Sbjct: 310 RRLTGHDL 317


>gi|294668895|ref|ZP_06733985.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           elongata subsp. glycolytica ATCC 29315]
 gi|291309192|gb|EFE50435.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           elongata subsp. glycolytica ATCC 29315]
          Length = 286

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L  I+ +WF   + 
Sbjct: 5   GLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTAISNFWFGKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPHDQAQALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYRQ---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + + Q+LP  + TP+TK++      D+ IS  E   R I+ +   E 
Sbjct: 121 -TGAVCGIPLPAGLQEAQQLPEVIFTPSTKAAVG--DHDENISFEEC--RNIIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             R G  P   DK F+R+W+           P +P ++I +T + Y  A   +T
Sbjct: 234 --RVGTNPPSFDKQFVRDWLEQSGWNKEAPAPRVPADVIAKTVEKYREALTLLT 285


>gi|148251646|ref|YP_001236231.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. BTAi1]
 gi|146403819|gb|ABQ32325.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. BTAi1]
          Length = 304

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 89/313 (28%), Positives = 150/313 (47%), Gaps = 30/313 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L  + +P LP    GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTLLASNLP-LPKIGRGKVRDIYAVGDDRVLLLTTDRISAFDVVMNETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + YWF+    +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAYWFNALEGVVHHHMISADTDAIIAEVPELAPHRQEILGRAMLCKRTNVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           L+G+               +    LP  + ++QKL   + +P TK+       D+ I+  
Sbjct: 120 LSGSAWKEY-----AASGTLAGEQLPAGLVESQKLEPAIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R ++      T+ S   +++  G  LA E G+I+ D+K+EFG DK  +IIL DE+ 
Sbjct: 172 RM--REVVGDETAYTLESMTRAVYTLGETLAREQGIIIADTKFEFGRDKDGHIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W V+ Y+    +        +D++               P +P++++  TSQ 
Sbjct: 230 TPDSSRFWAVDAYKPGQPQPSFDKQPLRDYLDAERKAGRWNGEAPPPPLPQSVVDATSQR 289

Query: 282 YIAAYEKITGLKF 294
           Y+ A+ ++TG + 
Sbjct: 290 YLEAFRRVTGREL 302


>gi|39997189|ref|NP_953140.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sulfurreducens PCA]
 gi|81832015|sp|Q74BF0|PUR7_GEOSL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|39984079|gb|AAR35467.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sulfurreducens PCA]
 gi|298506202|gb|ADI84925.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sulfurreducens KN400]
          Length = 296

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 89/307 (28%), Positives = 150/307 (48%), Gaps = 31/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
            ++ K   P+L     GKVR+ Y L D   + + TDR+SAFD  +   IP KG VL QI+
Sbjct: 3   ELVLKTDFPDLKLAGRGKVRDIYDLGDA-LLIVTTDRISAFDVIMNEAIPDKGYVLTQIS 61

Query: 61  QYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +                  +   ++ ++ +  P+E IVRGY++G+
Sbjct: 62  SFWFRQMEDIIPNHIISTDVKDFPAECQKYAAQLEGRSMLVKKAKPLPVECIVRGYISGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  + ++ KL  P+ TP+TK+       D+ IS ++ + 
Sbjct: 122 GWKDY-----KATGAICGITLPAGLVESDKLEEPIFTPSTKAELGE--HDENISFDKCVE 174

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
              + R   E I    +++++R   +A   G+I+ D+K+E+GI     +I+ DE  TPDS
Sbjct: 175 L--IGRELAEKIRDVTIAIYKRARDIADTKGIIIADTKFEYGIY-NGELIIIDECMTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  ++Y+    +       DK F+R+++ T         P +PE I+ +T + Y+ A
Sbjct: 232 SRFWPKDSYKPGGAQ----PSFDKQFLRDYLETLDWGKTAPAPPLPEEIVRKTGEKYMEA 287

Query: 286 YEKITGL 292
             ++TG 
Sbjct: 288 LVRLTGK 294


>gi|319638375|ref|ZP_07993137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           mucosa C102]
 gi|317400124|gb|EFV80783.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           mucosa C102]
          Length = 287

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSCGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|294630196|ref|ZP_06708756.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. e14]
 gi|292833529|gb|EFF91878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. e14]
          Length = 299

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 91/301 (30%), Positives = 152/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL +++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRELYRNEAGDLVMVASDRMSAYDWVLPTEIPDKGRVLTRLSLWWFER 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH +    P           LV + L+M P+E + RGYL G+            
Sbjct: 72  LADLVPNHVIGTDLPDGAPADWAGRTLVCKSLRMVPVECVARGYLTGSGLAEY-----EQ 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  +  +       +
Sbjct: 127 SRTVCGLALPEGLVDGSELPAPIFTPATKAEVGE--HDENVSYEEVARQ--VGAETAAEL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E G+IL D+K+EFG D +  ++LADE+ TPDSSR+W  + ++  
Sbjct: 183 RQATLAVYSRARDIARERGIILADTKFEFGFDGE-TLVLADEVLTPDSSRFWPADQWQPG 241

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+         R     P +PE ++  T   Y+ AYE++TG  
Sbjct: 242 RAQ----PSYDKQYVRDWLTSAESGWDRRSEQPPPPLPEKVVEATRAKYVEAYERLTGTS 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|295837595|ref|ZP_06824528.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Streptomyces sp. SPB74]
 gi|197698320|gb|EDY45253.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Streptomyces sp. SPB74]
          Length = 299

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 99/301 (32%), Positives = 157/301 (52%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L M P+E + RGYL G+            
Sbjct: 72  LADLVPNHVLSTRLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTGSGLVEYER----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ ++D  +LP P+ TP TK+       D+ +S  E+  R  +       +
Sbjct: 127 SRTVCGLALPEGLADGSELPGPIFTPATKAEVGE--HDENVSYEEVARR--IGSETAAQL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D    ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYGRGRDIARERGIILADTKFEFGFDGD-ELVLADEVLTPDSSRFWPADSWEPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P +P  I+ RT   YI AYEK+TG++
Sbjct: 242 RAQ----PSFDKQFVRDWLTSPASGWDRKSEQPPPGLPAEIVERTRAKYIEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|21229930|ref|NP_635847.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66766806|ref|YP_241568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. campestris str. 8004]
 gi|188989883|ref|YP_001901893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. campestris str. B100]
 gi|25008995|sp|Q8PD87|PUR7_XANCP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81307205|sp|Q4UZH5|PUR7_XANC8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568632|sp|B0RMY6|PUR7_XANCB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21111440|gb|AAM39771.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66572138|gb|AAY47548.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. campestris str. 8004]
 gi|167731643|emb|CAP49821.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Xanthomonas campestris pv. campestris]
          Length = 310

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYLIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P ++I 
Sbjct: 236 MDEMLTPDSSRYWPADQY----ELGTSPPSYDKQFVRDYLETLDWGKTAPGPRLPADVIE 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|325915200|ref|ZP_08177523.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325538560|gb|EGD10233.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 308

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 93/313 (29%), Positives = 149/313 (47%), Gaps = 38/313 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + L               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFELPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              K+    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKVSGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P+++I 
Sbjct: 234 MDEMLTPDSSRYWPADQY----EVGTSPPSYDKQFVRDYLETLDWGKTAPGPSLPDDVID 289

Query: 277 RTSQTYIAAYEKI 289
           RT   Y  A +++
Sbjct: 290 RTRAKYAEALQRL 302


>gi|306836861|ref|ZP_07469818.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium accolens ATCC 49726]
 gi|304567268|gb|EFM42876.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium accolens ATCC 49726]
          Length = 301

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 85/306 (27%), Positives = 154/306 (50%), Gaps = 26/306 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           MR +    +    +  SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   
Sbjct: 2   MRTMR-PELSSYTHVASGKVRDIYDVDDNTLLMVVSDRISAYDFALEPAIPDKGRVLTAT 60

Query: 60  TQYWFHHTSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           ++++F               +   +      +V ++L M P E + RG+L G+       
Sbjct: 61  SKFFFDAIDFPNHLAGPLDDDRIPEECLGRAMVVKKLDMLPFECVARGFLTGSGLKEY-- 118

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
                   +    LP  + +  +LP P+ TP TK+ +     D+ +S   +  +  L R 
Sbjct: 119 ---QADGTVCGIELPAGLVEASRLPEPIFTPATKAEQG--DHDENVSFAHVADK--LGRE 171

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           + E + +  L ++ +  +LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  +
Sbjct: 172 RAEELRAATLRIYAKAAQLAEEKGIILADTKFEFGLDEDGTLVLADEVLTPDSSRYWPAD 231

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEK 288
           +Y +   +       DK ++R+W+ +  + +        P +P++++  T   YI AYE+
Sbjct: 232 SYVEGEVQ----PSFDKQYVRDWLTSAASGWDKSSETTPPALPDDVVSATRLRYIEAYER 287

Query: 289 ITGLKF 294
           ++G +F
Sbjct: 288 LSGERF 293


>gi|225075234|ref|ZP_03718433.1| hypothetical protein NEIFLAOT_00234 [Neisseria flavescens
           NRL30031/H210]
 gi|224953409|gb|EEG34618.1| hypothetical protein NEIFLAOT_00234 [Neisseria flavescens
           NRL30031/H210]
          Length = 287

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|237748716|ref|ZP_04579196.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes OXCC13]
 gi|229380078|gb|EEO30169.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes OXCC13]
          Length = 292

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 92/304 (30%), Positives = 143/304 (47%), Gaps = 27/304 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L K  I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KG +L  +
Sbjct: 1   MPGLMKTQIKSLPFLHRGKVRDIYAVGDDKLLVVQTDRLSAFDVIMEDPIPNKGRILTAM 60

Query: 60  TQYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF     +  NH  D                   +V ++ +  PIE IVRGY+ G  
Sbjct: 61  SNFWFKKFGHLMPNHMTDIDPESLVAPHERDQVRGRAIVVKKYKAIPIEAIVRGYIIGTG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP  + + QKLP  + TP+TK+       DQ IS  ++   
Sbjct: 121 WKDYQQ-----TGAICGIKLPAGLKEAQKLPEVIFTPSTKADVGE--HDQNISFEKMKE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     E +   A++L+    + A   G+++ D+K+EFG+D    I L DEI TPDSS
Sbjct: 173 -IVGAEVAEKVREMAITLYREAAEFAATKGILIADTKFEFGMDDDGKIYLIDEILTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W + +Y      G++P   DK ++R+W+  +        P +P  +  +T++ Y  A 
Sbjct: 232 RFWPLSSY----EVGMSPPSFDKQYVRDWLSAQPWDKTAPAPRLPLEVAEKTTEKYNEAL 287

Query: 287 EKIT 290
             +T
Sbjct: 288 RLLT 291


>gi|281355388|ref|ZP_06241882.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Victivallis vadensis ATCC BAA-548]
 gi|281318268|gb|EFB02288.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Victivallis vadensis ATCC BAA-548]
          Length = 298

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 93/306 (30%), Positives = 150/306 (49%), Gaps = 29/306 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
            L +  IP L     GKVR+ Y L D   + +ATDRLSAFD  +   +P KGEVL QI+ 
Sbjct: 8   ALIQTEIPGLKLINRGKVRDVYDLGDA-LLFVATDRLSAFDVVMPNGVPRKGEVLTQISL 66

Query: 62  YWFHHTSDICSN-------------HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF    DI ++               +       ++ ++ ++ P+E IVRGYL G+   
Sbjct: 67  FWFDLMRDIPNHLISADVASRPELTAYVKDLQGRSMIVRKAKVLPVECIVRGYLVGSGWK 126

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       +    L        KL  P+ TP+TK+       D+ IS  ++   GI
Sbjct: 127 DYQK-----TGMVSGLKLRAGYQQASKLDEPLFTPSTKAEIG--DHDEAISFEQVG--GI 177

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  ++   +   +L ++      A + G+I+ D+K+EFG +    IIL DE+ TPDSSR+
Sbjct: 178 IGADKAAALRELSLKIYSTARDYAEKRGIIVADTKFEFG-EIDGRIILVDEVLTPDSSRF 236

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  + Y    + G +P+ LDK ++R+++ T         P++P N++ +TS  Y+ AY  
Sbjct: 237 WPADQY----QVGTSPVSLDKQYVRDYLETLDWNKTAPGPELPANVVKKTSDKYLEAYRM 292

Query: 289 ITGLKF 294
           +TG   
Sbjct: 293 LTGKSL 298


>gi|33592612|ref|NP_880256.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella pertussis Tohama I]
 gi|33595867|ref|NP_883510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella parapertussis 12822]
 gi|33600396|ref|NP_887956.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella bronchiseptica RB50]
 gi|39931824|sp|Q7VY42|PUR7_BORPE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|39931846|sp|Q7WB15|PUR7_BORPA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|39931857|sp|Q7WMI1|PUR7_BORBR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|33565946|emb|CAE36495.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella parapertussis]
 gi|33567995|emb|CAE31908.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella bronchiseptica RB50]
 gi|33572258|emb|CAE41810.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella pertussis Tohama I]
 gi|332382029|gb|AEE66876.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bordetella pertussis CS]
          Length = 293

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 85/302 (28%), Positives = 143/302 (47%), Gaps = 27/302 (8%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ I  LP    GKVR+ Y + D   + +A+DR+SAFD  +   IP KG+VL ++T
Sbjct: 3   SALHESSIKSLPLLGRGKVRDMYAVGDDKLLIVASDRISAFDVILDDPIPGKGQVLTELT 62

Query: 61  QYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +W    + I  NH              +D      +V ++L+   +E + RGYL G+  
Sbjct: 63  DFWLRKLAHILPNHSTGIQPEDVVAPDEVDQVRGRAVVVKRLKPILVEAVARGYLIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  +    +LP P+ TP  K+       D+ +    ++   
Sbjct: 123 KDY-----QASGSVCGIALPAGLQQASQLPEPIFTPAAKAEFGM--HDENVDFAHVVKE- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +   E I    L L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 175 -VGQEMAERIRDVTLRLYGEAARFAATKGIIIADTKFEFGLDDNGTLHLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R GI+P   DK F+R+W+ T+        P +P +++ +T+  Y  A +
Sbjct: 234 FWPADGY----RVGISPPSFDKQFVRDWLETQPWDKTPPAPRLPRDVLEKTAAKYREALD 289

Query: 288 KI 289
           ++
Sbjct: 290 RL 291


>gi|305680418|ref|ZP_07403226.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium matruchotii ATCC 14266]
 gi|305659949|gb|EFM49448.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium matruchotii ATCC 14266]
          Length = 311

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 90/303 (29%), Positives = 158/303 (52%), Gaps = 25/303 (8%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQY 62
           L +  + +  +  +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y
Sbjct: 14  LMRPELSQYNHVSAGKVREIYEIDDDTLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMY 73

Query: 63  WFHHTSD-------ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
           +F H          I      +      +V ++L+M P E +VRGYL G+          
Sbjct: 74  FFDHIDFPNHLAGDIDDMRIPEEVLGRAIVCKKLKMLPFECVVRGYLTGSGYKEY----- 128

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + ++ KLP P+ TP TK+       D+ ++  +++ +  L   +  
Sbjct: 129 LATGSVCGIPLPEGLVESSKLPEPIFTPATKADLG--DHDENVTFEQVVEK--LGERRAT 184

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +++++++  +LA   G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW +E YE
Sbjct: 185 ELRDASINIYKQAAELAEAKGIILADTKFEFGVDRDGTLVLADEVLTPDSSRYWPLEGYE 244

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++RNW+ +    +        P +P +++  T + Y+ A+E+ITG
Sbjct: 245 P----GKVQPSFDKQYVRNWLTSSKCDWQVDSNATPPPLPGSVVEATRERYVEAFERITG 300

Query: 292 LKF 294
            KF
Sbjct: 301 EKF 303


>gi|59800779|ref|YP_207491.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA 1090]
 gi|268596380|ref|ZP_06130547.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|268681648|ref|ZP_06148510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
 gi|59717674|gb|AAW89079.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria gonorrhoeae FA 1090]
 gi|268550168|gb|EEZ45187.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|268621932|gb|EEZ54332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
          Length = 319

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 37  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 96

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 97  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 152

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 153 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 207

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 208 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 265

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 266 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|282863504|ref|ZP_06272563.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. ACTE]
 gi|282561839|gb|EFB67382.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. ACTE]
          Length = 309

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 88/309 (28%), Positives = 152/309 (49%), Gaps = 31/309 (10%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFEQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH +    P           ++ + L+M P+E + RGYL G+            
Sbjct: 72  LADLVPNHVISTELPAGAPADWAGRTMICRSLRMVPVECVARGYLTGSGLAEY-----KA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + +    LP+ + D  +LP  + TP TK++      D+ +S  E+     +       +
Sbjct: 127 TQTVCGMGLPEGLVDGSELPGAIFTPATKAAVG--DHDENVSYEEVARE--VGAETAAEL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVET 233
               L+++ R   +A E G+IL D+K+EFG     D  + +++ADE+ TPDSSR+W   +
Sbjct: 183 RQTTLAVYGRARDIARERGIILADTKFEFGFAPTEDGGEELVIADEVLTPDSSRFWPAAS 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKI 289
           +E    +       DK F+R+W+    + +        P +P+ I+  T   Y+ AYE +
Sbjct: 243 WEPGKAQ----PSYDKQFVRDWLTAPESGWDRHGEQPPPALPQEIVDATRAKYLDAYEHL 298

Query: 290 TGLKFIADN 298
           TGL +    
Sbjct: 299 TGLNWADAP 307


>gi|302531063|ref|ZP_07283405.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. AA4]
 gi|302439958|gb|EFL11774.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. AA4]
          Length = 293

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 156/302 (51%), Gaps = 26/302 (8%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
             + + P   +GKVR+ Y + D   + + +DR+SA+D  +   IP KG VL  ++ +WF 
Sbjct: 2   TTLADYPKIAAGKVRDLYAVGDDHLLLVTSDRISAYDFILDTPIPDKGRVLTAMSVFWFE 61

Query: 66  HTSDICSNHTLDYPDPNVL--------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             SD+  NH + Y DP +         + ++L M P+E + RGYL G+  +         
Sbjct: 62  QLSDLIPNHLVAYDDPRIPAEVRGRALLVRRLDMLPVEAVARGYLTGSGYSDYQR----- 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + +  KLP P+ TP TK++      D+ +S + ++    +   + E +
Sbjct: 117 TGAVCGVELPEGLVEASKLPSPIFTPATKAAFGE--HDENVSFDAVVA--TIGAKRAEEL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG ++A + G++L D+K+EFG+D+   ++LADE+ TPDSSRYW  E YE  
Sbjct: 173 REATLAVYRRGAEVAAKRGILLADTKFEFGVDETGALVLADEVLTPDSSRYWPAEGYEPG 232

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++RNW+           N   P +P  ++  T   Y+ AYE++TGL 
Sbjct: 233 RVQ----PSFDKQYVRNWLTGPESGWDRASNVQPPPLPSEVVEATRGRYVEAYERMTGLS 288

Query: 294 FI 295
             
Sbjct: 289 LE 290


>gi|227494303|ref|ZP_03924619.1| phosphoribosylamine-glycine ligase [Actinomyces coleocanis DSM
           15436]
 gi|226832037|gb|EEH64420.1| phosphoribosylamine-glycine ligase [Actinomyces coleocanis DSM
           15436]
          Length = 730

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 80/297 (26%), Positives = 145/297 (48%), Gaps = 22/297 (7%)

Query: 8   YIPELPNYYSGKVRENY--FLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF 64
            +P   +   GKVR+ Y     D   + +A+DR+SA+D  +   IP KG++L Q++ +WF
Sbjct: 448 EVPGWTHVSQGKVRDLYVNDEDDSLLLVVASDRISAYDYVLDTPIPDKGKILTQLSAWWF 507

Query: 65  HHT---SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                 + + S    +      ++ ++L M+P+E + RGYL G+               +
Sbjct: 508 EQLGVENHVVSLDVPEVVAGRAMICRRLSMYPVECVARGYLTGSGLKEYRESQ-----SV 562

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP  +++   LP P+ TP  K+       D+ +S   ++    +     E++ +  
Sbjct: 563 CGVSLPAGLTEASVLPEPIFTPAAKAEVGE--HDENVSFERVVEM--VGPEVAESLRAAT 618

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++ +   +A E G+IL D+K+EFG      +IL DE+ TPDSSR+W  + + +    G
Sbjct: 619 LEVYSKAAAIAAERGIILADTKFEFGHI-DGRLILGDEVLTPDSSRFWPADQWVE----G 673

Query: 242 ITPIGLDKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
                 DK ++R+W+++       +   P +P  ++  T   Y+ A+EK+TG  F A
Sbjct: 674 QVTPSFDKQYVRDWLVSDGAGWDRQSTPPALPAEVVEATRARYVEAFEKLTGRVFQA 730


>gi|71909252|ref|YP_286839.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dechloromonas aromatica RCB]
 gi|123626483|sp|Q479W2|PUR7_DECAR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71848873|gb|AAZ48369.1| SAICAR synthetase [Dechloromonas aromatica RCB]
          Length = 310

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 97/321 (30%), Positives = 141/321 (43%), Gaps = 38/321 (11%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   L ++ I  LP    GKVR+ Y +     + + TDRLSAFD  +   IP KGEVL  
Sbjct: 1   MTAPLFESTITSLPLINKGKVRDIYAVDADKLLIVTTDRLSAFDVILPDPIPRKGEVLQA 60

Query: 59  ITQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
           +  +WF     I  N                +      +V ++L+  PIE +VRGY+ G+
Sbjct: 61  VANFWFDKLGHIVPNQLTGIDPETVVAENEREQVRGRAVVVKRLKPLPIEAVVRGYVIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  +    KLP P+ TP TK++      D+ +S      
Sbjct: 121 GWKDYQE-----TGAICGIALPAGLKMAAKLPSPIFTPATKAAVG--DHDENVSFATAQA 173

Query: 166 R------------GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN 213
                        G       +     A+ L+E     A   G+I+ D+K+EFGID    
Sbjct: 174 NCAADLAEALAGTGKNGAGLADEARIAAIRLYEEASAYARGRGIIIADTKFEFGIDAAGT 233

Query: 214 IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPEN 273
           + L DE  TPDSSR+W  + Y++    G  P   DK ++R+++ T         P +P +
Sbjct: 234 LHLIDEALTPDSSRFWPADHYQE----GSNPPSYDKQYVRDYLETLDWGKVAPGPKLPAD 289

Query: 274 IILRTSQTYIAAYEKITGLKF 294
           +I RTS  YI AYEK+TG   
Sbjct: 290 VIARTSAKYIEAYEKLTGKTL 310


>gi|302552512|ref|ZP_07304854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces viridochromogenes DSM 40736]
 gi|302470130|gb|EFL33223.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces viridochromogenes DSM 40736]
          Length = 299

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/301 (30%), Positives = 156/301 (51%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRELYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + LQM P+E + RGYL G+            
Sbjct: 72  LADLVPNHVLSTELPAGAPADWEGRTLVCKSLQMVPVECVARGYLTGSGLVEYEE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    +
Sbjct: 127 TRTVCGLALPEGLVDGSELPAPIFTPATKAAVGE--HDENVSYEEVARQ--VGADTAARL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D   +++LADE+ T DSSR+W  + ++  
Sbjct: 183 RQATLAVYSRGRDIARERGIILADTKFEFGFDGD-DLVLADEVLTADSSRFWPADQWQPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P +P+ ++  T   Y+ AYE++TG  
Sbjct: 242 RAQ----PSYDKQFVRDWLTSAESGWDRKSEQPPPALPQQVVDATRAKYVEAYERLTGTS 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|296313830|ref|ZP_06863771.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           polysaccharea ATCC 43768]
 gi|296839559|gb|EFH23497.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           polysaccharea ATCC 43768]
          Length = 287

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH   +              +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W    Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPAGQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|261400441|ref|ZP_05986566.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           lactamica ATCC 23970]
 gi|269209891|gb|EEZ76346.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           lactamica ATCC 23970]
          Length = 287

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/297 (31%), Positives = 144/297 (48%), Gaps = 27/297 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF  
Sbjct: 2   SVTGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKK 61

Query: 67  TSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            + I  NH                  +   +V ++L    +E IVRGYLAG+        
Sbjct: 62  LAHIMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK- 120

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                  +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +  
Sbjct: 121 ----TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKEL 172

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +   A+ L+    + A   G+I+ D+K+EFG+DK   + L DE+ TPDSSR+W  + 
Sbjct: 173 AAEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDKNGTLTLMDEVLTPDSSRFWPADQ 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           Y      G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 233 Y----EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|149173966|ref|ZP_01852595.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces maris DSM 8797]
 gi|148847496|gb|EDL61830.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces maris DSM 8797]
          Length = 296

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 86/305 (28%), Positives = 150/305 (49%), Gaps = 32/305 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
             +++ +  +P    GKVR+ Y   D   + +ATDR+SAFD  +   IP KG VL QI++
Sbjct: 5   AFTESTLSGIP-VKRGKVRDVYDFGD-RLLFVATDRISAFDWILTPGIPDKGRVLTQISR 62

Query: 62  YWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
           +WF   + I ++     P                  +V ++ ++ P E +VRGYL+G+  
Sbjct: 63  FWFERFTGISNHLLSMNPSDLPLPADADLEALRGRCMVVRKTEVVPFECVVRGYLSGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  M  + +LP P+ TP TK+       D+ +S   +  R 
Sbjct: 123 KDY-----LANGAVCGIELPAGMQQSDQLPEPLFTPATKAETG---HDENVSFQTM--RD 172

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +     + +   ++ ++++G + A + G+IL D+K+EFG+      IL DE+ TPDSSR
Sbjct: 173 AIGGELADRLRELSIQIYQQGSEYARQKGIILADTKFEFGLL-NGEPILIDEVLTPDSSR 231

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y+    +      LDK F+R+W+ T         P +P+ I+++T + Y  A++
Sbjct: 232 FWPADLYQPGGAQ----PSLDKQFVRDWLETTTWDKNSTPPVLPDEIVMKTREKYFEAFQ 287

Query: 288 KITGL 292
            +TG 
Sbjct: 288 MLTGQ 292


>gi|303327442|ref|ZP_07357883.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Desulfovibrio sp. 3_1_syn3]
 gi|302862382|gb|EFL85315.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Desulfovibrio sp. 3_1_syn3]
          Length = 295

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 90/308 (29%), Positives = 150/308 (48%), Gaps = 30/308 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+++ K  I   P    GKVR+ Y + + T + + TDR+SAFD  +   IPYKG +LN+I
Sbjct: 1   MKVVVKTDITAYPLLSRGKVRDIYDVDEKTLLIVTTDRMSAFDVIMSEPIPYKGVILNKI 60

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     DI  NH L+                 +   ++ ++ +  P+E IVRGY+ G
Sbjct: 61  TLFWMDKFKDIIPNHLLESDVNRFPAALAPWKDELEGRAVLVRKAKPLPVECIVRGYITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              ++  Y LP+ + ++ KL   + TP+TK+       D+ IS  E  
Sbjct: 121 SGWKDY-----QATGQLCGYRLPEGLRESDKLEPALFTPSTKAELGQ--HDENISVAEAA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
               L  +        +L+++E G   A   G+I+ D+K+EFG     ++ L DE+ TPD
Sbjct: 174 RL--LGEDTARLAEKTSLAIYEAGRAYASGRGIIVADTKFEFGFI-DGSLHLIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + Y+    +       DK ++R+W+  +    +   P +PE +I  T++ Y  
Sbjct: 231 SSRFWPADQYKAGQGQ----PSFDKQYLRDWLKKQPWNMQPPPPHLPEEVIQATAERYKE 286

Query: 285 AYEKITGL 292
           AYE +T  
Sbjct: 287 AYEILTSE 294


>gi|296130790|ref|YP_003638040.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Cellulomonas flavigena DSM 20109]
 gi|296022605|gb|ADG75841.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Cellulomonas flavigena DSM 20109]
          Length = 318

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 86/310 (27%), Positives = 149/310 (48%), Gaps = 36/310 (11%)

Query: 8   YIPELPNYYSGKVRENYFLSD------------GTRITIATDRLSAFDQNI-ACIPYKGE 54
           ++P   + YSGKVR+ Y                   + +A+DR+SA+D  +   IP KG 
Sbjct: 20  HLPGWRHVYSGKVRDLYEPDASPEGVALRQRHGDVVLVVASDRVSAYDHVLSPGIPGKGV 79

Query: 55  VLNQITQYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           VL Q++ +WF   +D+  NH +    P       +V ++L MFP+E + RGYL G+    
Sbjct: 80  VLTQLSLWWFEQLTDLVPNHVVSTDVPEAVAGRAMVCRRLDMFPVECVARGYLTGSGLAE 139

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                     ++    LP  + D  +LP P+ TP TK+       D+ +  + ++    +
Sbjct: 140 YRE-----NGEVTGIALPTGLVDGSRLPEPIFTPATKAELG--DHDENVRFSVVVD--TV 190

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTPDSSRY 228
                ET+    L+++ R   +A E G++L D+K EFG D     +   + + TPDSSR+
Sbjct: 191 GPETAETLRDLTLAVYARAEGVARERGVVLADTKLEFGTDPVTGAVTLGDEVLTPDSSRF 250

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIA 284
           W  + +E    +       DK F+R+W+ +  + +        P +P++++ RT   Y+ 
Sbjct: 251 WPADAWEPGHAQ----PSFDKQFVRDWLTSDASGWDRASDAPPPALPDDVVERTRARYLE 306

Query: 285 AYEKITGLKF 294
           AYE++TG   
Sbjct: 307 AYERLTGRPL 316


>gi|254493245|ref|ZP_05106416.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 1291]
 gi|268598509|ref|ZP_06132676.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|268683875|ref|ZP_06150737.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268686118|ref|ZP_06152980.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|226512285|gb|EEH61630.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 1291]
 gi|268582640|gb|EEZ47316.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|268624159|gb|EEZ56559.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626402|gb|EEZ58802.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 319

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 37  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 96

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 97  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 152

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 153 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 207

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 208 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 265

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 266 --EVGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|119718556|ref|YP_925521.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardioides sp. JS614]
 gi|119539217|gb|ABL83834.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardioides sp. JS614]
          Length = 284

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 92/296 (31%), Positives = 149/296 (50%), Gaps = 23/296 (7%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           IP   + +SGKVR+ Y L  G  + +A+DR+S FD  +   IP KGE+L +++ +WF   
Sbjct: 2   IPGATHLHSGKVRDLYELPGGELLMVASDRISIFDFVLDTTIPDKGEILTRMSLWWFDRL 61

Query: 68  SDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +D+  NH L    P       +V ++L M+P+E + RGYL G+               + 
Sbjct: 62  ADLVPNHVLSTDVPPEVRGRAVVCERLAMYPVECVARGYLTGSGLVDY-----RASGAVC 116

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP  + D  +LP PV TP TK+       D+ +S + +   G +  ++   +    L
Sbjct: 117 GIALPAGLVDGSRLPEPVFTPATKAELGE--HDENVSYDAVA--GTVGADRAAELRDLTL 172

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            ++ R   +A E G+IL D+K EFG       +LADE+ TPDSSR+W    +E    +  
Sbjct: 173 RVYARAESIARERGIILADTKLEFGARPDGTTVLADEVLTPDSSRFWPAAEWEPGHAQ-- 230

Query: 243 TPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                DK  +RNW L+  + +     +  P +P  ++ RT   Y+ A+E +TG ++
Sbjct: 231 --PSYDKQIVRNWALSPESGWDRSSGEAPPPLPAEVVERTRSRYVEAFELLTGERW 284


>gi|223938791|ref|ZP_03630679.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [bacterium
           Ellin514]
 gi|223892489|gb|EEF58962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [bacterium
           Ellin514]
          Length = 297

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 89/307 (28%), Positives = 149/307 (48%), Gaps = 32/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L +  +P +    SGKVRE + L D   + +ATDR+SAFD  +   IP KGEVL QI+
Sbjct: 4   EPLLQLDLPGIRKLKSGKVREVFDLGD-RLLFVATDRISAFDCIMPNGIPRKGEVLTQIS 62

Query: 61  QYWFHHTSDICSNHTLDYPDP---------------NVLVGQQLQMFPIELIVRGYLAGN 105
            +WF   +    NH L  P+                  ++ ++ Q   IE +VRGYLAG+
Sbjct: 63  YFWFDQMASFQPNHLLSKPNDSLPILLQPYAAQLAGRCMIVKKAQPLAIECVVRGYLAGS 122

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          +    LP  + ++ +LP P+ TP TK+       D+ IS  E   
Sbjct: 123 GWKEYQERQ-----TVCGIKLPAGLKESSELPEPIFTPATKAESG---HDENISFEE--A 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             ++  +  E   S ++ +++   + A + G+I+ D+K+EFG+     ++L DE+ TPDS
Sbjct: 173 SKLVGSDIAEKARSASMKIYKFAREYARQRGIIIADTKFEFGLFDD-ELLLIDEVLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y+    +       DK F+R+++ T         P +P  ++ ++   Y+ A
Sbjct: 232 SRFWPADQYQPGRSQ----PSFDKQFVRDYLETLDWDKTPPAPKLPPEVVEKSQAKYLDA 287

Query: 286 YEKITGL 292
           Y ++TG 
Sbjct: 288 YHRLTGQ 294


>gi|184200075|ref|YP_001854282.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kocuria
           rhizophila DC2201]
 gi|183580305|dbj|BAG28776.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kocuria
           rhizophila DC2201]
          Length = 323

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 94/322 (29%), Positives = 157/322 (48%), Gaps = 39/322 (12%)

Query: 8   YIPELPNYYSGKVRENYFLSDGT------------------RITIATDRLSAFDQNIAC- 48
            IP   + YSGKVRE Y   +                     + +A+DR+SAFDQ +   
Sbjct: 9   EIPGWKHVYSGKVRELYVPDESRMTATGVAIHDDAEYRAGAVLVVASDRISAFDQVLPTE 68

Query: 49  IPYKGEVLNQITQYWFHHTSDICSN----HTLDYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           IP KG +L Q++ +WF     I ++       +      +V + L MFP+E IVRGYL G
Sbjct: 69  IPDKGTILTQLSLWWFEQLDGIPNHILSTDVHESVRGRAVVCKNLSMFPVENIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +      T        +    LP+ + D  +L  P+ TPT K++      D+PI+  E+ 
Sbjct: 129 SGLKDYRT-----TGSVCGIELPEGLQDGDRLEQPIFTPTGKAALGE--HDEPITYREMA 181

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTP 223
              ++  +  + +   +L ++ R  ++A E G+I+ D+K EFG+D  +  I   + + TP
Sbjct: 182 D--VVGNSVADRLRELSLKIYTRAERIARERGIIVADTKVEFGLDSYRGAITLGDEVLTP 239

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQT 281
           DSSR+W++ETY     +       DK ++R+W+ +          +P +PE+++ RT + 
Sbjct: 240 DSSRFWDMETYRPGRAQ----PSFDKQYVRDWLRSDASGWDGHGPVPQLPEDVVARTRER 295

Query: 282 YIAAYEKITGLKFIADNSELPP 303
           Y+ AYE++TG  F      L  
Sbjct: 296 YVEAYERLTGRVFDPRGPFLEV 317


>gi|326203382|ref|ZP_08193247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium papyrosolvens DSM 2782]
 gi|325986640|gb|EGD47471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium papyrosolvens DSM 2782]
          Length = 298

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 99/312 (31%), Positives = 155/312 (49%), Gaps = 32/312 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +L+     +LP +  GKVR  Y L D   + + TDR+SAFD      IP KG VLN I+ 
Sbjct: 2   LLNNTDFIKLPLFVKGKVRNVYDLGDQ-LLIVVTDRISAFDVVFDELIPNKGTVLNSISA 60

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF  T D+  NH +               D      ++ +++QM P E IVRGYL G+ 
Sbjct: 61  FWFDFTKDVIGNHVITTDVDKYPKELSAFKDELQGRSMLVKKVQMLPAECIVRGYLEGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  +    KLP P+ TP+TK SE     D  +S   +  +
Sbjct: 121 LKEYQK-----TGTVCGIKLPAGLKQADKLPEPIFTPSTKESEG---HDINVSFEVLCEK 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +     + +   +L L+E+  K A   GLIL D+K+EFG+     +++ DE+ TPDSS
Sbjct: 173 --IGLEMAQKLKDASLKLYEKASKHAESKGLILADTKFEFGML-DGELVVGDEMFTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W ++ Y+    +       DK ++R ++ +     +   P++P+ +I +T + Y+ AY
Sbjct: 230 RFWAMDEYQPGRAQ----KSFDKQYLREYLESITWDKQPPAPELPKEVIRKTEEKYVEAY 285

Query: 287 EKITGLKFIADN 298
           E+ITG KF  DN
Sbjct: 286 ERITGKKFQGDN 297


>gi|268603167|ref|ZP_06137334.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
 gi|268587298|gb|EEZ51974.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
          Length = 319

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 37  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 96

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 97  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 152

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 153 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 207

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + Y  
Sbjct: 208 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQY-- 265

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 266 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|313668763|ref|YP_004049047.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           lactamica ST-640]
 gi|313006225|emb|CBN87687.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria lactamica 020-06]
          Length = 287

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 92/297 (30%), Positives = 144/297 (48%), Gaps = 27/297 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF  
Sbjct: 2   SVTGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKK 61

Query: 67  TSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            + I  NH                  +   +V ++L    +E IVRGYLAG+        
Sbjct: 62  LAHIMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK- 120

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                  +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +  
Sbjct: 121 ----TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKEL 172

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +   A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + 
Sbjct: 173 AAEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQ 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           Y      G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 233 Y----EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|325927747|ref|ZP_08188975.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas perforans 91-118]
 gi|325541948|gb|EGD13462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas perforans 91-118]
          Length = 308

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 94/313 (30%), Positives = 149/313 (47%), Gaps = 38/313 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + L               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDLPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 123 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P ++I 
Sbjct: 234 MDEMLTPDSSRYWPADQYEP----GTSPPSYDKQFVRDYLETLDWGKTAPGPRLPADVID 289

Query: 277 RTSQTYIAAYEKI 289
           RT   Y  A +++
Sbjct: 290 RTRAKYAEALQRL 302


>gi|221632755|ref|YP_002521977.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermomicrobium roseum DSM 5159]
 gi|221155602|gb|ACM04729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermomicrobium roseum DSM 5159]
          Length = 302

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 91/305 (29%), Positives = 143/305 (46%), Gaps = 29/305 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
            ++    IPELP Y  GKVRE + L D   + +ATDRLSAFD  +   IP KG VL Q++
Sbjct: 5   EVVLHVDIPELPVYRRGKVREVFDLGD-CLLLVATDRLSAFDVILPNGIPGKGIVLTQLS 63

Query: 61  QYWFHHTSDICSNHTLDYPDP------------NVLVGQQLQMFPIELIVRGYLAGNTKT 108
            +WF    D    H +    P              +V ++ +   IE + RGYLAG+   
Sbjct: 64  VFWFRWFGDRLRTHFVTTELPAIVDRYRRMLAGRSMVVRKAERIDIECVARGYLAGSAWQ 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       +    LP  M ++++L  P+ TP  K        D+ IS   ++ R  
Sbjct: 124 EYRE-----TGCVAGIRLPPGMRESEQLAEPIFTPAIKVDGG---HDENISFERLVER-- 173

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +       +    L ++    K A E G+I+ D+K EFG      + + DE+ TPDSSR+
Sbjct: 174 VGSELARELRERTLWIYRVAEKYARERGVIIADTKIEFGWI-DGELAVIDELLTPDSSRF 232

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W+ E Y+    +       DK F+R+W+ T     +   P +P +++ +T++ Y  AY +
Sbjct: 233 WDAERYQPGRPQ----PSFDKQFVRDWLTTIGWNKQPPAPRLPADVVEKTAEKYREAYRR 288

Query: 289 ITGLK 293
           +TG  
Sbjct: 289 LTGQP 293


>gi|329938782|ref|ZP_08288178.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoaurantiacus M045]
 gi|329302273|gb|EGG46165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoaurantiacus M045]
          Length = 299

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 92/301 (30%), Positives = 158/301 (52%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG +L Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRELYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRILTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+   H L    P           LV + L+M P+E + RGYL G+          N 
Sbjct: 72  LADLVPGHVLSTELPAGAPADWRGRTLVCKSLRMVPVECVARGYLTGSGLVEY-----NA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    +
Sbjct: 127 SRTVCGLALPEGLVDGSELPAPIFTPATKAAVG--DHDENVSYEEVARQ--VGADTAARL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A + G++L D+K+EFG D    ++LADE+ TPDSSR+W  E +E  
Sbjct: 183 RQATLAVYVRGRDIARDRGILLADTKFEFGFDGD-ELVLADEVLTPDSSRFWPAEEWEPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P +P+ ++  T   Y+ AYE++TG++
Sbjct: 242 RAQ----PSYDKQFVRDWLTSPASGWDRTAEQPPPALPDEVVEATRGKYVEAYERLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|56476026|ref|YP_157615.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aromatoleum aromaticum EbN1]
 gi|81821200|sp|Q5P7J7|PUR7_AZOSE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|56312069|emb|CAI06714.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aromatoleum aromaticum EbN1]
          Length = 311

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 92/319 (28%), Positives = 142/319 (44%), Gaps = 37/319 (11%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           + L ++ I  LP    GKVR+ Y +     + + +DRLSAFD  +   IP KG VL  + 
Sbjct: 3   QPLFESTIKSLPLLGRGKVRDIYAVDADKLLIVTSDRLSAFDVILPDPIPDKGRVLTAMA 62

Query: 61  QYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I  N                D      LV ++L+  PIE +VRGY+ G+  
Sbjct: 63  AFWFARLGHIVPNQLTGIDPESVVASDERDQVRGRSLVVKRLKPLPIEAVVRGYVIGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR- 166
                        I    LP  ++   KLP P+ TP +K+       D+ IS      R 
Sbjct: 123 KDYQD-----TGAICGIRLPAGLAQAAKLPSPIFTPASKADVG--DHDENISFAAAQTRC 175

Query: 167 -----------GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNII 215
                      G             A++L+      A   G+I+ D+K+EFGID    + 
Sbjct: 176 AAELTGLLAGSGTNGARLATEARDAAITLYVEAANYAAGRGIIIADTKFEFGIDSAGTLH 235

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           L DE  TPDSSR+W  ++Y +    GI+P   DK ++R+++ T     +   P +P ++I
Sbjct: 236 LIDEALTPDSSRFWPADSYRE----GISPPSYDKQYVRDYLETLTWGKKAPGPHLPADVI 291

Query: 276 LRTSQTYIAAYEKITGLKF 294
            +T+  Y  A+E++TG   
Sbjct: 292 AKTAAKYREAFERLTGQSL 310


>gi|289669427|ref|ZP_06490502.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 310

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 93/313 (29%), Positives = 148/313 (47%), Gaps = 38/313 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPANAPPGDYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPTLYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              KI    LPD +   +K P P+ TP+TK++      D+
Sbjct: 125 IARGYLIGSGWKDYQR-----TGKISGIELPDGLRQAEKRPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E+G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAEHGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P  +I 
Sbjct: 236 MDEMLTPDSSRYWPADQYEP----GTSPPSYDKQFVRDYLETLEWGKTAPGPRLPAEVID 291

Query: 277 RTSQTYIAAYEKI 289
           RT   Y  A +++
Sbjct: 292 RTRAKYAEALQRL 304


>gi|257054887|ref|YP_003132719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Saccharomonospora viridis DSM 43017]
 gi|256584759|gb|ACU95892.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Saccharomonospora viridis DSM 43017]
          Length = 283

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 82/297 (27%), Positives = 142/297 (47%), Gaps = 22/297 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           + + ++GKVR+ Y    G  + +A+DR+S +D  +   IP KG +L Q++ +WF    DI
Sbjct: 1   MKHLHAGKVRDLYS-DRGDLLLVASDRVSVYDVPLPTPIPGKGALLTQLSVWWFERFRDI 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +             +  + L M  +E + RGYL G+               +   
Sbjct: 60  VPNHLISATDVPAEFAGRAIRCRPLTMIKVECVARGYLTGSALQEYRR-----SSTVCGV 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +  KLP P+ TPTTK+       D P++ ++++ +    R   E +    L +
Sbjct: 115 PLPSGLVEGSKLPEPIFTPTTKADTG---HDLPMTFDDVVAQE--GRETAERLRDLTLRI 169

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           +  G + A E G+++ D+K EFG D    + L DE+ T DSSR+W  + +E    +    
Sbjct: 170 YREGAEYAAERGILVADTKLEFGWDADGVLTLGDEVLTSDSSRFWPADQWEPGRPQ---- 225

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
              DK ++R+W ++         P +P +++  T Q YI  YE++TG  + +  S  
Sbjct: 226 HSFDKQYVRDWAVSTGWDKTPPGPAVPPDVVEATRQRYIDVYERLTGRTWDSPGSPA 282


>gi|227502108|ref|ZP_03932157.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium accolens ATCC 49725]
 gi|227077167|gb|EEI15130.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium accolens ATCC 49725]
          Length = 301

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/306 (27%), Positives = 153/306 (50%), Gaps = 26/306 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           MR +    +    +  SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   
Sbjct: 2   MRTMR-PELSSYTHVASGKVRDIYDVDDTTLLMVVSDRISAYDFALEPAIPDKGRVLTAT 60

Query: 60  TQYWFHHTSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           ++++F                   +      +V ++L M P E + RG+L G+       
Sbjct: 61  SKFFFDAIDFPNHLAGPLDDERIPEECLGRAMVVKKLDMLPFECVARGFLTGSGLKEY-- 118

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
                   +    LP  + +  +LP P+ TP TK+ +     D+ +S   +  +  L R 
Sbjct: 119 ---QADGTVCGIELPAGLVEASRLPEPIFTPATKAEQG--DHDENVSFAHVADK--LGRE 171

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           + E + +  L ++ +  +LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  +
Sbjct: 172 RAEELRAATLRIYAKAAQLAEEKGIILADTKFEFGLDEDGTLVLADEVLTPDSSRYWPAD 231

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEK 288
           +Y +   +       DK ++R+W+ +  + +        P +P++++  T   YI AYE+
Sbjct: 232 SYVEGEVQ----PSFDKQYVRDWLTSAASGWDKSSETTPPALPDDVVSATRLRYIEAYER 287

Query: 289 ITGLKF 294
           ++G +F
Sbjct: 288 LSGERF 293


>gi|325067828|ref|ZP_08126501.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Actinomyces oris K20]
          Length = 316

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 84/304 (27%), Positives = 151/304 (49%), Gaps = 30/304 (9%)

Query: 9   IPELPNYYSGKVRENYFL-------SDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y              + +A+DR+SA+D  +A  IP KG+VL  ++
Sbjct: 24  VPGWEHRSSGKVRDVYAPTSDGPWGGQDVLLVVASDRISAYDHILATPIPDKGKVLTALS 83

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +D+  NH +    P       ++ ++L+M+P+E + RGYL G+          
Sbjct: 84  AWWFEQLADVVPNHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTGSGLVEYRQ--- 140

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
              R +    LP+ +++  +LP P+ TP  K+       D+ ++   ++    +  +   
Sbjct: 141 --SRSVCGVALPEGLTEASRLPEPIFTPAAKAELGE--HDENVTFERVVQM--VGDSAAT 194

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+L+ R  ++A + G+IL D+K+E G D    +IL DE+ TPDSSR+W  + +E
Sbjct: 195 ALRETTLALYSRAAEIARDRGIILADTKFELGTDADGELILGDEVLTPDSSRFWPADAWE 254

Query: 236 KSFREGITPIGLDKDFIRNWILTR----CNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++R+W+ +             P +P++++ RT   Y+ AYE++TG
Sbjct: 255 P----GRVTPSFDKQYVRDWLTSPASGWDRDGGQEPPALPDDVVERTRARYLEAYERLTG 310

Query: 292 LKFI 295
               
Sbjct: 311 HPLE 314


>gi|190576141|ref|YP_001973986.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas maltophilia K279a]
 gi|226724560|sp|B2FKM0|PUR7_STRMK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|190014063|emb|CAQ47703.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas maltophilia K279a]
          Length = 310

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 93/315 (29%), Positives = 148/315 (46%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CIP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRERLPAGTPPGEYLLMVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIEL 96
            KGE+L Q++ +WF  T+ +  NH                       +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFAKTAHLMPNHLTGIDVASVLPEGVDPALYARRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              K+    LPD +   ++LP P+ TP+TK++      D+
Sbjct: 125 IARGYLIGSGWKDYQR-----TGKVSGIDLPDGLRQAEQLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++ +  +     E +    L +++     A E G+IL D+K+EFG D    + +
Sbjct: 178 NIDFDAMVKQ--VGAELAERVRDATLRIYKFAADYARERGIILADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P IP  II 
Sbjct: 236 MDEMLTPDSSRYWPADEY----EVGTSPPSYDKQFVRDYLETLDWGKTAPGPTIPAEIIE 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|261378781|ref|ZP_05983354.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           cinerea ATCC 14685]
 gi|269144759|gb|EEZ71177.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           cinerea ATCC 14685]
          Length = 287

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 92/297 (30%), Positives = 148/297 (49%), Gaps = 27/297 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF  
Sbjct: 2   SVTSLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKK 61

Query: 67  TSDICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            + I  NH   +              +   +V ++L    +E IVRGYLAG+        
Sbjct: 62  LAHIMPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK- 120

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                  +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +  
Sbjct: 121 ----TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKEL 172

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + 
Sbjct: 173 AAEVRTKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQ 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           Y    + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 233 Y----KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|222056569|ref|YP_002538931.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. FRC-32]
 gi|254783964|sp|B9M5S1|PUR7_GEOSF RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|221565858|gb|ACM21830.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. FRC-32]
          Length = 296

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 149/307 (48%), Gaps = 31/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           +++     P+L     GKVR+ Y L + T + + TDR+SAFD  +   IP KG VL QI+
Sbjct: 3   KLVLTTDFPDLKLAARGKVRDIYDLGE-TLLIVTTDRISAFDVIMNEGIPDKGYVLTQIS 61

Query: 61  QYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +               D  +   ++ ++ +  P E IVRGY++G+
Sbjct: 62  AFWFRQMEDIIKNHIISTEVKDFPSACQKYADILEGRSMLVKKAKPLPAECIVRGYISGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP+ + ++ +LP P+ TP+TK+       D+ IS  +++ 
Sbjct: 122 GWKDY-----KATGSICGIKLPEGLKESDRLPQPIFTPSTKAELG--THDENISFEKMVE 174

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
                +   E +    L ++ +   +A   G+I+ D+K+E+GI     +I+ DE  TPDS
Sbjct: 175 L--CGKETAEKVRDVTLKIYMKARDIADTKGIIIADTKFEYGIY-NGELIIIDECMTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  ++Y     +       DK F+R+++ T         P +PE I+ +T + Y+ A
Sbjct: 232 SRFWPKDSYHPGGPQ----PSFDKQFLRDYLETLDWNKSAPAPPLPEEIVRKTGEKYMEA 287

Query: 286 YEKITGL 292
             K+TG 
Sbjct: 288 LVKLTGK 294


>gi|27375923|ref|NP_767452.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium japonicum USDA 110]
 gi|39931935|sp|Q89W81|PUR72_BRAJA RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           B; AltName: Full=SAICAR synthetase 2
 gi|27349061|dbj|BAC46077.1| purC [Bradyrhizobium japonicum USDA 110]
          Length = 304

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/313 (27%), Positives = 148/313 (47%), Gaps = 30/313 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P LP    GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTMLSSDLP-LPKIGRGKVRDIYAVDDDRLLLLTTDRISAFDVVMGETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAFWFGELEGVVPHHMISADTDEIIAAVPALKPHRAEILGRAMLSRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           L+G+      T        +    L   + +++KL   + +P TK+       D+ I+  
Sbjct: 120 LSGSAWKEYAT-----SGTLAGEKLKAGLVESEKLEPAIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R ++      T+ S   +++  G +LA E G+I+ D+K+EFG DK   IIL DE+ 
Sbjct: 172 RM--REVVGDETAYTLESMTRAIYTLGEELAREQGIIIADTKFEFGRDKDGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W V+ Y+    +        +D++               P +P +++  TS+ 
Sbjct: 230 TPDSSRFWAVDAYKPGQPQASFDKQPLRDYLDVERRAGRWNGDAPPPPLPASVVEATSKR 289

Query: 282 YIAAYEKITGLKF 294
           Y+ AY ++TG + 
Sbjct: 290 YLEAYRRVTGKEL 302


>gi|78222136|ref|YP_383883.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           metallireducens GS-15]
 gi|123572439|sp|Q39X66|PUR7_GEOMG RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|78193391|gb|ABB31158.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           metallireducens GS-15]
          Length = 296

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 84/307 (27%), Positives = 146/307 (47%), Gaps = 31/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
            ++ K   P+L     GKVR+ Y L +   + + TDR+SAFD  +   IP KG VL QI+
Sbjct: 3   NLVLKTDFPDLKLVARGKVRDIYDLGEA-LLIVTTDRISAFDVIMNEGIPDKGYVLTQIS 61

Query: 61  QYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +                  +   ++ ++    P E IVRGY++G+
Sbjct: 62  AFWFRQMEDIIPNHIISTEVKDFPAECQKYAADLEGRSMLVKKANPLPAECIVRGYISGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  + ++ KL  P+ TP+TK+       D+ IS + ++ 
Sbjct: 122 GWKDY-----KATGSICGIKLPAGLVESDKLEEPIFTPSTKAELG--THDENISFDRMVE 174

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
              + +     +    +++++R   +A   G+I+ D+K+E+GI     +I+ DE  TPDS
Sbjct: 175 M--MGKELAGKVRDVTIAIYKRARDIADAKGIIIADTKFEYGIY-NGELIIIDECMTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  ++Y+    +       DK F+R+++ T         P +P  I+ +T + Y+ A
Sbjct: 232 SRFWPKDSYKPGGAQ----PSFDKQFLRDYLETLDWNKTAPAPPLPAEIVKKTGEKYMEA 287

Query: 286 YEKITGL 292
             ++TG 
Sbjct: 288 LVRLTGK 294


>gi|309378198|emb|CBX23170.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 287

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 92/297 (30%), Positives = 144/297 (48%), Gaps = 27/297 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF  
Sbjct: 2   SVTGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKK 61

Query: 67  TSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            + I  NH                  +   +V ++L    +E IVRGYLAG+        
Sbjct: 62  LAHIMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK- 120

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                  +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +  
Sbjct: 121 ----TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKEL 172

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +   A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + 
Sbjct: 173 AAEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQ 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           Y      G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 233 Y----EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|220927841|ref|YP_002504750.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulolyticum H10]
 gi|219998169|gb|ACL74770.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulolyticum H10]
          Length = 298

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 98/312 (31%), Positives = 151/312 (48%), Gaps = 32/312 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +++      LP +  GKVR  Y L D   + + TDR+SAFD      IP KG VLN I+ 
Sbjct: 2   LINNTNFIRLPLFVKGKVRNVYDLGDQ-LLIVVTDRISAFDVVFDELIPNKGTVLNSISA 60

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF  T D+  NH +               D      ++ +++QM P E IVRGYL G+ 
Sbjct: 61  FWFDFTKDVIGNHVITTDVSKYPKELSAFKDELQGRSMLVKKVQMLPAECIVRGYLEGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  +    KLP P+ TP+TK SE     D  +S   +  +
Sbjct: 121 LKEYQK-----TGTVCGIKLPSGLKQADKLPEPIFTPSTKESEG---HDINVSFEVLCEK 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +     + +   +L L+E+  K A   GLIL D+K+EFG+     +++ DE+ TPDSS
Sbjct: 173 --IGTEMAQKLKDASLKLYEKASKHAESKGLILADTKFEFGML-DGELVVGDEMFTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+    +       DK ++R ++       +   P++P+ +I +T + YI AY
Sbjct: 230 RFWARDEYQPGRAQ----KSFDKQYLREYLENITWDKQPPAPELPQEVIRKTEEKYIEAY 285

Query: 287 EKITGLKFIADN 298
           E+ITG KF  D 
Sbjct: 286 ERITGKKFQGDK 297


>gi|163840599|ref|YP_001625004.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Renibacterium salmoninarum ATCC 33209]
 gi|162954075|gb|ABY23590.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Renibacterium salmoninarum ATCC 33209]
          Length = 298

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 84/301 (27%), Positives = 147/301 (48%), Gaps = 28/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSD---GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF 64
           +P   + YSGKVR+ Y  +D      + +A+DR+SA+D  +   IP KG +L +++ +WF
Sbjct: 11  LPGWKHVYSGKVRDLYEPADGAQDRVLVVASDRISAYDYVLDTEIPDKGAILTRLSLWWF 70

Query: 65  HHTSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
                          +   +      ++ ++L+MFP+E I RGYL G+            
Sbjct: 71  DQLEVPNHVLASTVADGVPELVAGRAMICRRLEMFPVECIARGYLTGSVLAEYRQ----- 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + +    LP  + D  +L   + TP+ K+       D+ I    ++    +     ET+
Sbjct: 126 LQSVAGLPLPAGLLDGSRLEEAIFTPSAKAEVGK--HDENIDFAAVVES--VGAEHAETL 181

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            S  L ++ R  ++A E G+IL D+K EFG+D+   + L DE+ TPDSSR+W+   +   
Sbjct: 182 RSLTLDVYRRAEEIARERGIILADTKVEFGLDEAGVVTLGDEVLTPDSSRFWDAALWTPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+ +  + +        P +P +++ RT   Y+ AYEK+TG  
Sbjct: 242 QAQAS----FDKQYVRDWLTSPASGWDRTTNAPPPALPADVVERTRARYVEAYEKLTGET 297

Query: 294 F 294
           F
Sbjct: 298 F 298


>gi|148264908|ref|YP_001231614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           uraniireducens Rf4]
 gi|189038231|sp|A5G5H3|PUR7_GEOUR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|146398408|gb|ABQ27041.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           uraniireducens Rf4]
          Length = 296

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/307 (28%), Positives = 151/307 (49%), Gaps = 31/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           +++     P+L     GKVR+ Y L + T + + TDR+SAFD  +   IP KG VL QI+
Sbjct: 3   KLVLTTDFPDLKLAARGKVRDIYDLGE-TLLIVTTDRISAFDVIMNEGIPDKGYVLTQIS 61

Query: 61  QYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +                  +   ++ ++ +  P E IVRGY++G+
Sbjct: 62  AFWFRQMEDIIPNHIISTEVKDFPAECQKYADVLEGRSMLVKKAKPLPAECIVRGYISGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          +    LP  + ++ +LP P+ TP+TK+       D+ IS  +++ 
Sbjct: 122 GWKDYQ-----ATGSVCGITLPAGLKESDRLPEPIFTPSTKAELG--THDENISFEKMVD 174

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
                ++  E +    L ++++   +A   G+I+ D+K+E+GI +   +I+ DE  TPDS
Sbjct: 175 M--CGKDIAEKVRDITLKIYKKARDIADGKGIIIADTKFEYGIYEG-ELIIIDECMTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  ++Y+    +       DK F+R+++ T         P +PE I+ +T + Y+ A
Sbjct: 232 SRFWPKDSYQPGGPQ----PSFDKQFLRDYLETLDWDKTAPAPPLPEEIVRKTGEKYMEA 287

Query: 286 YEKITGL 292
             K+TG 
Sbjct: 288 LVKLTGK 294


>gi|167856336|ref|ZP_02479065.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Haemophilus parasuis 29755]
 gi|219871599|ref|YP_002475974.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus parasuis SH0165]
 gi|167852532|gb|EDS23817.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Haemophilus parasuis 29755]
 gi|219691803|gb|ACL33026.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus parasuis SH0165]
          Length = 285

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPRAEAEAIQHRAVVCKRLVPVKIESIVRGYLTGSGLKDYQK---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 120 -TGTICGLALPEGLVEASKLPEPIFTPSSKAEVG--DHDINISYAECERQ--IGVELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY++
Sbjct: 175 VRDAAIALYKEAADYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWSVETYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK FIR+W+       +   P +P ++I +T   Y  A E +T
Sbjct: 235 ----GSNPPSFDKQFIRDWLEQSGWNKQAPAPSVPADVIEKTVAKYQEALELLT 284


>gi|255325898|ref|ZP_05366990.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium tuberculostearicum SK141]
 gi|255297110|gb|EET76435.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium tuberculostearicum SK141]
          Length = 300

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/313 (27%), Positives = 155/313 (49%), Gaps = 26/313 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+++    +    +  SGKVR+ Y + + T + + +DR+SA+D  +   IP KG VL   
Sbjct: 1   MKVMR-PELSSYTHLASGKVRDIYDVDENTLLMVVSDRISAYDHALEPAIPDKGRVLTAT 59

Query: 60  TQYWFHHTSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           ++++F                          +V ++L M P E + RG+L G+       
Sbjct: 60  SKFFFDSIDFPNHLAGPLDDERIPAECLGRAMVVKKLDMLPFECVARGFLTGSGLKEY-- 117

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
                   +    LP+ + +  +LP P+ TP TK+ +     D+ +S + ++ +  L  +
Sbjct: 118 ---KANGTVCGIELPEGLVEASRLPEPIFTPATKAEQGE--HDENVSFDVVVDK--LGAD 170

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           + E + +  L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +
Sbjct: 171 RAEELRAATLRIYSEAATLAEEKGIILADTKFEFGLDKDGTLVLADEVLTPDSSRYWPAD 230

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEK 288
           +Y +   +       DK ++RNW+ +  + +        P +P++++  T   YI AYE+
Sbjct: 231 SYVEGEVQ----PSFDKQYVRNWLTSDASGWDQAADGTPPQLPDDVVSATRLRYIEAYER 286

Query: 289 ITGLKFIADNSEL 301
           ++G +F    S  
Sbjct: 287 LSGERFADSLSPE 299


>gi|303245444|ref|ZP_07331728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio fructosovorans JJ]
 gi|302493293|gb|EFL53155.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio fructosovorans JJ]
          Length = 297

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 152/310 (49%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +++  IP L     GKVR+ Y LS  + + + TDR+SA+D  +   IP KG +LNQI
Sbjct: 1   MDAVAQTDIPALTLRSRGKVRDIYDLSPESLLIVTTDRISAYDVIMPDPIPQKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH L               +      +V ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDMFRDMVPNHLLATEVANFPAACAPYAEQLAGRSVVARKAKPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++  LP P+ TP+TK+       D+ I+  +  
Sbjct: 121 SGLKDY-----KATGTVCGHALPAGLVESDILPEPLFTPSTKADLG--AHDENITLAK-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            + ++       +   +L+++ +    A   G+I+ D+K+EFG      +IL DE+ TPD
Sbjct: 172 AKDMIGVELCAKVEELSLAMYAKARDYARGRGIIIADTKFEFGQTDD-GLILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y+     G +    DK ++R+W+ +     +   P +PE+++ RT + Y+ 
Sbjct: 231 SSRFWPAEGYKP----GNSQPSYDKQYLRDWLTSIGFDKKPPAPRLPEDVVARTREKYLT 286

Query: 285 AYEKITGLKF 294
           AY  +TG K 
Sbjct: 287 AYAVLTGKKL 296


>gi|325919156|ref|ZP_08181213.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas gardneri ATCC 19865]
 gi|325550363|gb|EGD21160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas gardneri ATCC 19865]
          Length = 308

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 148/315 (46%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLRSDLPGLPLRHRGKVRDVFDIPRERLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFHKTDHLMPNHLVDIRVEQVLPDGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P  +I 
Sbjct: 234 MDEMLTPDSSRYWPADQY----ELGTSPPSYDKQFVRDYLETLDWGKTAPGPSLPAEVIE 289

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 290 RTRAKYAEALQRLAG 304


>gi|61387379|gb|AAX45347.1| PurC [Rhodococcus equi]
          Length = 294

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 88/300 (29%), Positives = 147/300 (49%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F  
Sbjct: 4   SLESYIHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFEK 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      LV ++L M P+E + RGYL G+          N   
Sbjct: 64  LGGTNHLAGDPLDERIPEEVLGRALVVRKLNMLPVECVARGYLTGSGLADY-----NSTG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP +K+       D+ I    ++ +  + ++    +  
Sbjct: 119 AVCGVALPEGLVEASQLPEPIFTPASKAELG--DHDENIDFATVVDK--VGQDLAVKLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R    A + G+IL D+K+EFG+D + N++LADE+ TPDSSRYW  + YE    
Sbjct: 175 DTLDIYFRAASFARDRGIILADTKFEFGLDAEGNLVLADEVLTPDSSRYWPADGYEP--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            G      DK F+RNW+    + +        P +P++I+  T   YI AYE+I+GL F 
Sbjct: 232 -GKVQPSFDKQFVRNWLTGPESGWDRASDTPPPPLPQDIVDATRARYIEAYERISGLSFE 290


>gi|88812487|ref|ZP_01127736.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrococcus mobilis Nb-231]
 gi|88790273|gb|EAR21391.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrococcus mobilis Nb-231]
          Length = 299

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 91/303 (30%), Positives = 142/303 (46%), Gaps = 28/303 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L K+ + +L     GKVR+ Y + D   + + TDRLSAFD  +   IP KG +L  ++
Sbjct: 6   ETLFKSQLTDLRLVQRGKVRDIYEIDDARLLIVTTDRLSAFDVILPDPIPGKGIILTALS 65

Query: 61  QYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYLAGNT 106
           ++WF  T  I  NH L  P                  +V ++LQ  PIE + RGYL G+ 
Sbjct: 66  RFWFERTRPIIGNHLLADPLESVLTRASEVRQVQSRAMVVRRLQPLPIEAVARGYLVGSA 125

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        ++    LP  +    +LP P+ TP TK++      DQ I   + +  
Sbjct: 126 WNEYRR-----SGQVCGIPLPPGLQQADQLPEPIFTPATKATAG--SHDQNIDFAQTV-- 176

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            IL  +  E +    L ++      A   G+I+ D+K+EF  D    ++L DEI TPDSS
Sbjct: 177 QILGHDTAEQVRRMTLKIYNEATSYARRCGIIIADTKFEFARDHDGQLLLIDEILTPDSS 236

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G +P   DK F+R+++ +         P +P  II +T++ Y  A 
Sbjct: 237 RFWPADQY----RSGSSPPSFDKQFVRDYLASLAWDQTTPGPRLPAKIIAQTAEKYREAQ 292

Query: 287 EKI 289
            ++
Sbjct: 293 RRL 295


>gi|261364735|ref|ZP_05977618.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           mucosa ATCC 25996]
 gi|288567034|gb|EFC88594.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           mucosa ATCC 25996]
          Length = 288

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 91/297 (30%), Positives = 144/297 (48%), Gaps = 27/297 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y +     + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDSKRMLMVASDRLSAFDVILDNPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPEHEAKVIEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -NGSVCGIKLPEGMKEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLK 293
             + G  P   DK F+R+W+       +   P++P ++I +T   Y  A   +T   
Sbjct: 234 --QVGTNPPSFDKQFVRDWLEQSGWNKKAPAPEVPSDVIQKTVDKYREALNLLTKES 288


>gi|294627226|ref|ZP_06705813.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292598465|gb|EFF42615.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 310

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 93/315 (29%), Positives = 148/315 (46%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLS FD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLMVATDRLSTFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P  +I 
Sbjct: 236 MDEMLTPDSSRYWPADQYEP----GNSPPSYDKQFVRDYLETLDWGKTAPGPRLPAEVID 291

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 292 RTRAKYAEALQRLAG 306


>gi|311740200|ref|ZP_07714032.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304755|gb|EFQ80826.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 297

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 82/299 (27%), Positives = 149/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +    +  SGKVR+ Y + + T + + +DR+SA+D  +   IP KG VL   ++++F  
Sbjct: 4   ELSSYTHLASGKVRDIYDVDENTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKFFFDS 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                                   +V ++L M P E + RG+L G+              
Sbjct: 64  IDFPNHLAGPLDDERIPAECLGRAMVVKKLDMLPFECVARGFLTGSGLKEY-----KANG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP TK+ +     D+ +S + ++ +  L   + E + +
Sbjct: 119 TVCGIELPEGLVEASRLPEPIFTPATKAEQGE--HDENVSFDFVVDK--LGAERAEELRA 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++     LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y +   
Sbjct: 175 ATLRIYSEAAALAEEKGIILADTKFEFGLDQDGTLVLADEVLTPDSSRYWPADSYVEGEV 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK ++RNW+ +  + +        P +P++++  T   YI AYE+++G +F
Sbjct: 235 Q----PSFDKQYVRNWLTSDASGWDQAADGTPPQLPDDVVSATRLRYIEAYERLSGERF 289


>gi|271963122|ref|YP_003337318.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase
           [Streptosporangium roseum DSM 43021]
 gi|270506297|gb|ACZ84575.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Streptosporangium roseum DSM 43021]
          Length = 276

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 83/290 (28%), Positives = 146/290 (50%), Gaps = 21/290 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y    G  + +A+DR+S +D  +   IP KG++L Q++ +WF   +DI
Sbjct: 1   MKLLHSGKVRDVYE-DRGDIVLVASDRVSVYDVILPTPIPDKGKILTQLSLWWFEQLADI 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +         +   +  ++L+M  +E + RGYL G+              ++   
Sbjct: 60  VPNHVVSATDVPAEFEGRAVRCRKLKMVQVECVARGYLTGSGLKDYQAR-----GEVSGV 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + D  +LP P+ TP+TK+       D+PI+ ++++ +          +    L++
Sbjct: 115 PLPPGLVDGSRLPEPIFTPSTKAPLGQ--HDEPITFDDVVAQE--GAEVAGELRRITLAV 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG +LA E G+I+ D+K E G      ++L DE+ T DSSR+W  + +E    +    
Sbjct: 171 YGRGAELARERGVIIADTKIELGWAADGTLVLGDEVLTSDSSRFWPADQWEPGRAQFS-- 228

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              DK F+R+W        ++  P++P  I+  T   Y+ AYE+ITG  +
Sbjct: 229 --FDKQFVRDWATGTGWDKQEPAPEVPAEIVEITRARYVEAYERITGKSW 276


>gi|291302289|ref|YP_003513567.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stackebrandtia nassauensis DSM 44728]
 gi|290571509|gb|ADD44474.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stackebrandtia nassauensis DSM 44728]
          Length = 278

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 85/290 (29%), Positives = 143/290 (49%), Gaps = 21/290 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y   D   I +A+DR+S +D  +   +P KG +L  ++ +WF   +D 
Sbjct: 1   MKLLHSGKVRDVYADGDE-LILVASDRVSVYDIVLPTPVPDKGRLLTALSLWWFDQLADA 59

Query: 71  CSNHTL------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +      +      +  ++L M P+E + RGYL G+               +   
Sbjct: 60  MPNHVISATDVPEEFAGRAVRCRRLDMVPVECVARGYLTGSGLKEYQR-----DGTVSGL 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + D  +LP P+ TP+TK+       D+P++  E+  +  L     + +    L +
Sbjct: 115 ELPPGLEDGSRLPEPIFTPSTKAPVGQ--HDEPMTFGEVAAK--LDHPTAQRLRDITLDI 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG  LA + G+I+ D+K E G D    ++LADE+ T DSSR+W  + ++    +    
Sbjct: 171 YRRGRDLAAQRGIIVADTKIELGFDTDGELVLADEVLTMDSSRFWPADGWQPGRPQ---- 226

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              DK ++R+W  T         P+IP+ ++  T   YI AYE+ITGL +
Sbjct: 227 PSFDKQYLRDWAATTGWDKTSPPPEIPDEVVAATRAKYIEAYERITGLTW 276


>gi|134095776|ref|YP_001100851.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Herminiimonas arsenicoxydans]
 gi|133739679|emb|CAL62730.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Herminiimonas arsenicoxydans]
          Length = 298

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 94/309 (30%), Positives = 148/309 (47%), Gaps = 28/309 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ I  LP    GKVRENY + D   + + +DRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MTSLYQSTITSLPLLGRGKVRENYAVGDDKILIVTSDRLSAFDVVMNEAIPDKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    DI  NH              ++      +V ++LQ   +E +VRGYL G+ 
Sbjct: 61  SDFWFEKLKDIVPNHLTGIAPESVVAPDEVEQVKNRAVVAKRLQPILVEAVVRGYLIGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +            +    LP  +   +KL  P+ TP  K+       D+ I+  E+  R
Sbjct: 121 WSDYQK-----TGAVCGVQLPAGLKQAEKLAEPIFTPAAKADMGE--HDENITFAEMEQR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + +     I   ++ L++     A   G+I+ D+K+EFG+DK   + L DE+ T DSS
Sbjct: 174 --IGKELAGKIRDVSIKLYKTAADYAATRGIIIADTKFEFGLDKDGTLHLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAA 285
           R+W  ++Y      GI+P   DK F+R+++ T          P +P ++I +T   Y  A
Sbjct: 232 RFWPADSY----ATGISPPSFDKQFVRDYLETLTDWKKTAPAPTLPADVIEKTGAKYREA 287

Query: 286 YEKITGLKF 294
             ++TG   
Sbjct: 288 LTRLTGEDL 296


>gi|189426096|ref|YP_001953273.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           lovleyi SZ]
 gi|229564397|sp|B3E940|PUR7_GEOLS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189422355|gb|ACD96753.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           lovleyi SZ]
          Length = 296

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 84/306 (27%), Positives = 147/306 (48%), Gaps = 31/306 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           + + +   P L     GKVR+ Y L D   + + +DR+SAFD  +   IP KG+VL QI+
Sbjct: 3   QPVKQTDFPGLKLVNRGKVRDIYDLGDA-LLMVTSDRISAFDVIMNEPIPDKGKVLTQIS 61

Query: 61  QYWFHHTSDICSNHTLDYPD---------------PNVLVGQQLQMFPIELIVRGYLAGN 105
           ++WF    DI  NH +                      ++ ++ +    E IVRGY++G+
Sbjct: 62  KFWFSQMEDIIPNHIISTDVADYPAACQPYAEVLAGRSMLVKKAEPLAAECIVRGYVSGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP+ + ++ +L  P+ TP+TK+       D+ IS +E++ 
Sbjct: 122 GWKDY-----KATGSICGIKLPEGLKESDRLAEPIFTPSTKAELG--THDENISFDEMV- 173

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             +  +   E      + ++ R  ++A + G+I+ D+K+EFG+ +   +I+ DE  TPDS
Sbjct: 174 -KVCGKELAEQAREATIRIYCRAREIADQKGIIIADTKFEFGVYEG-KLIIIDECLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y+    +       DK F+R+++ T         P +PE I+ +T + Y  A
Sbjct: 232 SRFWPKDQYQPGGPQ----PSFDKQFLRDYLETLDWGKTAPAPPLPEEIVTKTGEKYKEA 287

Query: 286 YEKITG 291
             K+ G
Sbjct: 288 LFKLAG 293


>gi|261392874|emb|CAX50455.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Neisseria meningitidis 8013]
          Length = 287

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|194098064|ref|YP_002001112.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|268594383|ref|ZP_06128550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|268600861|ref|ZP_06135028.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
 gi|193933354|gb|ACF29178.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|268547772|gb|EEZ43190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|268584992|gb|EEZ49668.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
 gi|317163797|gb|ADV07338.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 319

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A +P KGE+L QI+ +WF   + 
Sbjct: 37  GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPVPGKGEILTQISNFWFKKLAH 96

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 97  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 152

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 153 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 207

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 208 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 265

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 266 --EVGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|78046056|ref|YP_362231.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|123586057|sp|Q3BYD2|PUR7_XANC5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|78034486|emb|CAJ22131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 308

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 94/313 (30%), Positives = 149/313 (47%), Gaps = 38/313 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + L               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDLPRDRLPADAPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFHKTEHLMPNHLMDIRVEQVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 123 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P ++I 
Sbjct: 234 MDEMLTPDSSRYWPADQYEP----GTSPPSYDKQFVRDYLETLDWGKTAPGPRLPADVID 289

Query: 277 RTSQTYIAAYEKI 289
           RT   Y  A +++
Sbjct: 290 RTRAKYAEALQRL 302


>gi|323698322|ref|ZP_08110234.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio sp. ND132]
 gi|323458254|gb|EGB14119.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio desulfuricans ND132]
          Length = 298

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 88/310 (28%), Positives = 148/310 (47%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  + +  I E P    GKVR+ Y +   T + + TDR+SAFD  +   I  KG+VLNQI
Sbjct: 1   MAAVLETNITEYPLISRGKVRDIYEIDADTLLLVTTDRISAFDVVMPDPIEDKGKVLNQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH +               D      ++ ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMKMMEDLVPNHIIATNVDDYPEPLRKYRDQLQDRSVLAKKAKPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +  +           ++  + LP+ + ++  L  P+ TP+TK+       D+ IS ++  
Sbjct: 121 SGWSDYQK-----TGEVCGHKLPEGLQESAMLEKPLFTPSTKADLGQ--HDENISLDK-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              +L       + + ALS++ R    A + G+++ D+K+EFGI     ++  DE  TPD
Sbjct: 172 AAELLGEEMMRKVETLALSIYTRARDYAKQRGILIADTKFEFGIL-DGELLFIDEALTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y     +       DK + R+W++      +   P +P +I  RT + Y+ 
Sbjct: 231 SSRFWPEEGYAPGQSQ----PSFDKQYFRDWLVQIGFNKQPPAPHVPADIAARTREKYLE 286

Query: 285 AYEKITGLKF 294
           AY+ +TG   
Sbjct: 287 AYKLLTGEDL 296


>gi|239906841|ref|YP_002953582.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio magneticus RS-1]
 gi|239796707|dbj|BAH75696.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio magneticus RS-1]
          Length = 297

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 91/310 (29%), Positives = 158/310 (50%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +++  I   P    GKVR+ Y LS  + + + TDR+SA+D  +   IP KG +LNQI
Sbjct: 1   MHAVTETDIKAYPLRSRGKVRDIYDLSPDSLLLVTTDRISAYDVIMPDPIPLKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH +                      +V ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDMFKDMVPNHLIASDVADFPAPLAPHAADLAGRSVVAKKAKPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +  + LP  + ++Q LP P+ TP+TK+       D+ I+ +   
Sbjct: 121 SGLKDY-----QATGSVCGHALPAGLVESQILPVPIFTPSTKADLG--AHDENITLD--T 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            + +L    +  + + +L+++ +    A E G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AKEMLGSALFAKVEATSLAMYAKARDYARERGIIIADTKFEFGLI-DGELILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y      G +    DK ++R+W+++     +   P++P+++I +T + Y+A
Sbjct: 231 SSRFWPAEGY----AAGKSQPSYDKQYLRDWLVSIGFNKQPPAPNLPQDVIAKTQEKYLA 286

Query: 285 AYEKITGLKF 294
           AYE +TG K 
Sbjct: 287 AYELLTGKKL 296


>gi|227506360|ref|ZP_03936409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Corynebacterium striatum ATCC 6940]
 gi|227197011|gb|EEI77059.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Corynebacterium striatum ATCC 6940]
          Length = 289

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 85/299 (28%), Positives = 154/299 (51%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            +    +  SGKVR+ Y + + T + + +DR+SA+D ++   IP KG VL   ++++F  
Sbjct: 4   ELSSYKHLASGKVRDIYDVDENTLLMVVSDRISAYDHSLDPAIPDKGRVLTATSKFFFDV 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      +V ++L M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGPLDDERIPEEVLGRAMVVKKLDMLPFECVARGYLTGSGLKEYKE-----SG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L + + E + +
Sbjct: 119 TVCGIELPEGLTEASRLPEPIFTPATKAEQGE--HDENVSFDAVVAK--LGKERAEELRA 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++    ++A E G+IL D+K+EFG+D+   +ILADE+ TPDSSRYW  +TYE+   
Sbjct: 175 ATLRIYSEAARIAEEKGIILADTKFEFGMDENGTLILADEVLTPDSSRYWPADTYEE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+ +  + +        P +P++++  T   Y+ AYE+++G  F
Sbjct: 232 -GKVQPSFDKQYVRNWLTSPESGWDQAADTTPPHLPDDVVEATRARYVEAYERLSGNSF 289


>gi|38234494|ref|NP_940261.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium diphtheriae NCTC 13129]
 gi|81829865|sp|Q6NFG4|PUR7_CORDI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|38200757|emb|CAE50461.1| Putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium diphtheriae]
          Length = 297

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 150/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+FH+
Sbjct: 4   ELSQYTHVSAGKVREIYEVDDERLLMVVSDRISAYDHILEPEIPDKGRVLTAMSMYFFHN 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V ++L+M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGPIDDPAIPEEVLGRAMVCKKLKMLPFECVARGYLTGSGLKEYQE-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   +  
Sbjct: 119 TVCGVELPEGLVEASKLPEPIFTPATKAELG--DHDENVSFDVVVEK--LGEARANELRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++     LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  + YE+   
Sbjct: 175 ATLRIYSEAAALAEERGIILADTKFEFGLDEDGRLVLADEVLTPDSSRYWPADGYEE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +        P +P +++  T + Y+ A+E+ITG KF
Sbjct: 232 -GKVQPSFDKQYVRNWLTGPKSGWSTDDVTPPPSLPGSVVEATRERYVEAFERITGKKF 289


>gi|326772418|ref|ZP_08231702.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces viscosus C505]
 gi|326637050|gb|EGE37952.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces viscosus C505]
          Length = 352

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 83/304 (27%), Positives = 154/304 (50%), Gaps = 30/304 (9%)

Query: 9   IPELPNYYSGKVRENYFL-------SDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y              + +A+DR+SA+D  +A  IP KG+VL  ++
Sbjct: 60  VPGWEHRSSGKVRDVYAPTSDGPWGGQDVLLVVASDRISAYDHILATPIPDKGKVLTALS 119

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +D+  NH +    P       ++ ++L+M+P+E + RGYL G+          
Sbjct: 120 AWWFEQLADVVPNHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTGSGLVEYRQG-- 177

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
              R +    LP+ +++  +LP P+ TP  K+       D+ ++   ++    +  +   
Sbjct: 178 ---RSVCGVALPEGLTEASRLPEPIFTPAAKAELGE--HDENVTFERVVQM--VGDSAAT 230

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+L+ R  ++A + G+IL D+K+E G D   +++L DE+ TPDSSR+W  + +E
Sbjct: 231 ALRETTLALYSRAAEIARDRGIILADTKFELGTDADGDLVLGDEVLTPDSSRFWPADAWE 290

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++R+W+ +  + +        P +P++++ RT   Y+ AYE++TG
Sbjct: 291 P----GRVTPSFDKQYVRDWLTSPASGWDRGGDQEPPALPDDVVERTRARYLEAYERLTG 346

Query: 292 LKFI 295
               
Sbjct: 347 HPLE 350


>gi|300780477|ref|ZP_07090333.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium genitalium ATCC 33030]
 gi|300534587|gb|EFK55646.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium genitalium ATCC 33030]
          Length = 290

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 88/300 (29%), Positives = 155/300 (51%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y +   T + +ATDR+SAFD ++   IP KG++L   + ++F  
Sbjct: 4   ELSDYKHLSAGKVREIYEIDTDTLLMVATDRISAFDYSLDPEIPDKGKILTLTSAFFFDL 63

Query: 67  TSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            ++  ++      D  +         V ++L M P E +VRGYL G+ K        +  
Sbjct: 64  LAEFPNHLAGPLDDGRIPEDVLGGAFVVKRLDMVPFECVVRGYLTGSGKKEY-----DAT 118

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LPD + +  KLP P+ TP TK+ +     D  +S + +     +  +    + 
Sbjct: 119 GSVCGVELPDGLVEASKLPEPIFTPATKAEQG--DHDVNVSYDYMARE--IGEDLASRLR 174

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ +  + A   G+IL D+K+EFG+D    ++LADE+ TPDSSRYW  ++Y++  
Sbjct: 175 ETTLAIYTKAAQYAESRGIILADTKFEFGLDDNGTLVLADEVLTPDSSRYWPADSYKEGE 234

Query: 239 REGITPIGLDKDFIRNWILTR-CNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            +       DK ++RNW+  +           P++P +++  T + YI AYE+++G KFI
Sbjct: 235 AQ----PSFDKQYVRNWLSQKSGWDADSGTPPPELPGSVVEATRERYIEAYERLSGKKFI 290


>gi|255068246|ref|ZP_05320101.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sicca ATCC 29256]
 gi|255047516|gb|EET42980.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sicca ATCC 29256]
          Length = 286

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y +     + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDSKRMLMVASDRLSAFDVILDNPIPGKGEILTQISNFWFQKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPEHEAKAIEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -NGSVCGIKLPEGMKEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   PD+P ++I +T   Y  A   +T
Sbjct: 234 --QVGTNPPSFDKQFVRDWLEQSGWNKKAPAPDVPSDVIQKTVDKYREALNLLT 285


>gi|289209543|ref|YP_003461609.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thioalkalivibrio sp. K90mix]
 gi|288945174|gb|ADC72873.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thioalkalivibrio sp. K90mix]
          Length = 298

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 85/305 (27%), Positives = 144/305 (47%), Gaps = 30/305 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
            L +++IP+L   + GKVR+ Y +     + + TDRLSAFD  +   IP KG +L  IT+
Sbjct: 4   ALLESHIPDLDLVHRGKVRDLYAVDADHWLMVTTDRLSAFDVILPTPIPGKGCMLTAITE 63

Query: 62  YWFHH---------------TSDICSNHTLDYP-DPNVLVGQQLQMFPIELIVRGYLAGN 105
           +W H                   +  +  +  P +   LV ++L+  P+E +VRGYL G+
Sbjct: 64  FWMHKVERELGIPNQLTGIPLEQVVPDTAIRAPLEGRSLVIRRLEALPVEAVVRGYLIGS 123

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          +    LP  +    KLP  + TP+TK++      D  I    ++ 
Sbjct: 124 GWKDY-----QASGAVCGIPLPPGLELASKLPEAIFTPSTKAAVG--DHDANIDFATVVE 176

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
              +   +   +   AL+++      A E G+I+ D+K+EFG+D    + L DE+ TPDS
Sbjct: 177 --TIGEERARQVRDAALAIYAMARDYASERGIIIADTKFEFGVDANGTLHLIDEVLTPDS 234

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y      G +P   DK ++R+++ T         P++P  +  +T+  Y  A
Sbjct: 235 SRFWPADQYAP----GHSPESFDKQYVRDYLETLDWDKTAPGPELPTEVAEQTAARYREA 290

Query: 286 YEKIT 290
            E++T
Sbjct: 291 LERLT 295


>gi|240080229|ref|ZP_04724772.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|240123022|ref|ZP_04735978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
          Length = 287

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|152980348|ref|YP_001354535.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janthinobacterium sp. Marseille]
 gi|151280425|gb|ABR88835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janthinobacterium sp. Marseille]
          Length = 298

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 92/309 (29%), Positives = 147/309 (47%), Gaps = 28/309 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ I  LP    GKVRENY + D   + + +DRLSAFD  +   IP KG+VLNQ+
Sbjct: 1   MTSLYQSTITSLPLLGRGKVRENYAVGDDKILIVTSDRLSAFDVVMNEPIPTKGQVLNQM 60

Query: 60  TQYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    DI  NH              +       +V ++L+   +E +VRGYL G+ 
Sbjct: 61  SDFWFEKLKDIVPNHLTGIAPESVVAPDEVAQVKNRAVVAKRLEPILVEAVVRGYLIGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  +   +KL  P+ TP  K+       D+ I+  ++  R
Sbjct: 121 WNDY-----KATGAVCGVALPAGLKQAEKLAEPIFTPAAKAEMGE--HDENITFADMEQR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + +     I   ++ L++     A   G+I+ D+K+EFG+DK   + L DE+ T DSS
Sbjct: 174 --IGKELANKIRDVSIKLYKTAADYAATRGIIIADTKFEFGLDKDGTLHLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAA 285
           R+W  ++Y      GI+P   DK F+R+++ T          P +P  +I +T   Y  A
Sbjct: 232 RFWPADSY----ATGISPPSFDKQFVRDYLETLTEWKKTAPAPALPAEVIEKTGAKYREA 287

Query: 286 YEKITGLKF 294
             ++TG + 
Sbjct: 288 LTRLTGEEL 296


>gi|332971520|gb|EGK10470.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Kingella kingae ATCC 23330]
          Length = 286

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKIMLIVATDRLSAFDVILDEPIVGKGEILTQISNFWFGKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    IE ++RGYL+G+           
Sbjct: 65  IMPNHFTGQTVFDVLPENEAQAVEKRAVVAKRLTPVKIEAVIRGYLSGSGWKEYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+N+ + +KLP  + TP+TK+       D+ IS        I+ + + E 
Sbjct: 121 -SGTVCGIKLPENLREAEKLPEVIFTPSTKAEVG--DHDENISFERCCE--IIGKERAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY  
Sbjct: 176 VRAKAIQLYTEAAEFAKARGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWAVETY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P +++ +T   Y  A   +T
Sbjct: 234 --QVGTNPPSFDKQFVRDWLEQSGWNKQPPAPKLPADVLEKTVAKYQEALNVLT 285


>gi|119962502|ref|YP_949078.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter aurescens TC1]
 gi|119949361|gb|ABM08272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter aurescens TC1]
          Length = 312

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 85/313 (27%), Positives = 148/313 (47%), Gaps = 36/313 (11%)

Query: 5   SKA-YIPELPNYYSGKVRENY---------FLSDGTRITIATDRLSAFDQNIAC-IPYKG 53
           ++   +P   + YSGKVR+ Y          +     + +A+DR+SA+D  ++  IP KG
Sbjct: 12  TETLELPGWKHVYSGKVRDLYVPADEAITEKIGQECVLVVASDRISAYDHVLSSEIPDKG 71

Query: 54  EVLNQITQYWFHHTS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
            VL Q++ +WF                   +  +   ++ ++L MFP+E I RGYL G+ 
Sbjct: 72  RVLTQLSLWWFDQLDVEHHVLASTVEGGVPEAVEGRAMICKKLDMFPVECIARGYLTGSG 131

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                       R +    LP+ + D  +L   + TP+ K+       D  I+ ++++  
Sbjct: 132 LAEYKE-----SRTVCNIPLPEGLVDGSRLEKALFTPSAKAEVGE--HDVNITYDDVVAM 184

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTPDS 225
             +  +    +S   L ++ R  ++A E G+IL D+K EFGID    +I   + + TPDS
Sbjct: 185 --VGDDIAARLSELTLKIYTRAEEIARERGIILADTKVEFGIDAATGVITLGDEVLTPDS 242

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQT 281
           SR+W+  TY     +       DK ++R+W+ +  + +        P +P  ++ RT   
Sbjct: 243 SRFWDASTYAPGKSQ----PSYDKQYVRDWLTSAESGWDKSSDTPPPPLPAEVVERTRAR 298

Query: 282 YIAAYEKITGLKF 294
           Y+ AYEK+TG  F
Sbjct: 299 YVEAYEKLTGRTF 311


>gi|311112173|ref|YP_003983395.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Rothia
           dentocariosa ATCC 17931]
 gi|310943667|gb|ADP39961.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Rothia
           dentocariosa ATCC 17931]
          Length = 308

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 99/312 (31%), Positives = 152/312 (48%), Gaps = 39/312 (12%)

Query: 9   IPELPNYYSGKVRENYFLSDGTR------------------ITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y   +                     + +A+DR+SAFD+ +   I
Sbjct: 10  IPGWTHVYSGKVRDLYVPEESRYDAAGLTVSDDAEIRAGSVMVVASDRISAFDKILPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDI----CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
           P KG++L Q++ +WF   S I     S    +      ++ + L MFP+E IVRGYL G+
Sbjct: 70  PDKGKILTQMSLWWFQQLSHIPNHVISTDVPESVAGRAMICKSLNMFPVECIVRGYLTGS 129

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             TS           +    LP  + D  +L  P+ TPT K+       D+P++  E+  
Sbjct: 130 GLTSYRD-----TGSVAGIELPAGLVDGSRLETPIFTPTGKAEVGQ--HDEPVTREELYA 182

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTPD 224
              +       +   +L L+    K+A E G+IL D+K EFG D  +  I L DE+ TPD
Sbjct: 183 E--VGHAIGNRLEELSLELYSTAEKIAREQGIILADTKVEFGTDSYRGEITLGDELLTPD 240

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWIL--TRCNPYRDNIPDIPENIILRTSQTY 282
           SSR+W+   YE    +       DK F+R+W+          DN+P +PE+++ +T   Y
Sbjct: 241 SSRFWDASEYEPGKSQ----PSFDKQFVRDWLRSPESGWDGSDNVPHLPEDVVEKTRARY 296

Query: 283 IAAYEKITGLKF 294
           + AYE++TG KF
Sbjct: 297 VEAYERLTGTKF 308


>gi|217969904|ref|YP_002355138.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Thauera
           sp. MZ1T]
 gi|217507231|gb|ACK54242.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Thauera
           sp. MZ1T]
          Length = 311

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 92/321 (28%), Positives = 142/321 (44%), Gaps = 38/321 (11%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           M   + +  I  LP    GKVR+ Y +     + + +DRLSAFD  +   IP KG VL  
Sbjct: 1   MATPIFETSIQSLPLLGRGKVRDIYAVDADKLLIVTSDRLSAFDVVLPDPIPDKGRVLVA 60

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGN 105
           +  +WF     I  N         V+             V ++L+  PIE +VRGY+ G+
Sbjct: 61  LANFWFDRLGHILPNQLTGIDPETVVAENEREQVRGRALVVKRLKPLPIEAVVRGYVIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP  +    KLP P+ TP++K+       D+ IS  +   
Sbjct: 121 GWKDY-----QATGAICGIALPAGLQQAAKLPAPIFTPSSKADMGE--HDENISFAQAQA 173

Query: 166 R------------GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN 213
           R            G       +   + A++L+    + A   G+++ D+K+EFGID    
Sbjct: 174 RCEALMKDALAGTGKTGAQLADEARAAAIALYSEAAEFAATRGILIADTKFEFGIDAAGT 233

Query: 214 IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPEN 273
           + L DE  TPDSSR+W  + Y +    GI+P   DK ++R+++ T         P +P  
Sbjct: 234 LHLIDEALTPDSSRFWPADGYRE----GISPPSFDKQYVRDYLETLDWNKAPPAPKLPAE 289

Query: 274 IILRTSQTYIAAYEKITGLKF 294
           +I  T+  Y  AYE++TG K 
Sbjct: 290 VIEHTAAKYREAYERLTGRKL 310


>gi|125975366|ref|YP_001039276.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum ATCC 27405]
 gi|256005488|ref|ZP_05430450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 2360]
 gi|281419326|ref|ZP_06250341.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum JW20]
 gi|125715591|gb|ABN54083.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum ATCC 27405]
 gi|255990543|gb|EEU00663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 2360]
 gi|281406946|gb|EFB37209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum JW20]
 gi|316939481|gb|ADU73515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 1313]
          Length = 294

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 155/308 (50%), Gaps = 32/308 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +L      +LP Y  GKVR  Y L D   + + TDR+SAFD      IP KG+VLN I++
Sbjct: 2   LLGDTNFIDLPLYIKGKVRNVYDLGD-KLLIVVTDRISAFDVVFPNLIPNKGKVLNGISK 60

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF +T DI  NH +               +  +   ++ ++++M P E IVRGYL G+ 
Sbjct: 61  FWFDYTRDIVDNHVITTDVSEYPEGLSKFKEELEGRSMLVKKIKMIPAECIVRGYLEGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP+ +    KLP P+ TP+TK +E     DQ +S   +   
Sbjct: 121 LKDY-----KATGSICGIKLPEGLRQADKLPEPIFTPSTKETEG---HDQNVSFEGLC-- 170

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       +   +L+L+E+  K A   G+IL D+K+EFGI     I+L DE+ TPDSS
Sbjct: 171 NAIGTELATKLRDISLALYEKASKYAESRGIILADTKFEFGIL-DGKIVLGDELFTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W++  YE    +       DK F+R ++ +     +   P +P++++  T   YI AY
Sbjct: 230 RFWDMNEYEPGRAQ----KSFDKQFVREYLESIGWDKKPPAPTLPDDVVKNTELKYIEAY 285

Query: 287 EKITGLKF 294
           E+ITG KF
Sbjct: 286 ERITGNKF 293


>gi|161869701|ref|YP_001598868.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis 053442]
 gi|189038226|sp|A9M3I9|PUR7_NEIM0 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|161595254|gb|ABX72914.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis 053442]
          Length = 287

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|254522697|ref|ZP_05134752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas sp. SKA14]
 gi|219720288|gb|EED38813.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas sp. SKA14]
          Length = 308

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 93/315 (29%), Positives = 149/315 (47%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDIPRERLPAGTPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WF  T+ +  NH                       +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFAKTAHLMPNHLTGIDVASVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              K+    LPD +   ++LP P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKVSGIDLPDGLRQAEQLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++ +  +  +  E +    L +++     A E G+IL D+K+EFG D    + +
Sbjct: 176 NIDFDAMVKQ--VGADLAERVRDATLRIYKFAADYARERGIILADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P IP  II 
Sbjct: 234 MDEMLTPDSSRYWPADEY----EVGTSPPSYDKQFVRDYLETLDWGKTAPGPSIPAEIIE 289

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 290 RTRAKYAEALQRLAG 304


>gi|116624332|ref|YP_826488.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Solibacter usitatus Ellin6076]
 gi|116227494|gb|ABJ86203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 311

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 84/308 (27%), Positives = 152/308 (49%), Gaps = 32/308 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           ++ +  +  +  +  GKVR+ Y + +   + +ATDR+SAFD  +   IP KG VL Q++ 
Sbjct: 20  VILETDLAGVVRHARGKVRDVYSVDN-RLLIVATDRISAFDYILKSGIPDKGRVLTQLSL 78

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF    D+  NH L               D  +   ++ ++ QM  IE + RGYL+G+ 
Sbjct: 79  FWFDFLRDVVPNHFLTARVDEYPAPLPEFRDQLEGRSMLVKRAQMIDIECVARGYLSGSG 138

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + ++ KLP P+ TP TK+    SG D+ +S   ++  
Sbjct: 139 WKEYRER-----GTVCGIALPAGLRESDKLPEPIFTPATKA---QSGHDENVSFAHVV-- 188

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            ++  +    +    L +++R  + A   G+I+ D+K+EFG    + ++L DE+ TPDSS
Sbjct: 189 SLIGESLAARLRDLTLEIYKRASRYAETRGVIIADTKFEFGF-AGEELLLGDEVLTPDSS 247

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  +TY+    +       DK F+R+++ +     +   P +P+ +  +TS+ Y  A+
Sbjct: 248 RFWPADTYKPGGAQFS----FDKQFVRDYLESIQWNKQPPAPALPDEVAEKTSEKYREAF 303

Query: 287 EKITGLKF 294
             +TG   
Sbjct: 304 RILTGHSL 311


>gi|240112442|ref|ZP_04726932.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|260441000|ref|ZP_05794816.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
          Length = 287

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|237745646|ref|ZP_04576126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes HOxBLS]
 gi|229376997|gb|EEO27088.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes HOxBLS]
          Length = 292

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 92/304 (30%), Positives = 147/304 (48%), Gaps = 27/304 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L +  I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KG +L  +
Sbjct: 1   MPGLMETTIKSLPFLHRGKVRDIYAVGDDKMLVVQTDRLSAFDVVMEDPIPNKGRILTAM 60

Query: 60  TQYWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF     +  NH  D                   +V ++ +  PIE IVRGY+ G  
Sbjct: 61  SNFWFKKFGHLMPNHMTDIDPESLVAPEERDQVRGRAIVVKKFRPLPIEAIVRGYIIGTG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP  + + QKLP  + TP+TK++      DQ IS  ++   
Sbjct: 121 WKDYQK-----TGAICGIKLPAGLKEAQKLPEVIFTPSTKAAVGE--HDQNISFEKMKE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+  +  E +   A++L+      A   G+++ D+K+EFG+D++  + L DEI TPDSS
Sbjct: 173 -IVGADIAEKVRDLAITLYREAADFAATKGILIADTKFEFGVDEEGKVYLIDEILTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y      GI+P   DK ++R+W+  +    +   P +PE +  +T++ Y  A 
Sbjct: 232 RFWPAASY----AVGISPPSFDKQYVRDWLEAQPWDKKAPAPRLPEEVAQKTTEKYNEAL 287

Query: 287 EKIT 290
             +T
Sbjct: 288 RLLT 291


>gi|218767878|ref|YP_002342390.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis Z2491]
 gi|22001874|sp|Q9JV73|PUR7_NEIMA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|121051886|emb|CAM08192.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria meningitidis Z2491]
 gi|319410125|emb|CBY90461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Neisseria meningitidis WUE 2594]
          Length = 287

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|240117466|ref|ZP_04731528.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
          Length = 287

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|213966224|ref|ZP_03394409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium amycolatum SK46]
 gi|213951159|gb|EEB62556.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium amycolatum SK46]
          Length = 297

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 87/299 (29%), Positives = 150/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +  +GKVRE Y +   T + + +DR+SAFD  +   IP KG VL  ++ ++F  
Sbjct: 4   ELSSYNHLSAGKVREIYEIDPETLLLVVSDRISAFDHILETPIPDKGRVLTAMSVFFFDE 63

Query: 67  TSDICSN-------HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      LV ++L M P E + RGYL G+              
Sbjct: 64  IDFPNHMAGPADDERIPEECLGRALVCKKLDMLPFECVARGYLTGSGLVEYKE-----NG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  KLP PV TP TK+       D+ +S + ++    L + + E +  
Sbjct: 119 TVCGIELPEGLVEGSKLPEPVFTPATKAELGE--HDENVSFDAVVES--LGQKRAEELRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ +  +LA + G+IL D+K+EFG+D   N++LADE+ TPDSSRYW  ++Y++   
Sbjct: 175 ATLRIYTQAAELAAKRGIILADTKFEFGLDSDGNLVLADEVLTPDSSRYWPADSYQE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + ++       P +P +++  T + Y+ AYE+++G +F
Sbjct: 232 -GSVNPSFDKQYVRNWLTCSKSGWKKDEGTPPPALPGSVVEATRERYVEAYERLSGRRF 289


>gi|30248870|ref|NP_840940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosomonas europaea ATCC 19718]
 gi|39931891|sp|Q82W32|PUR7_NITEU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|30138487|emb|CAD84777.1| SAICAR synthetase [Nitrosomonas europaea ATCC 19718]
          Length = 295

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 92/303 (30%), Positives = 148/303 (48%), Gaps = 28/303 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
            L +  I  LP  + GKVR+ Y + +   + I TDR+SAFD  +   IP KG++L +I++
Sbjct: 5   ALFETSITSLPLLHRGKVRDIYAVDENHLLIIQTDRVSAFDVILPTPIPEKGKILTKISR 64

Query: 62  YWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF   + I  NH               D       + ++L+  P+E IVRGY++G+   
Sbjct: 65  FWFDKLAHIIPNHLTDITPESVVSSREQDQVSDRAFIVRKLKPLPVEAIVRGYISGSGWK 124

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRG 167
                       I    LP  + +  K+P   + TP+TK+       D+ IS +      
Sbjct: 125 DYQR-----SGTICGIALPAGLREADKIPDGAIFTPSTKAEAG--SHDENISYSVC--EQ 175

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           +L  +    +S ++++L+      AL   +I+ D+K+EFG+D+   + L DE  TPDSSR
Sbjct: 176 LLGVSLAAAVSRHSIALYTAAADYALTRSIIIADTKFEFGLDEANQLYLIDEALTPDSSR 235

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  E+Y      G TP   DK FIR+W+           P IPE ++++T + Y AA  
Sbjct: 236 FWPAESYRP----GKTPPSYDKQFIRDWLEQINWNKTPPAPPIPEEVLVQTIEKYQAACR 291

Query: 288 KIT 290
            +T
Sbjct: 292 VLT 294


>gi|225022177|ref|ZP_03711369.1| hypothetical protein CORMATOL_02211 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945110|gb|EEG26319.1| hypothetical protein CORMATOL_02211 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 297

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 156/299 (52%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y+F H
Sbjct: 4   ELSQYNHVSAGKVREIYEIDDDTLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFDH 63

Query: 67  TSD-------ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V ++L+M P E +VRGYL G+              
Sbjct: 64  IDFPNHLAGDIDDMRIPEEVLGRAIVCKKLKMLPFECVVRGYLTGSGYKEY-----LATG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ KLP P+ TP TK+       D+ ++  +++ +  L   +   +  
Sbjct: 119 SVCGIPLPEGLVESSKLPEPIFTPATKADLG--DHDENVTFEQVVEK--LGERRATELRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            +++++++  +LA   G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW +E YE    
Sbjct: 175 ASINIYKQAAELAEAKGIILADTKFEFGVDQDGTLVLADEVLTPDSSRYWPLEGYEP--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+ +    +        P +P +++  T + Y+ A+E+ITG KF
Sbjct: 232 -GKVQPSFDKQYVRNWLTSSKCDWQVDSNATPPPLPGSVVEATRERYVEAFERITGEKF 289


>gi|189202646|ref|XP_001937659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187984758|gb|EDU50246.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 301

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 92/308 (29%), Positives = 156/308 (50%), Gaps = 27/308 (8%)

Query: 2   RILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
             ++   I   LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  +
Sbjct: 4   SAVTNIDIEGKLPKVASGKVRDLYAIDDDTLLFVASDRISAYDVIMENGIPGKGALLTAM 63

Query: 60  TQYWFHHTSDICSNHTLDY--------------PDPNVLVGQQLQMFPIELIVRGYLAGN 105
           + YWFHH           +                   +  ++L++ PIE IVRGY+ G+
Sbjct: 64  SIYWFHHLPTQVPGLKTHFLTSSLPAALSNQTDLKDRSMQVRRLRILPIESIVRGYITGS 123

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             +            +    +P  + + QKLP P+ TP+TK+       D+ ISP +   
Sbjct: 124 GWSEYTK-----SGTVNGIKMPTGLIEGQKLPEPLWTPSTKADVGGK--DENISPEKARE 176

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             I      + +   +L++++   + A E G+IL D+K+EFG+D+   ++L DE+ TPDS
Sbjct: 177 L-IGDEKVAKKVEELSLAIYQAAAERAEEVGIILADTKFEFGVDEGSEVVLVDEVLTPDS 235

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  E++E +   G      DK F+R+W+ +     ++ +  +PE+++ RT+  Y  A
Sbjct: 236 SRFWPKESWESNL--GKAQPSFDKQFLRDWLTSNGLKGKEGV-KVPEDVVERTAAKYREA 292

Query: 286 YEKITGLK 293
            EK+TG  
Sbjct: 293 CEKLTGKS 300


>gi|262183504|ref|ZP_06042925.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium aurimucosum ATCC 700975]
          Length = 285

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 87/295 (29%), Positives = 149/295 (50%), Gaps = 21/295 (7%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH- 65
            +    +  SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   ++++F  
Sbjct: 4   ELSSYAHIASGKVRDIYEIDDSTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKFFFDV 63

Query: 66  ------HTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     +      +      +V Q+L M P E + RGYL G+              
Sbjct: 64  IVFPNHLAGPLDDERIPEEVLGRAMVVQKLDMLPFECVARGYLTGSGLKEY-----QASG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L R + E +  
Sbjct: 119 SVCGVELPEGLTEASRLPEPIFTPATKAEQG--DHDENVSFDVVVDK--LGRERAEELRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +TYE+   
Sbjct: 175 ATLRIYAEAAALAEEKGIILADTKFEFGVDKHGTLVLADEVLTPDSSRYWPADTYEE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++R+W+           P +P++++  T   Y+ A+E+++G  F
Sbjct: 232 -GKVQPSFDKQYVRDWLTNSGWDKESTPPRLPDDVVQATRARYVEAFERLSGTTF 285


>gi|300932496|ref|ZP_07147752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium resistens DSM 45100]
          Length = 297

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 87/299 (29%), Positives = 150/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y +   T + + TDR+SA+D  +   IP KG VL  ++ ++F +
Sbjct: 4   ELSDYEHISAGKVREIYEIDADTLLMVVTDRISAYDFVLDTEIPDKGRVLTAMSAFFFDN 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                                   +V ++L+M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGPLDDERIPASVLGRAMVCKKLEMLPFECVARGYLTGSGLKEYNE-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ +++  +LP P+ TP TK+       D+ +S + ++    L  ++ + +  
Sbjct: 119 TVCGVELPEGLTEASRLPEPIFTPATKAEVG--DHDENVSFDVVVE--ALGEDRAKELRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L+++    ++A E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  E YE+   
Sbjct: 175 ATLAIYSLAAEMARERGVILADTKFEFGLDENGQLVLADEVLTPDSSRYWPAEEYEE--- 231

Query: 240 EGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+         +D    P +P +++  T   Y+ AYEKI+G +F
Sbjct: 232 -GKVQPSFDKQYVRNWLTGPKSGWDKKDGTPPPALPGSVVEATRARYVEAYEKISGKRF 289


>gi|289663839|ref|ZP_06485420.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 310

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 94/313 (30%), Positives = 148/313 (47%), Gaps = 38/313 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 5   TTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLLIVATDRLSAFDVVLPDPIP 64

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDY--------------PDPNVLVGQQLQMFPIEL 96
            KGE+L Q++ +WFH T  +  NH +D                    +V ++L+  P+E 
Sbjct: 65  GKGEMLCQVSNFWFHKTEHLMPNHLVDIGVEQVLPEDVDPTLYAKRAVVTRKLKPVPVEA 124

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGY+ G+              KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 IARGYVIGSGWKDYQR-----TGKISGIELPDGLRQAEKLPEPIFTPSTKAAAG--DHDE 177

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 178 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 235

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P  II 
Sbjct: 236 MDEMLTPDSSRYWPADQYEP----GTSPPSYDKQFVRDYLETLEWGKTAPGPRLPAEIID 291

Query: 277 RTSQTYIAAYEKI 289
           RT   Y  A +++
Sbjct: 292 RTRAKYAEALQRL 304


>gi|261493523|ref|ZP_05990044.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261495968|ref|ZP_05992384.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261308374|gb|EEY09661.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261310819|gb|EEY12001.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 299

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 96/294 (32%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + +   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 18  SLKKIYSGKVRDLYEIDEKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAH 77

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 78  IMPNHFTGDSVFDVLPQEEAEAIQHRAVVCKRLIPVKIESIVRGYLTGSGLKDYQQ---- 133

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  + +     
Sbjct: 134 -TGTICGLTLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEECERQ--IGQELAAK 188

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   AL L+      AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY +
Sbjct: 189 VRDAALKLYTEAANYALTKGIIICDTKFEFGLDENGELTLMDEVLTPDSSRFWSVETYRE 248

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P  +I +T   Y  A + +T
Sbjct: 249 ----GTNPPSFDKQFVRDWLENSGWNKQPPAPKVPAEVIEKTVAKYQEALDLLT 298


>gi|227834009|ref|YP_002835716.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium aurimucosum ATCC 700975]
 gi|227455025|gb|ACP33778.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium aurimucosum ATCC 700975]
          Length = 288

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 87/299 (29%), Positives = 151/299 (50%), Gaps = 21/299 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQY 62
           + +  +    +  SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   +++
Sbjct: 3   VMRPELSSYAHIASGKVRDIYEIDDSTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKF 62

Query: 63  WFH-------HTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
           +F            +      +      +V Q+L M P E + RGYL G+          
Sbjct: 63  FFDVIVFPNHLAGPLDDERIPEEVLGRAMVVQKLDMLPFECVARGYLTGSGLKEY----- 117

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L R + E
Sbjct: 118 QASGSVCGVELPEGLTEASRLPEPIFTPATKAEQG--DHDENVSFDVVVDK--LGRERAE 173

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +TYE
Sbjct: 174 ELREATLRIYAEAAALAEEKGIILADTKFEFGVDKHGTLVLADEVLTPDSSRYWPADTYE 233

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +    G      DK ++R+W+           P +P++++  T   Y+ A+E+++G  F
Sbjct: 234 E----GKVQPSFDKQYVRDWLTNSGWDKESTPPRLPDDVVQATRARYVEAFERLSGTTF 288


>gi|260221960|emb|CBA31046.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 313

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 86/313 (27%), Positives = 145/313 (46%), Gaps = 36/313 (11%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M          LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+
Sbjct: 13  MTSALHTSALSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGALLTQM 72

Query: 60  TQYWFHHTSDICSNHTLDYPD-----------------PNVLVGQQLQMFPIELIVRGYL 102
             +WF       ++   ++                      ++ ++L+  P+E +VRGYL
Sbjct: 73  ALFWFEKLGKNGADVCPNHLTGDAPESAVTPAEAAQVAGRSMLVKRLKPLPVEAVVRGYL 132

Query: 103 AGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
           AG+               +    LP  + +  KLP P+ TP  K++      D+ I+  +
Sbjct: 133 AGSGWKEY-----QHNGAVCGVPLPAGLQNASKLPEPIYTPAAKAAVG--DHDENITFEK 185

Query: 163 IIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
            +    +  +    I   ++ +++   + AL  G+I+ D+K+EFG+DK   + L DE+ T
Sbjct: 186 TVEM--IGLDLATRIRDLSIQIYKVAAEFALTKGIIIADTKFEFGLDKDGTLTLMDEVLT 243

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRC-----NPYRDNIPDIPENIILR 277
           PDSSRYW VE+Y    + G  P   DK F+R+W+                P +P  +I +
Sbjct: 244 PDSSRYWPVESY----QVGTNPPSYDKQFVRDWLEQALVDGKPWDKTPPAPRVPREVIEK 299

Query: 278 TSQTYIAAYEKIT 290
           T+  Y  A +++T
Sbjct: 300 TADKYREALQRLT 312


>gi|221126333|ref|XP_002166104.1| PREDICTED: similar to
           5-phosphoribosyl-5-aminoimidazole-4-N-succinoca
           rboxamide synthase [Hydra magnipapillata]
          Length = 301

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 86/313 (27%), Positives = 145/313 (46%), Gaps = 36/313 (11%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M          LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+
Sbjct: 1   MTSALHTSALSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGALLTQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPD-----------------PNVLVGQQLQMFPIELIVRGYL 102
             +WF       ++   ++                      ++ ++L+  P+E +VRGYL
Sbjct: 61  ALFWFEKLGKNGADVCPNHLTGDAPESAVTPAEAAQVAGRSMLVKRLKPLPVEAVVRGYL 120

Query: 103 AGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
           AG+               +    LP  + +  KLP P+ TP  K++      D+ I+  +
Sbjct: 121 AGSGWKEY-----QHNGAVCGVPLPAGLQNASKLPEPIYTPAAKAAVG--DHDENITFEK 173

Query: 163 IIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
            +    +  +    I   ++ +++   + AL  G+I+ D+K+EFG+DK   + L DE+ T
Sbjct: 174 TVEM--IGLDLATRIRDLSIQIYKVAAEFALTKGIIIADTKFEFGLDKDGTLTLMDEVLT 231

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRC-----NPYRDNIPDIPENIILR 277
           PDSSRYW VE+Y    + G  P   DK F+R+W+                P +P  +I +
Sbjct: 232 PDSSRYWPVESY----QVGTNPPSYDKQFVRDWLEQALVDGKPWDKTPPAPRVPREVIEK 287

Query: 278 TSQTYIAAYEKIT 290
           T+  Y  A +++T
Sbjct: 288 TADKYREALQRLT 300


>gi|320009591|gb|ADW04441.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces flavogriseus ATCC 33331]
          Length = 308

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 94/305 (30%), Positives = 153/305 (50%), Gaps = 31/305 (10%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            + +  NH L    P           L+ + L+M  +E + RGYLAG+          + 
Sbjct: 72  LAGLVPNHVLSAELPAGAPADWAGRTLICRSLRMVQVECVARGYLAGSGLAEY-----DA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+     +       +
Sbjct: 127 DRTVCGIGLPEGLVDGSELPGPIFTPATKAAVG--DHDENVSYEEVARE--VGPETAALL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVET 233
               L ++ R   +A E G+IL D+K+EFG     D  + +ILADE+ TPDSSR+W  E 
Sbjct: 183 RRTTLDVYSRARDIARERGIILADTKFEFGFAPTEDGGEELILADEVLTPDSSRFWPAEI 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKI 289
           +E    +       DK F+R+W+ +  + +        P +P+ I+  T   Y+ AYE +
Sbjct: 243 WEPGKAQ----PSYDKQFVRDWLTSPASGWDRHGEQPPPPLPQAIVDATRAKYLEAYELL 298

Query: 290 TGLKF 294
           TGL +
Sbjct: 299 TGLNW 303


>gi|254363232|ref|ZP_04979280.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica PHL213]
 gi|153095129|gb|EDN75676.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica PHL213]
          Length = 285

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + +   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 4   SLKKIYSGKVRDLYEIDEKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPQEEAEAIQHRAVVCKRLIPVKIESIVRGYLTGSGLKDYQQ---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  + +     
Sbjct: 120 -TGTICGLTLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEECERQ--IGQELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   AL L+      AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY +
Sbjct: 175 VRDAALKLYTEAANYALTKGIIICDTKFEFGLDENGELTLMDEVLTPDSSRFWSVETYRE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P IP  +I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQPPAPKIPAEVIEKTVAKYQEALDLLT 284


>gi|226945583|ref|YP_002800656.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azotobacter vinelandii DJ]
 gi|226720510|gb|ACO79681.1| SAICAR synthetase [Azotobacter vinelandii DJ]
          Length = 289

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 144/293 (49%), Gaps = 27/293 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y +     + +A+DRLSAFD  +   IP KG++L  I+ +WF   + 
Sbjct: 8   SLKKIYSGKVRDLYEVDAKRMLMVASDRLSAFDVILAEPIPDKGKILTAISNFWFGKLAG 67

Query: 70  ICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH              L   +   +V ++L+   +E IVRGY+AG+           
Sbjct: 68  IVPNHFTGDRVEDVVPAAELPLVEGRAVVVKRLKPVAVEAIVRGYIAGSGWKEYQKG--- 124

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + +  KLP P+ TP+TK++      D+ I+       GI+ +     
Sbjct: 125 --GIVCGIPLPAGLREAAKLPQPIFTPSTKAALGV--HDENITYARC--EGIIGKELAAK 178

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   +++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++Y +
Sbjct: 179 VRDASIALYSTAVEYAATRGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRFWPADSYME 238

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
               G  P   DK F+R+W+ +     +   P +P  +  +T+  Y  A  ++
Sbjct: 239 ----GRNPPSFDKQFVRDWLESTGWNKQPPAPSLPLEVAQKTADKYREALTRL 287


>gi|258591622|emb|CBE67923.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           (SAICAR synthetase) (ade1/pur7). Catalyses
           ATP+5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
           carboxylate+L-aspartate<=>ADP+phosphate+(S)-2-(5-amino-
           1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate
           [NC10 bacterium 'Dutch sediment']
          Length = 311

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 93/303 (30%), Positives = 155/303 (51%), Gaps = 31/303 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           ++     PEL  Y  GKVR+ Y   D   + +ATDR+SAFD  +   IP KG +L  ++ 
Sbjct: 14  VVLNTECPELTLYARGKVRDIYDFED-RLLLVATDRISAFDVVLPTGIPGKGRILTALST 72

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WFH T+D+  NH L               +      ++ ++ +  PIE IVRGYL+G+ 
Sbjct: 73  FWFHVTADLVPNHLLTTEVDGFPPACRPYRETLQGRSMLVKKTKPLPIECIVRGYLSGSG 132

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + ++ +L  P+ TP+TK+ +     D  I+ +E   R
Sbjct: 133 WVEYQK-----TGTVCGIPLPVGLPESCRLDPPLFTPSTKAEQG--AHDVNITFDEAAAR 185

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             L     E + + +L+L+ER    ALE G+I+ D+K+EFG+    N++L DE+ TPDSS
Sbjct: 186 --LGLELAERVRTLSLALYERARTHALERGIIIADTKFEFGLL-DGNLVLIDEVLTPDSS 242

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  +TY     +       DK F+R+++ +     ++  P++P++I+ RT   Y  A 
Sbjct: 243 RFWPCDTYAPGRSQ----PSFDKQFVRDYLKSIAWDMQEPGPELPQDIVRRTRAKYQEAL 298

Query: 287 EKI 289
            ++
Sbjct: 299 RRL 301


>gi|239930319|ref|ZP_04687272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
 gi|291438664|ref|ZP_06578054.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
 gi|291341559|gb|EFE68515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
          Length = 299

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG +L Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRILTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  +H L    P           LV + L M P+E + RGYL G+            
Sbjct: 72  LADLLPHHVLSTEVPAGAPDDWAGRTLVCKSLNMVPVECVARGYLTGSGLAEYNE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    +
Sbjct: 127 SRTVCGLALPEGLVDGSELPAPIFTPATKAAVGE--HDENVSYEEVARQ--VGADTAARL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+ + R   +A E G+IL D+K+EFG D +  +++ADE+ TPDSSR+W  E +E  
Sbjct: 183 RQATLAAYSRARDVARERGIILADTKFEFGFDGES-LVIADEVLTPDSSRFWPAEQWEPG 241

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+         R     P +P  ++  T   Y+ AYE++TG  
Sbjct: 242 RAQ----PSYDKQYVRDWLTSAESGWDRRGEQPPPPLPRQVVDATRAKYVEAYERLTGTA 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|182437655|ref|YP_001825374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326778291|ref|ZP_08237556.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces cf. griseus XylebKG-1]
 gi|229568624|sp|B1VR40|PUR7_STRGG RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|178466171|dbj|BAG20691.1| putative phosphoribosylaminoimidazole- succinocarboxamide
           synthetase [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|326658624|gb|EGE43470.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces cf. griseus XylebKG-1]
          Length = 304

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 89/305 (29%), Positives = 150/305 (49%), Gaps = 31/305 (10%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL +++ +WF  
Sbjct: 12  QVPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTRLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH +    P           L+ + L+M  +E + RGYL G+          + 
Sbjct: 72  LADLVPNHVISTELPPGAPADWAGRTLICKSLRMVEVECVARGYLTGSGLVEY-----DA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + +  +LP P+ TP TK++      D+ +S  +I     +       +
Sbjct: 127 TRTVCGIGLPEGLVNGSELPGPIFTPATKAAVG--DHDENVSYEDIARE--VGPETAAEL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVET 233
               L ++ R   +A   G+IL D+K+EFG     D  + +I+ADE+ TPDSSR+W   T
Sbjct: 183 RRTTLDVYRRARDIAHGRGIILADTKFEFGFETAEDGTERLIIADEVLTPDSSRFWPAAT 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKI 289
           +E    +       DK F+R+W+ +  + +        P +P  I+  T   YI AYE +
Sbjct: 243 WEPGRAQ----PSYDKQFVRDWLTSPASGWDRASEQPPPALPPEIVAATRAKYIEAYEVL 298

Query: 290 TGLKF 294
           TG  +
Sbjct: 299 TGTNW 303


>gi|325577991|ref|ZP_08148185.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325160224|gb|EGC72352.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 289

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 96/304 (31%), Positives = 149/304 (49%), Gaps = 30/304 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+ +++     L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI
Sbjct: 1   MQAMTQL---SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQI 57

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF+  + I  NH               D      +V ++L    IE IVRGYL G+ 
Sbjct: 58  SNFWFNKLAHIMPNHFTGDSVYDVLPKEEADLVKDRAVVCKRLNPIKIESIVRGYLTGSG 117

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP+ + +  KLP P+ TP++K        D  IS  +    
Sbjct: 118 LKDY-----KQTGAICGLKLPEGLVEASKLPEPIFTPSSKEEVG--NHDINISYEQC--E 168

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       +   A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSS
Sbjct: 169 KAIGAELAAQVREKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSS 228

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W V+TY++    G  P   DK F+R+W+       +   P +P+ +I +T   Y  A 
Sbjct: 229 RFWSVDTYKE----GTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPKEVIDKTVAKYQEAL 284

Query: 287 EKIT 290
           + +T
Sbjct: 285 DLLT 288


>gi|259505966|ref|ZP_05748868.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
 gi|259166447|gb|EEW51001.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
          Length = 297

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 91/299 (30%), Positives = 152/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + +   + +A+DR+SA+D  +   IP KG VL  ++Q++F  
Sbjct: 4   ELSQYKHLSAGKVREIYEIDEHHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFDA 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V ++L M P E +VRGYL G+              
Sbjct: 64  IDFPNHLAGPIDDPRIPEEVLGRAMVCKKLAMMPFECVVRGYLTGSGLEEYRQ-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ +LP P+ TP TK+       D  +S + +  R  L   +   +  
Sbjct: 119 TVCGITLPEGLVESSRLPEPIFTPATKADVG--DHDINVSFDVVEER--LGEARANQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            +++++ R  ++ALE G+IL D+K+EFG+D+   ++L DE+ TPDSSRYW  E YE    
Sbjct: 175 ASIAIYSRAAEIALERGVILADTKFEFGLDENGELVLGDEVLTPDSSRYWPAEGYEA--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +  N     P +P +++  T + YI AYE I+G KF
Sbjct: 232 -GHVQPSFDKQYVRNWLTGPKSGWDKNSGVQPPALPGSVVEATRERYIEAYELISGNKF 289


>gi|25029043|ref|NP_739097.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
 gi|39931985|sp|Q8FML6|PUR7_COREF RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|23494330|dbj|BAC19297.1| phosphoribosylaminoimidazolesuccinocarboxyamide synthase
           [Corynebacterium efficiens YS-314]
          Length = 304

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 91/299 (30%), Positives = 152/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + +   + +A+DR+SA+D  +   IP KG VL  ++Q++F  
Sbjct: 11  ELSQYKHLSAGKVREIYEIDEHHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFDA 70

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V ++L M P E +VRGYL G+              
Sbjct: 71  IDFPNHLAGPIDDPRIPEEVLGRAMVCKKLAMMPFECVVRGYLTGSGLEEYRQ-----TG 125

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ +LP P+ TP TK+       D  +S + +  R  L   +   +  
Sbjct: 126 TVCGITLPEGLVESSRLPEPIFTPATKADVG--DHDINVSFDVVEER--LGEARANQLRD 181

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            +++++ R  ++ALE G+IL D+K+EFG+D+   ++L DE+ TPDSSRYW  E YE    
Sbjct: 182 ASIAIYSRAAEIALERGVILADTKFEFGLDENGELVLGDEVLTPDSSRYWPAEGYEA--- 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +  N     P +P +++  T + YI AYE I+G KF
Sbjct: 239 -GHVQPSFDKQYVRNWLTGPKSGWDKNSGVQPPALPGSVVEATRERYIEAYELISGNKF 296


>gi|222832159|gb|EEE70636.1| predicted protein [Populus trichocarpa]
          Length = 286

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 90/294 (30%), Positives = 146/294 (49%), Gaps = 28/294 (9%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
             GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+  +WF     IC NH
Sbjct: 1   ARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMALFWFDKLGHICPNH 60

Query: 75  T-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                         +       ++ ++L+   IE +VRGYLAG+             R +
Sbjct: 61  LTGEAPESVVTPAEVPQVTGRSMLVKRLKPVLIEAVVRGYLAGSGWKEYQE-----SRSV 115

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ +++  KLP P+ TP  K+       D+ I+    +    +       I   A
Sbjct: 116 CGVPLPEGLTNAAKLPEPIYTPAAKAEMG--DHDENITYERTVEM--VGEKLASQIRDTA 171

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           + +++    +ALE G+I+ D+K+EFG+D+   ++L DE+ TPDSSRYW VE Y ++   G
Sbjct: 172 IRIYKEAAAIALEKGMIIADTKFEFGLDENGELVLMDEVLTPDSSRYWPVEGYAQALANG 231

Query: 242 ITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             P   DK F+R+W+       +        P +P+ +  +T+  Y  A +++T
Sbjct: 232 ENPPSYDKQFVRDWLEQAQVNGKPWDKSAPAPRLPQEVTEKTAAKYREALQRLT 285


>gi|68535415|ref|YP_250120.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium jeikeium K411]
 gi|68263014|emb|CAI36502.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium jeikeium K411]
          Length = 307

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/304 (28%), Positives = 150/304 (49%), Gaps = 25/304 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +L +  + E  ++ +GKVRE Y + +   + + +DR+SA+D  +   IP KG VL  ++ 
Sbjct: 9   LLMRPELCEYEHHSAGKVREIYEVDEDNLLMVVSDRISAYDYVLDTEIPDKGRVLTAVSA 68

Query: 62  YWFHHTSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           ++F                   +Y     ++ ++L M P E + RGYL G+         
Sbjct: 69  FFFDEIDFPNHLAGAMDDERIPEYVLGRAMLCKKLDMIPFECVARGYLTGSGLKEYQE-- 126

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
                 +    LP+ + +  +LP P+ TP TK+       D+ +S + ++    L   + 
Sbjct: 127 ---TGSVCGVELPEGLVEASRLPEPIFTPATKAELG--DHDENVSFDVVVE--ALGEERA 179

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +    LS++++   +A E GLIL D+K+EFG+D    ++LADE+ TPDSSRYW  E Y
Sbjct: 180 NELREATLSIYKKAAAIAEERGLILADTKFEFGLDADGTLVLADEVLTPDSSRYWPAEGY 239

Query: 235 EKSFREGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKIT 290
           E+    G      DK ++RNW+          +    P +P +++  T   YI AYEK++
Sbjct: 240 EE----GKVQPSFDKQYVRNWLTGPKSGWDKSEGTPPPPLPGSVVEATRSRYIEAYEKLS 295

Query: 291 GLKF 294
           G +F
Sbjct: 296 GKRF 299


>gi|325127859|gb|EGC50765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis N1568]
          Length = 287

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKLRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +  +P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPVPKVPADVIQKTVEKYREALTLLT 285


>gi|15602680|ref|NP_245752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|13431799|sp|P57878|PUR7_PASMU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|12721121|gb|AAK02899.1| PurC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 286

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNQLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               D      +V ++L    IE IVRGYL G+           
Sbjct: 65  IMPNHFTGDTVYDVLPKEEADKVKDRAVVCKRLTPIKIESIVRGYLTGSGLKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E     ++       
Sbjct: 121 -TGTICGLALPEGLVEASKLPEPIFTPSSKAEVG--DHDVNISYAEC--EQLIGPELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY +
Sbjct: 176 VKEKAIALYQAAAEYALSKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVETYRE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK FIR+W+ T     +   P +P  +I +T   Y  A + +T
Sbjct: 236 ----GINPPSFDKQFIRDWLETSGWNKQPPAPKVPAEVIEKTVNKYQEALDLLT 285


>gi|300742257|ref|ZP_07072278.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           dentocariosa M567]
 gi|300381442|gb|EFJ78004.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           dentocariosa M567]
          Length = 308

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/312 (31%), Positives = 151/312 (48%), Gaps = 39/312 (12%)

Query: 9   IPELPNYYSGKVRENYFLSDGTR------------------ITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y   +                     + +A+DR+SAFD+ +   I
Sbjct: 10  IPGWTHVYSGKVRDLYVPEESRYDAAGLTVSDDAEIRAGSVMVVASDRISAFDKILPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDI----CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
           P KG++L Q++ +WF   S I     S    +      ++ + L MFP+E IVRGYL G+
Sbjct: 70  PDKGKILTQMSLWWFQQLSHIPNHVISTDVPESVAGRAMICKSLNMFPVECIVRGYLTGS 129

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
              S           I    LP  + D  +L  P+ TPT K+       D+P++  E+  
Sbjct: 130 GLASYRD-----TGSIAGIELPAGLVDGSRLETPIFTPTGKAEVGQ--HDEPVTREELYA 182

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTPD 224
              +       +   +L L+    K+A E G+IL D+K EFG D  +  I L DE+ TPD
Sbjct: 183 E--VGHAIGNRLEELSLELYSTAEKIAREQGIILADTKVEFGTDSYRGEITLGDELLTPD 240

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWIL--TRCNPYRDNIPDIPENIILRTSQTY 282
           SSR+W+   YE    +       DK F+R+W+          DN+P +PE+++ +T   Y
Sbjct: 241 SSRFWDANEYEPGKSQ----PSFDKQFVRDWLRSPESGWDGSDNVPHLPEDVVEKTRARY 296

Query: 283 IAAYEKITGLKF 294
           + AYE++TG KF
Sbjct: 297 VEAYERLTGTKF 308


>gi|294789297|ref|ZP_06754535.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Simonsiella muelleri ATCC 29453]
 gi|294482722|gb|EFG30411.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Simonsiella muelleri ATCC 29453]
          Length = 285

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 149/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D T + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKTMLIVATDRLSAFDVILNEPIDGKGEILTQISNFWFGKLAH 63

Query: 70  ICSNHTLDYPDPNV-------------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH       +V             +V ++L    IE +VRGYL+G+           
Sbjct: 64  ILPNHFTGQTVYDVLPANEAKAIEKRAVVVKRLTPLKIEAVVRGYLSGSGWKEYQQ---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+N+   ++LP  + TP+TK+       D+ IS  + +   I+  +  E 
Sbjct: 120 -SGAVCGIRLPENLRQAEQLPEVIFTPSTKAEVG--DHDENISFEQCVD--IIGADLAEQ 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W ++TY  
Sbjct: 175 VRAKAIQLYTEAAEFAKMRGIIIADTKFEFGLDENGVLTLMDEVLTPDSSRFWAMQTY-- 232

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+ +     +   P +P +++ +T + Y  A   +T
Sbjct: 233 --EVGKNPPSFDKQFVRDWLESSGWNKQPPAPKVPADVLRKTVEKYQEALNVLT 284


>gi|302559827|ref|ZP_07312169.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoflavus Tu4000]
 gi|302477445|gb|EFL40538.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoflavus Tu4000]
          Length = 299

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 91/301 (30%), Positives = 149/301 (49%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L M P+E + RGYL G+            
Sbjct: 72  LADLLPNHVLSTELPAGAPAEWEGRTLVCKSLNMVPVECVARGYLTGSGLVEYDD----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +       +
Sbjct: 127 TRTVCGLALPEGLVDGSELPAPIFTPATKAAVGE--HDENVSYEEVARQ--VGAETAAQL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+ + R   +A E G++L D+K+EFG D    ++LADE+ TPDSSR+W    ++  
Sbjct: 183 RQATLAAYSRARDIARERGIVLADTKFEFGFDGD-TLVLADEVLTPDSSRFWPAGQWQPG 241

Query: 238 FREGITPIGLDKDFIRNWIL--TRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK ++R+W+         R     P +P++++  T   Y+ AYE +TG  
Sbjct: 242 RAQ----PSYDKQYVRDWLTSAESGWDRRSEQPPPPLPQHVVDATRTKYVEAYELLTGTG 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|255326692|ref|ZP_05367768.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           mucilaginosa ATCC 25296]
 gi|255295909|gb|EET75250.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           mucilaginosa ATCC 25296]
          Length = 308

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 96/313 (30%), Positives = 154/313 (49%), Gaps = 39/313 (12%)

Query: 8   YIPELPNYYSGKVRENYFLSDGT------------------RITIATDRLSAFDQNIAC- 48
            IP   + YSGKVR+ Y  ++                     + +A+DR+SAFD+ +   
Sbjct: 9   EIPGWTHIYSGKVRDLYVPNEERFDATGLTVNDDAELRAGSVMVVASDRISAFDRILPTE 68

Query: 49  IPYKGEVLNQITQYWFHHTSDICSN----HTLDYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           IP KG++L Q++ +WF     + ++       D      ++ + L MFP+E IVRGYL G
Sbjct: 69  IPDKGKILTQMSLWWFEQLKQVPNHVLSTDVPDVVAGRAMICRSLNMFPVECIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              +I    LP  + D  +L  P+ TPT K+       D+ ++  E+ 
Sbjct: 129 SGLAVYNE-----TGEIAGVKLPAGLVDGSRLETPIFTPTGKAEVGE--HDELVTREELY 181

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTP 223
               + +   E +   +LSL+    K+A E G+IL D+K EFG D  +  I L DE+ TP
Sbjct: 182 AE--VGQPVGERLEELSLSLYTTAEKIAREQGIILADTKMEFGTDSYRGEITLGDEVLTP 239

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL--TRCNPYRDNIPDIPENIILRTSQT 281
           DSSR+W+ + YE    +       DK ++R+W+          DN+P +PE ++ +T   
Sbjct: 240 DSSRFWDAQQYEPGRAQ----PSFDKQYVRDWLRSPEAGWDGSDNVPHLPEEVVEKTRAR 295

Query: 282 YIAAYEKITGLKF 294
           Y+ AYE++TG KF
Sbjct: 296 YVEAYERLTGTKF 308


>gi|239998523|ref|ZP_04718447.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|240016087|ref|ZP_04722627.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA6140]
 gi|240115182|ref|ZP_04729244.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
          Length = 287

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 147/294 (50%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  + A +P KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPVPGKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|325982195|ref|YP_004294597.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosomonas sp. AL212]
 gi|325531714|gb|ADZ26435.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosomonas sp. AL212]
          Length = 296

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/304 (29%), Positives = 145/304 (47%), Gaps = 28/304 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           +  L +  I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   +P KG++L  +
Sbjct: 4   LSALFETTIKSLPFLHRGKVRDIYAVGDDKLLIVQTDRLSAFDVILPTAVPGKGKILTAL 63

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF   + +  NH               +       V Q+L+  PIE IVRGY+ G+ 
Sbjct: 64  SHFWFQKLAHVLPNHLTGIAPESVVAESEREQVRDRAFVIQRLKPLPIEAIVRGYVVGSG 123

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIH 165
                         I    LP  +    KLP   + TP+TK+       D+ I+  E   
Sbjct: 124 WKDYQQ-----TGAICGIPLPSGLKLADKLPDGAIFTPSTKAPAG--AHDENIALTE--V 174

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
              L +   E +S+ A+ L+      AL+ G+I+ D+K+EFG+D    + L DE+ TPDS
Sbjct: 175 EQQLGKALSEEVSAKAIQLYTEAADYALQRGIIIADTKFEFGLDDVGELYLIDEVLTPDS 234

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W V  Y+    +       DK F+R+W+  +    +   P++P++I+ +T + Y  A
Sbjct: 235 SRFWPVNQYQPGQNQ----PSFDKQFVRDWLEKQDWNKKAPAPELPDDILRQTVEKYREA 290

Query: 286 YEKI 289
              +
Sbjct: 291 LRLL 294


>gi|325144205|gb|EGC66512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M01-240013]
 gi|325206401|gb|ADZ01854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M04-240196]
          Length = 287

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E      + +     
Sbjct: 121 -TGSVCGIRLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECERS--IGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGRLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|213405597|ref|XP_002173570.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Schizosaccharomyces japonicus yFS275]
 gi|212001617|gb|EEB07277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Schizosaccharomyces japonicus yFS275]
          Length = 300

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 96/315 (30%), Positives = 164/315 (52%), Gaps = 34/315 (10%)

Query: 1   MRILSKAYIPE-LPNYYSGKVRENYFLSDG--TRITIATDRLSAFDQNI-ACIPYKGEVL 56
           M  L +  +P       SGKVR+ Y   +   T   +ATDR+SAFD  +   IP KG++L
Sbjct: 1   MPALLQTNLPAPFRKIASGKVRDIYECQEDLSTLYFVATDRISAFDVIMENGIPDKGKIL 60

Query: 57  NQITQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGY 101
            +I+++WF+      + H +               D      ++ ++ ++ PIE IVRGY
Sbjct: 61  TKISEFWFNVLKPHTATHLVTSEWDKMPAVAAPFADQLKDRTMLVRRYKVLPIEAIVRGY 120

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           + G+  +            ++   +P+ M ++Q  P P+ TP+TK++E     D+ I P+
Sbjct: 121 ITGSAWSEYKK-----SGTVHGMPMPEGMQESQAFPEPLFTPSTKAAEG---HDENIHPD 172

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
           ++  + I+  +    ++  ++ L++     A E G+I+ D+K+EFG+D++ N+IL DE+ 
Sbjct: 173 QV--KDIIGADLAAKVAELSVKLYKVARDTAKEKGIIIADTKFEFGVDEQNNVILVDEVL 230

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W    Y      G      DK ++RNW++      +  +  +PENI+  T Q 
Sbjct: 231 TPDSSRFWLAADY----AVGKPQESFDKQYLRNWLIAENVRGKPGV-KLPENIVSSTRQK 285

Query: 282 YIAAYEKITGLKFIA 296
           YI AYE I G K++A
Sbjct: 286 YIEAYEMICGKKWVA 300


>gi|330923922|ref|XP_003300429.1| hypothetical protein PTT_11676 [Pyrenophora teres f. teres 0-1]
 gi|311325438|gb|EFQ91481.1| hypothetical protein PTT_11676 [Pyrenophora teres f. teres 0-1]
          Length = 301

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 155/308 (50%), Gaps = 27/308 (8%)

Query: 2   RILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
             ++   I   LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  +
Sbjct: 4   SAVTNIDIKGKLPKVASGKVRDLYAIDDDTLLFVASDRISAYDVIMENGIPGKGALLTAM 63

Query: 60  TQYWFHHTSDICSNHTLDY--------------PDPNVLVGQQLQMFPIELIVRGYLAGN 105
           + YWFH+           +                   +  ++L++ PIE IVRGY+ G+
Sbjct: 64  SIYWFHYLPTQVPGLKTHFLSSSLPAPLSDQPDLKDRSMQVRRLRILPIESIVRGYITGS 123

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             +            +    LP  + + QKLP P+ TP+TK+       D+ ISP +   
Sbjct: 124 GWSEYAK-----LGTVNGIKLPAGLIEGQKLPEPLWTPSTKADVGGK--DENISPEKARE 176

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             I      + +   +L++++   K A E G+IL D+K+EFG+D+   ++L DE+ TPDS
Sbjct: 177 L-IGDATVAKKVEELSLAIYQAAAKRAEEVGIILADTKFEFGVDEGGEVVLVDEVLTPDS 235

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  E++E +   G      DK F+R+W+       ++ +  +PE+++ RT+  Y  A
Sbjct: 236 SRFWPKESWESNL--GRAQPSFDKQFLRDWLTDNGLKGKEGV-KVPEDVVERTAAKYREA 292

Query: 286 YEKITGLK 293
            EK+TG  
Sbjct: 293 CEKLTGKS 300


>gi|296413674|ref|XP_002836534.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630361|emb|CAZ80725.1| unnamed protein product [Tuber melanosporum]
          Length = 300

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 96/310 (30%), Positives = 160/310 (51%), Gaps = 32/310 (10%)

Query: 3   ILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
            L+   +   LP    GKVR+ Y LS    + +ATDR+SA+D  +   IP KG++L  ++
Sbjct: 2   ALTCTDLRGTLPLLAQGKVRDVYTLSSDHLLFVATDRISAYDVIMKNGIPNKGKLLTALS 61

Query: 61  QYWFH-HTSDICSNHTLD---------------YPDPNVLVGQQLQMFPIELIVRGYLAG 104
           ++WF     D+  NH +                      +V ++L++FP+E IVRGYL G
Sbjct: 62  EFWFTTVLKDVGLNHFVSSSMEFLPEKLQKYSAQLKGRSMVVKRLKIFPVEAIVRGYLTG 121

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               ++   +P+ M ++Q    P+ TP+TK+++     D+ I P++  
Sbjct: 122 SAWIEYKK-----SGTVHGIRVPEGMVESQAFEKPLFTPSTKAAQGK--HDENIHPDKTA 174

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++     + I   +L+L+ +    A E G+I+ D+K+EFG+D+  N++L DE+ TPD
Sbjct: 175 --QLVGHEYAKEIEKLSLALYTKARDYAAERGIIIADTKFEFGLDEDGNVVLVDEVLTPD 232

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W    Y    R G +    DK F+RNW+       R  I  +P+ I+L TS+ Y  
Sbjct: 233 SSRFWLSSAY----RAGRSQDSYDKQFLRNWLTESGVKGRPGI-VMPDEIVLETSKKYHE 287

Query: 285 AYEKITGLKF 294
           AYE +TG ++
Sbjct: 288 AYELLTGSEW 297


>gi|254669728|emb|CBA03897.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis alpha153]
          Length = 287

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|319950170|ref|ZP_08024102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dietzia
           cinnamea P4]
 gi|319436158|gb|EFV91346.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dietzia
           cinnamea P4]
          Length = 297

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 92/299 (30%), Positives = 146/299 (48%), Gaps = 26/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +  SGKVRE Y + D T + +ATDR+SA+D  +   IP KG VL  ++ ++F  
Sbjct: 4   DLSSYRHLVSGKVRELYEIDDETLLMVATDRISAYDHVLGTPIPDKGRVLTAMSAFFFDA 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     +             +V ++L M   E + RGYL G+  T           
Sbjct: 64  LDVPNHLAGPLDDERIPAEVLGRAMVVRRLDMVQAECVARGYLTGSGITEYRE-----SG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LPD + +  KLP P+ TP TK++      D+ IS +++    I+     E + S
Sbjct: 119 TVCGIELPDGLVEASKLPEPIFTPATKAAVG--DHDENISFDQLTR--IVGDELAERLRS 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R  ++A + G++L D+K+EFG+     +ILADE+ TPDSSRYW  + Y     
Sbjct: 175 ETLDIYSRAAEIAADRGVLLADTKFEFGL-ADGELILADEVLTPDSSRYWPADDYSPGRV 233

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK F+RNW+      +        P +P+ ++  T + YI AYE+I+GL F
Sbjct: 234 Q----PSFDKQFVRNWLTGPEAGWNKDADTPPPVLPDAVVAATRERYIEAYERISGLSF 288


>gi|302869717|ref|YP_003838354.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Micromonospora aurantiaca ATCC 27029]
 gi|315503801|ref|YP_004082688.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Micromonospora sp. L5]
 gi|302572576|gb|ADL48778.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Micromonospora aurantiaca ATCC 27029]
 gi|315410420|gb|ADU08537.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Micromonospora sp. L5]
          Length = 277

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/290 (27%), Positives = 141/290 (48%), Gaps = 21/290 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y       I +ATDR+S +D  +   IP KG +L  ++ +WF   SD+
Sbjct: 1   MELLHSGKVRDVYA-DGEDLILVATDRVSIYDVVLPTPIPDKGRLLTALSLWWFEQLSDL 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +             +  ++L M P+E + RGYL G                +   
Sbjct: 60  VPNHVISATDVPAEFAGRAIRCRRLDMVPVECVARGYLTGGGFAEYQR-----TGSVSGV 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +   LP P+ TP+TK+ +     D+PI+  +++ +  +     E +    + +
Sbjct: 115 PLPRGLVEASILPEPIFTPSTKAPKGE--HDEPITYEQVVDK--VGPEVAERLRQITVDV 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG ++A E G+++ D+K E G      ++L DE+ T DSSR+W  E+Y+    +    
Sbjct: 171 YRRGAEIAAERGILIADTKLELGWAPDGTLVLGDEVLTSDSSRFWPAESYQPGRAQFS-- 228

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              DK ++R+W  +     +   P++P  +I  T   Y+  YEK+TG ++
Sbjct: 229 --YDKQYVRDWATSSGWDKQPPAPEVPAEVIEATRTRYVEVYEKLTGNRW 276


>gi|194367499|ref|YP_002030109.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas maltophilia R551-3]
 gi|229568625|sp|B4SLF7|PUR7_STRM5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|194350303|gb|ACF53426.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stenotrophomonas maltophilia R551-3]
          Length = 308

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 93/315 (29%), Positives = 148/315 (46%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-IP 50
             L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDIPRERLPAGTPPGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WF  T+ +  NH                       +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFAKTAHLMPNHLTGIDVASVLPEGVDPALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              K+    LPD +   ++LP P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKVSGIDLPDGLRQAEQLPEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++ +  +     E +    L +++     A E G+IL D+K+EFG D    + +
Sbjct: 176 NIDFDAMVKQ--VGAEMAERVRDATLRIYKFAADYARERGIILADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P IP  II 
Sbjct: 234 MDEMLTPDSSRYWPADEY----EVGTSPPSYDKQFVRDYLETLDWGKTAPGPTIPAEIIE 289

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 290 RTRAKYGEALQRLAG 304


>gi|332525419|ref|ZP_08401579.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rubrivivax benzoatilyticus JA2]
 gi|332108688|gb|EGJ09912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rubrivivax benzoatilyticus JA2]
          Length = 300

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 85/308 (27%), Positives = 146/308 (47%), Gaps = 32/308 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
             L ++ +  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KGE+L ++ 
Sbjct: 3   TALYQSDLHSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVVLDDPIPGKGELLTRMA 62

Query: 61  QYWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF     I  +H              +       ++ ++L+  P+E +VRGYLAG+  
Sbjct: 63  LFWFDKLGSIVPHHLTGEDPCSVVAADEVAQVRGRSMLVKRLKGLPVEAVVRGYLAGSGW 122

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  + +  +LP P+ TP TK++      D+ I    +    
Sbjct: 123 KEYQQ-----SGTVCGVALPPGLKNASRLPAPIFTPATKAAVG--DHDENIPFERM--EQ 173

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           ++       +   ++ L+E     AL  G+I+ D+K+EFG+D++  + L DE+ TPDSSR
Sbjct: 174 MIGAELAAQVREVSIRLYEAAAAHALTRGIIIADTKFEFGLDERGTLTLMDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTY 282
           +WE   + +    G  P   DK  +R+W+ T     +    R   P +P  +   ++  Y
Sbjct: 234 FWEASGWVE----GENPPSYDKQPVRDWLETATVDGQPWNKRAPAPRLPAEVAAASTARY 289

Query: 283 IAAYEKIT 290
             A E++T
Sbjct: 290 ALACERLT 297


>gi|229822072|ref|YP_002883598.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Beutenbergia cavernae DSM 12333]
 gi|229567985|gb|ACQ81836.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Beutenbergia cavernae DSM 12333]
          Length = 307

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/310 (26%), Positives = 148/310 (47%), Gaps = 36/310 (11%)

Query: 8   YIPELPNYYSGKVRENYFLS------------DGTRITIATDRLSAFDQNIAC-IPYKGE 54
            +P   +  SGKVR+ Y               D   + +A+DR+SA+D  +   IP KG 
Sbjct: 11  QVPGWRHVASGKVRDLYVPDAPPAGSLAVEPADAVVLLVASDRISAYDYVLPTPIPDKGA 70

Query: 55  VLNQITQYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           +L  ++ +WF   +D+  NH +    P       ++ ++L M+P+E + RGYLAG+    
Sbjct: 71  ILTALSVWWFEQLADVVPNHLVSLDVPGAVAGRAMICRRLDMYPVECVARGYLAGSGLAE 130

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                      +    LP  + +  KLP P+ TP TK+       D+ ++  +      +
Sbjct: 131 YRE-----TGAVCGVELPPGLVEGSKLPRPIFTPATKADLGE--HDENVTFEKAAAE--V 181

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTPDSSRY 228
             +    +    L L+ R  ++A   G+IL D+K+EFG     + I+  + + TPDSSRY
Sbjct: 182 GEDVATRLRDLTLELYTRASQIAAGRGIILADTKFEFGRRPGTDEIVLGDEVLTPDSSRY 241

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIA 284
           W  ET++    +       DK ++R+W+ +  + +        P++P +++ +T   Y+ 
Sbjct: 242 WPAETWQPGRPQ----PSFDKQYVRDWLASPASGWDRTGGALPPELPADVVEKTRARYVE 297

Query: 285 AYEKITGLKF 294
           AYE++TG  F
Sbjct: 298 AYERLTGRAF 307


>gi|315107909|gb|EFT79885.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL030PA1]
          Length = 421

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 90/314 (28%), Positives = 158/314 (50%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++ +LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-DLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDLLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQR--- 116

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
              R +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 117 --NRAVCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|254804637|ref|YP_003082858.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase [Neisseria
           meningitidis alpha14]
 gi|254668179|emb|CBA04877.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis alpha14]
          Length = 287

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|325265861|ref|ZP_08132547.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Kingella denitrificans ATCC 33394]
 gi|324982499|gb|EGC18125.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Kingella denitrificans ATCC 33394]
          Length = 288

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 93/304 (30%), Positives = 145/304 (47%), Gaps = 33/304 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L       L   YSGKVR+ Y +   T + +ATDRLSAFD  +   I  KGE+L QI
Sbjct: 3   MNTL------SLKKIYSGKVRDLYEIDSKTMLIVATDRLSAFDVILDEPIVGKGEILTQI 56

Query: 60  TQYWFHHTSDICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF   + I  NH                      +V ++L    IE +VRGYL+G+ 
Sbjct: 57  SNFWFGKLAHIMPNHFTGQTVFDVLPEAEAQAVARRAVVAKRLTPVKIEAVVRGYLSGSG 116

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP  + + ++LP  + TP+TK+       D+ IS       
Sbjct: 117 WKEYQK-----SGTVCSIQLPAGLREAEQLPEVIFTPSTKAEVG--DHDENISFERCAE- 168

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ + + E + + A+ L+      A   G+I+ D+K+EFG+D+   + L DE+ TPDSS
Sbjct: 169 -IIGKERAEEVRAKAIQLYTEAAAYAKTRGIIIADTKFEFGLDENGVLTLMDEVLTPDSS 227

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W VE+Y    + G  P   DK F+R+W+       +   P +PE+++ +T   Y  A 
Sbjct: 228 RFWAVESY----QVGTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPEDVLAKTVAKYREAL 283

Query: 287 EKIT 290
             +T
Sbjct: 284 NVLT 287


>gi|91200646|emb|CAJ73696.1| strongly similar to phosphoribosylaminoimidazole-succinocarboxamide
           (SAICAR) synthase [Candidatus Kuenenia stuttgartiensis]
          Length = 300

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 162/315 (51%), Gaps = 35/315 (11%)

Query: 1   MRI---LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVL 56
           M+    L    I +L  +  GKVR+ Y +++   + + TDR+SAFD  +   IPYKG+VL
Sbjct: 1   MKTTQPLLTTNISQLKLHNRGKVRDIYEVNND-LLIVTTDRISAFDVVLPNGIPYKGQVL 59

Query: 57  NQITQYWFHHTSDICSNHTL----------------DYPDPNVLVGQQLQMFPIELIVRG 100
             +++YWFH+T+D+  NH +                D      ++ +++ + P+E I+RG
Sbjct: 60  TGLSEYWFHYTADVTENHLITTDIDSIDNTFVRHHKDILQGRSMLVKKVNVIPVECIIRG 119

Query: 101 YLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISP 160
           YLAG+       F       I    LP  + ++ KLP P+ TP+TK+       D+ I  
Sbjct: 120 YLAGSGWKEYQKFQ-----SICGIKLPAGLKESDKLPEPIFTPSTKAHTG---HDENIPV 171

Query: 161 NEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEI 220
           +E+    ++ +   + +   +L ++ +  + A   G+I+ D+K+E+GI      +L DE+
Sbjct: 172 SEV--INLIGKTLTDELKEKSLKIYSKASEYAKSRGIIICDTKFEWGITNNNKTMLIDEV 229

Query: 221 HTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQ 280
            TPDSSR+W +E Y     +       DK FIR+++ +         P +P +II +TS+
Sbjct: 230 LTPDSSRFWPLEFYTPGKPQ----PSYDKQFIRDYLESIHWDKNPPAPALPPDIIQKTSE 285

Query: 281 TYIAAYEKITGLKFI 295
            Y+ AY+ +TG   I
Sbjct: 286 KYLNAYKTLTGKSLI 300


>gi|300859150|ref|YP_003784133.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|300686604|gb|ADK29526.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|302206844|gb|ADL11186.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium pseudotuberculosis C231]
 gi|308277096|gb|ADO26995.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium pseudotuberculosis I19]
          Length = 297

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 149/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+F H
Sbjct: 4   ELSQYTHVSAGKVREIYEIDDERLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFDH 63

Query: 67  TSD-------ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      LV ++L+M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGSIDDPAIPEEVLGRALVCKKLKMLPFECVARGYLTGSGLKEYQQ-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
           K+    LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   + +
Sbjct: 119 KVCGIELPEGLVEASKLPSPIFTPATKADFG--DHDENVSFDAVVDK--LGEARANELRA 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++     +A   G+IL D+K+EFG+D+  N++LADE  TPDSSRYW  + YE+   
Sbjct: 175 VTLKIYSEAAAIAESRGIILADTKFEFGLDEDGNLVLADEALTPDSSRYWPADGYEEGKA 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK ++RNW+    + +        P +P +++  T + Y+ A+E ITG KF
Sbjct: 235 Q----PSFDKQYVRNWLTGPKSGWSTDSLSPPPSLPGSVVEATRERYVEAFESITGKKF 289


>gi|256380864|ref|YP_003104524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinosynnema mirum DSM 43827]
 gi|255925167|gb|ACU40678.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Actinosynnema mirum DSM 43827]
          Length = 295

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/300 (27%), Positives = 151/300 (50%), Gaps = 26/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + + P   +GKVR  + + D   + +A+DR+SA+D  ++  IP KG VL  ++ +WF  
Sbjct: 3   QLADYPVIATGKVRSVHAVDDELLLFVASDRISAYDHVLSTPIPDKGRVLTAMSVFWFDK 62

Query: 67  TSDICSNHTLDYPDPNVL--------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            +D+  NH + + DP +         + ++L M  +E + RGYL G+             
Sbjct: 63  LADLAPNHLVAWDDPRIPAEVRGRALLVRRLDMVQVECVARGYLTGSGMVEYRE-----T 117

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LP+ + +  +L  P+ TP TK+       D+ +S   +    ++     E + 
Sbjct: 118 GSVCGVPLPEGLVEASELAEPIFTPATKAELG--AHDENVSFAHV--ESVVGGALAEELR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
           +  L ++    + A   G++L D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y+   
Sbjct: 174 ARTLQVYSAAREHARSRGVVLADTKFEFGVDRAGTLVLADEVLTPDSSRYWPADSYQAGR 233

Query: 239 REGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            +       DK ++R+W+ +  + +        P +P  ++  T   Y+ AYE+ITGL F
Sbjct: 234 VQ----PSFDKQYVRDWLTSAESGWDRKSDAPPPALPAEVVAATRARYVEAYERITGLSF 289


>gi|322419881|ref|YP_004199104.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. M18]
 gi|320126268|gb|ADW13828.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. M18]
          Length = 296

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 91/309 (29%), Positives = 145/309 (46%), Gaps = 32/309 (10%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   +     P L     GKVR+ Y L + T + + TDR+SAFD  +   IP KG VL Q
Sbjct: 1   MTTPVLNTDFPGLKLAARGKVRDIYDLGE-TLLIVTTDRISAFDVIMNEGIPNKGYVLTQ 59

Query: 59  ITQYWFHHTSDICSNHTLDYPD---------------PNVLVGQQLQMFPIELIVRGYLA 103
           I+ YWF    DI  NH +                      +  ++ +    E IVRGY++
Sbjct: 60  ISAYWFRQMEDIIKNHIISTDVAEFPKECQPYAETLAGRSMWVKKAKPLAAECIVRGYIS 119

Query: 104 GNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
           G+               I    LP+ + ++ +LP P+ TP+TK+       D+ IS   +
Sbjct: 120 GSGWKDYQQ-----TGAICGIKLPEGLKESDRLPQPIFTPSTKAELG--THDENISFERM 172

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTP 223
               I  +   E +    L ++E+   LA + G+I+ D+K+E+GI +   +I+ DE  TP
Sbjct: 173 CE--ICGKEISEKVRDVTLRIYEKARDLADQKGIIIADTKFEYGIYEG-ELIIIDECMTP 229

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W  E+Y+    +       DK F+R+++ T         P +P  I+ +T + Y+
Sbjct: 230 DSSRFWPKESYQPGGPQ----PSFDKQFLRDYLETLDWGKTAPAPPLPAEIVAKTGEKYM 285

Query: 284 AAYEKITGL 292
            A  K+TG 
Sbjct: 286 EALVKLTGK 294


>gi|89899021|ref|YP_521492.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodoferax ferrireducens T118]
 gi|122480255|sp|Q222U2|PUR7_RHOFD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|89343758|gb|ABD67961.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodoferax ferrireducens T118]
          Length = 305

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/312 (26%), Positives = 147/312 (47%), Gaps = 36/312 (11%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            L  + +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KG +L Q+  
Sbjct: 7   ALHTSMLTSLPLLARGKVRDNYAVGIDRILMVASDRLSAFDVIMGEPIPGKGALLTQMAL 66

Query: 62  YWFHHT-----------------SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           +WF                      + +   +       ++ ++L+  P+E +VRGYLAG
Sbjct: 67  FWFDKLGPKGLNLCPIHLTGDAPESVVTAAEVPQVTGRSMLVKRLKPLPVEAVVRGYLAG 126

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +    LP  + +  KLP P+ TP  K++      D+ I+  + +
Sbjct: 127 SGWKEY-----QHNGAVCGVKLPAGLQNASKLPEPIYTPAAKAAAG--DHDENITFEQTV 179

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
               +  +    I   ++++++   ++A   G+I+ D+K+EFG+D    + L DE+ TPD
Sbjct: 180 EM--IGLDLATRIRDISIAIYKAASEIARAKGIIIADTKFEFGLDADGTLTLMDEVLTPD 237

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTS 279
           SSR+W  E+Y++    GI P   DK F+R+W+       +        P +P+ +I +T+
Sbjct: 238 SSRFWPAESYQE----GINPPSFDKQFVRDWLEQVQVNGKPWNKTPPAPRVPDEVIAKTA 293

Query: 280 QTYIAAYEKITG 291
             Y  A  ++ G
Sbjct: 294 AKYQEALTRLIG 305


>gi|283457376|ref|YP_003361952.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rothia
           mucilaginosa DY-18]
 gi|283133367|dbj|BAI64132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rothia
           mucilaginosa DY-18]
          Length = 342

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 96/313 (30%), Positives = 154/313 (49%), Gaps = 39/313 (12%)

Query: 8   YIPELPNYYSGKVRENYFLSDGT------------------RITIATDRLSAFDQNIAC- 48
            IP   + YSGKVR+ Y  ++                     + +A+DR+SAFD+ +   
Sbjct: 43  EIPGWTHIYSGKVRDLYVPNEERFDATGLTVNDDAELRAGSVMVVASDRISAFDRILPTE 102

Query: 49  IPYKGEVLNQITQYWFHHTSDICSN----HTLDYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           IP KG++L Q++ +WF     + ++       D      ++ + L MFP+E IVRGYL G
Sbjct: 103 IPDKGKILTQMSLWWFEQLKQVPNHVLSTDVPDVVAGRAMICRSLNMFPVECIVRGYLTG 162

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              +I    LP  + D  +L  P+ TPT K+       D+ ++  E+ 
Sbjct: 163 SGLAVYNE-----TGEIAGVKLPAGLVDGSRLDTPIFTPTGKAEVGE--HDELVTREELY 215

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTP 223
               + +   E +   +LSL+    K+A E G+IL D+K EFG D  +  I L DE+ TP
Sbjct: 216 AE--VGQPVGERLEELSLSLYTTAEKIAREQGIILADTKMEFGTDSYRGEITLGDEVLTP 273

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL--TRCNPYRDNIPDIPENIILRTSQT 281
           DSSR+W+ + YE    +       DK ++R+W+          DN+P +PE ++ +T   
Sbjct: 274 DSSRFWDAQQYEPGRAQ----PSFDKQYVRDWLRSPEAGWDGSDNVPHLPEEVVEKTRAR 329

Query: 282 YIAAYEKITGLKF 294
           Y+ AYE++TG KF
Sbjct: 330 YVEAYERLTGTKF 342


>gi|116671947|ref|YP_832880.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter sp. FB24]
 gi|116612056|gb|ABK04780.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter sp. FB24]
          Length = 317

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 84/313 (26%), Positives = 152/313 (48%), Gaps = 35/313 (11%)

Query: 5   SKAYIPELPNYYSGKVRENYFLSDGTR---------ITIATDRLSAFDQNIAC-IPYKGE 54
           +   +P   + YSGKVR+ Y  +D +          + +A+DR+SA+D  ++  IP KG 
Sbjct: 18  ATLDLPGWRHVYSGKVRDLYVPADDSLARQFGQDCVLVVASDRISAYDHVLSSEIPDKGR 77

Query: 55  VLNQITQYWFHHTS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           +L Q++ +WF               +      +   ++ ++L MFP+E I RGYL G+  
Sbjct: 78  ILTQLSLWWFDQLDVAHHVLASTVEDGVPAAVEGRAMICKKLDMFPVECIARGYLTGSGL 137

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      R +    LP+ + D  +L   + TP+ K+       D+ I+ + ++  G
Sbjct: 138 LEYQQ-----SRTVCSIPLPEGLVDGSRLDEAIFTPSAKAEVGE--HDENITYDAVV--G 188

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTPDSS 226
           ++  +    +    L ++ +  ++A   G+IL D+K EFG D    +I   + + TPDSS
Sbjct: 189 LVGEDVAARLRELTLKIYTKAEEIARGRGIILADTKVEFGFDVSTGVITLGDEVLTPDSS 248

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTY 282
           R+W+  TYE    +       DK ++R+W+ +  + +        P +PE+++ RT   Y
Sbjct: 249 RFWDAATYEPGKSQ----PSYDKQYVRDWLTSDESGWDRASDVPPPALPEDVVSRTRGRY 304

Query: 283 IAAYEKITGLKFI 295
           + AYEK+TG  F+
Sbjct: 305 VEAYEKLTGRAFV 317


>gi|330469959|ref|YP_004407702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucosispora maris AB-18-032]
 gi|328812930|gb|AEB47102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucosispora maris AB-18-032]
          Length = 277

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 79/291 (27%), Positives = 146/291 (50%), Gaps = 21/291 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y   D   I +A+DR+S +D  +   IP KG++L  ++ +WF   +D+
Sbjct: 1   MELLHSGKVRDVYADGDD-LILVASDRISVYDVVLPTPIPDKGKLLTALSLWWFEQLADL 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             +H +             +  ++L+M P+E + RG+L G                +   
Sbjct: 60  VPHHVISATDVPAEFAGRAIRCRRLEMVPVECVARGFLTGGGLKEYER-----TGAVSGV 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +   LP P+ TP+TK+       DQP++  E++ +  +     E +    + +
Sbjct: 115 ELPRGLVEASILPEPIFTPSTKAPMGE--HDQPMTFAEVVDK--VGAQTAERLRQVTIDV 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG +LA + G+++ D+K E G      ++LADE+ TPDSSR+W  E+Y+    +    
Sbjct: 171 YCRGTELAAQRGILVADTKIELGWAADGTLVLADEVLTPDSSRFWPAESYQPGRAQFS-- 228

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              DK ++R+W  +     ++  P++P  ++  T   Y+  YEK+TG ++ 
Sbjct: 229 --YDKQYVRDWAASSGWNKQEPAPEVPAEVVEATRARYVDVYEKLTGNRWE 277


>gi|300784098|ref|YP_003764389.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
 gi|299793612|gb|ADJ43987.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
          Length = 280

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/291 (30%), Positives = 151/291 (51%), Gaps = 20/291 (6%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           + + ++GKVR+ Y L  G  + +A+DR+S +D ++   IP KG++LNQ++ +WF   +D+
Sbjct: 1   MKHIHAGKVRDLYELDGGDILLVASDRVSVYDVSLPTPIPDKGKLLNQLSAWWFDRMADV 60

Query: 71  CSNHTLDYPD------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +   D         +  + L+M  +E I RGYLAG               +I   
Sbjct: 61  VPNHVVSTTDVPEEFAGRAMRCKPLKMIQVECIARGYLAGLGLREYQR-----DGRISGV 115

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +  KLP P+ TPTTK   S +G D+ ++ +E+     +  +  + +    L +
Sbjct: 116 ALPPGLVEGDKLPEPIFTPTTK--ISDTGHDEFMTFDEV--LNEIGEDTAKRLRELTLEI 171

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + +G + A + G+I+ D+K EFG D    + L DE+ T DSSR+W  + +E    +    
Sbjct: 172 YTKGAEHAAKQGVIIADTKLEFGFDADGTLTLGDEVLTSDSSRFWPADAWEPGRPQ---- 227

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              DK F+R+W  +         P+IP +I+ +T Q Y   YE+ITG  ++
Sbjct: 228 HAFDKQFVRDWSRSTGWDQTPPGPEIPADIVEQTRQRYTEVYERITGKTWV 278


>gi|145596238|ref|YP_001160535.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinispora tropica CNB-440]
 gi|254783974|sp|A4XB58|PUR7_SALTO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|145305575|gb|ABP56157.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinispora tropica CNB-440]
          Length = 277

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/290 (27%), Positives = 142/290 (48%), Gaps = 21/290 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y   D   I +A+DR+S +D  +   IP KG++L  ++ +WF   +++
Sbjct: 1   MELLHSGKVRDVYADGDD-LILVASDRVSVYDVVLPTPIPEKGKLLTALSLWWFDQLAEL 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH L             +  ++L+M P+E + RGYL G                +   
Sbjct: 60  VPNHVLSATDVPVELAGRAIRCRRLEMVPVECVARGYLVGGGFAEYQR-----TGVVSGI 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  M +   LP P+ TP+TK+       DQP++  E++ +  +     E +    L +
Sbjct: 115 ELPRGMVEAAALPEPIFTPSTKAPVGE--HDQPMTFGEVVDK--VGAETAERLRQITLDV 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG +LA + G+++ D+K E G      + + DE+ T DSSR+W  E+Y+    +    
Sbjct: 171 YRRGAELAADRGILIADTKIELGWAADGTLTVGDELLTSDSSRFWPAESYQPGRAQFS-- 228

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              DK ++R+W        R   P++P+ ++  T   Y+  YE++TG ++
Sbjct: 229 --YDKQYVRDWATRSGWDRRSPAPEVPDEVVDATRARYVDVYERLTGERW 276


>gi|260913668|ref|ZP_05920144.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Pasteurella dagmatis ATCC 43325]
 gi|260632207|gb|EEX50382.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Pasteurella dagmatis ATCC 43325]
          Length = 286

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 146/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               D      +V ++L    IE IVRGYL G+           
Sbjct: 65  IMPNHFTGDSVYDVLPREEADLVKERSVVCKRLNPIKIESIVRGYLTGSGLKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E     ++       
Sbjct: 121 -TGTICGLSLPEGLVEASKLPEPIFTPSSKAEVG--DHDINISYEEC--EKLIGAELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 176 VKEKAITLYKVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               GI P   DK FIR+W+           P +P  +I +T   Y  A + +T
Sbjct: 236 ----GINPPSFDKQFIRDWLQNSGWNKEPPAPKVPAEVIQKTVDKYQEALDLLT 285


>gi|238021174|ref|ZP_04601600.1| hypothetical protein GCWU000324_01072 [Kingella oralis ATCC 51147]
 gi|237868154|gb|EEP69160.1| hypothetical protein GCWU000324_01072 [Kingella oralis ATCC 51147]
          Length = 325

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 94/303 (31%), Positives = 151/303 (49%), Gaps = 28/303 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L+   IP L   YSGKVR+ Y +++ T + +A+DRLSAFD  +   IP+KGE+L QI+
Sbjct: 36  ESLTMTTIP-LKKLYSGKVRDLYEINEQTMLIVASDRLSAFDVILNEPIPHKGEILTQIS 94

Query: 61  QYWFHHTSDICSNHTLDYPDP-------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
            +WF+  + I  NH                      +V ++L    IE +VRGYL+G+  
Sbjct: 95  NFWFNKLAHIMPNHFTGQTVHDILPEATARAIAQRAVVAKRLTPVKIEAVVRGYLSGSGW 154

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
            +          +I    LP ++ + +KLP  + TP+TK++      D+ IS        
Sbjct: 155 KAY-----QATGEICGIQLPAHLHEAEKLPEVIFTPSTKAAVG--DHDENISFERCADL- 206

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +     + + + A+ L+      A   G+I+ D+K+EFG+D    + L DE+ TPDSSR
Sbjct: 207 -IGSELAQQVRAKAIQLYTEAAAYAATRGIIIADTKFEFGLDANGTLTLMDEVLTPDSSR 265

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  ++Y    + G  P   DK FIR+W+       +   P IPE+++ +T   Y  A  
Sbjct: 266 FWAAQSY----QVGSNPPSFDKQFIRDWLERSGWNKQPPAPAIPEDVLAKTVAKYQEALR 321

Query: 288 KIT 290
            +T
Sbjct: 322 LLT 324


>gi|325830044|ref|ZP_08163501.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Eggerthella sp. HGA1]
 gi|325487511|gb|EGC89949.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Eggerthella sp. HGA1]
          Length = 292

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 153/297 (51%), Gaps = 32/297 (10%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
             GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH
Sbjct: 10  AQGKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENH 68

Query: 75  TL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               DY     ++ ++  MFP E IVRGYLAG+            + 
Sbjct: 69  LISSDVADLPEQFQPYADYLRGRFMLVKKADMFPAECIVRGYLAGSGLKEYQK-----QG 123

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +  
Sbjct: 124 TVCGIQLPEGLVNSSKLPEPIFTPSTKAEIG--DHDENISYERLVE--IIGEDDASQLRD 179

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            AL ++      A E G+I+ D+K+EFG      IILADE+ TPDSSR+W  + Y +   
Sbjct: 180 LALKVYTTARDHAAERGVIIADTKFEFGRL-NGQIILADEVLTPDSSRFWPGDEYAEGKD 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           +       DK F+R+W+       + N P +P++II RTS+ YI AYEKITG  F+ 
Sbjct: 239 Q----PSFDKQFVRDWLNAN-WDRQGNPPRLPQDIIDRTSEKYIQAYEKITGRTFVP 290


>gi|32033842|ref|ZP_00134127.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209472|ref|YP_001054697.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae L20]
 gi|126098264|gb|ABN75092.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 285

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E      +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEEC--EHQIGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|313836144|gb|EFS73858.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA2]
 gi|314927583|gb|EFS91414.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL044PA1]
 gi|314971422|gb|EFT15520.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA3]
 gi|328906355|gb|EGG26130.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium sp. P08]
          Length = 412

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 90/292 (30%), Positives = 150/292 (51%), Gaps = 24/292 (8%)

Query: 11  ELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +LP    GKVR  Y   D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   
Sbjct: 7   DLPLLAEGKVRRLYRFPDQPGRLLMVATDRISAYDHVLTPGVPGKGAILTSMSLWWFDQL 66

Query: 68  SDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +DI  NH +    P       +V ++L MFP+E +VRGYL G+           G R + 
Sbjct: 67  ADIVDNHLVGLDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEY-----QGHRSVC 121

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LPD + D  +L  P+ TP  K+ +     D+ I  + +    ++       + S +L
Sbjct: 122 GIRLPDGLQDRSRLEEPIFTPAVKAPQGE--HDENI--DYLRLVKLVGPEVAAQLRSLSL 177

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            +++R  ++A + G+IL D+K+EFG      I+LADE+ TPDSSR+W+ E+++     G 
Sbjct: 178 QIYQRAEEIARKRGIILADTKFEFGRRADGTIVLADEVLTPDSSRFWDAESWQP----GK 233

Query: 243 TPIGLDKDFIRNWI-LTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITG 291
                DK ++R+W+              P +P+ ++  TS+ Y  A+ ++TG
Sbjct: 234 GADSFDKQYVRDWLTKESGWDRASDQEPPALPDEVVKATSRRYEEAWARLTG 285


>gi|111021788|ref|YP_704760.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus jostii RHA1]
 gi|123045855|sp|Q0S784|PUR7_RHOSR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110821318|gb|ABG96602.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus jostii RHA1]
          Length = 294

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 88/299 (29%), Positives = 146/299 (48%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F  
Sbjct: 4   SLDSYAHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFGV 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                        +   +      LV ++L M P+E + RGYL G+              
Sbjct: 64  LGGNNHLAGEPDDSRIPEEVLGRALVVRKLDMVPVECVARGYLTGSGLLDYNE-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP +K+       D+ IS   ++ +  + ++    +  
Sbjct: 119 AVCGVALPEGLVEASQLPDPIFTPASKAELGE--HDENISFEAVVEK--VGQDLAVKLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R    A + G+IL D+K EFG+D + N++LADE+ TPDSSRYW  + YE    
Sbjct: 175 DTLDIYGRASNFAADRGIILADTKLEFGLDPQGNLVLADEVLTPDSSRYWPADGYEA--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK F+RNW+    + +        P +P  I+  T + YI AYE+I+GL F
Sbjct: 232 -GKVQPSFDKQFVRNWLTGPESGWDRASDTPPPPLPAEIVEATRERYIEAYERISGLSF 289


>gi|15676655|ref|NP_273799.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis MC58]
 gi|22001875|sp|Q9K063|PUR7_NEIMB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|7225987|gb|AAF41170.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis MC58]
 gi|325140089|gb|EGC62618.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis CU385]
          Length = 287

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E 
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|307331257|ref|ZP_07610380.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces violaceusniger Tu 4113]
 gi|306883069|gb|EFN14132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces violaceusniger Tu 4113]
          Length = 306

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 153/307 (49%), Gaps = 33/307 (10%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG++L Q++ +WF  
Sbjct: 12  EVPGLQHLHTGKVRDLYRNERGELVMVASDRISAYDWVLPTEIPEKGKILTQLSLWWFDL 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           LV + L+M P+E + RG+L G+            
Sbjct: 72  LADLVPNHVLSTELPPGAPADWEGRTLVCRSLRMVPVECVARGHLTGSGLAEYRE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ ++D  +LP P+ TP TK+       D+ ++  E+ HR  +       +
Sbjct: 127 TRTVCGIALPEGLTDGSELPSPIFTPATKAEVGE--HDENVAYEEVAHR--IGAEPAAQL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDK------KQNIILADEIHTPDSSRYWEV 231
               L++F R  ++A   G+IL D+K+EFG  +          +LADE+ TPDSSR+W  
Sbjct: 183 RQATLAIFNRAREIARARGIILADTKFEFGYAEATLGAEGAEPVLADEVLTPDSSRFWPA 242

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYE 287
           + ++    +       DK ++R+W+ +  + +        P +P  ++ RT   Y  AY 
Sbjct: 243 DQWQPGRAQ----PSFDKQYVRDWLTSPASGWDRTAEQPPPPLPAEVVERTRAKYAEAYG 298

Query: 288 KITGLKF 294
            +TG ++
Sbjct: 299 LLTGTRW 305


>gi|307258123|ref|ZP_07539875.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306863486|gb|EFM95417.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
          Length = 285

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVGTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|326331891|ref|ZP_08198178.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Nocardioidaceae bacterium Broad-1]
 gi|325950388|gb|EGD42441.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Nocardioidaceae bacterium Broad-1]
          Length = 302

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 98/304 (32%), Positives = 154/304 (50%), Gaps = 31/304 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDG----TRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYW 63
           IP   + +SGKVR+ Y L +G      + +A+DR+SAFD      IP KGE+L +++ +W
Sbjct: 12  IPGAKHLHSGKVRDLYELEEGPYAGQLLMVASDRISAFDHVFDTVIPDKGEILTKLSLWW 71

Query: 64  FHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           F    D+   H L    P       +V Q+L M P+E + RGYL G+             
Sbjct: 72  FEQFEDLVPTHVLSTDVPAAVEGRAVVAQKLHMLPVECVARGYLTGSGLREY-----EVT 126

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
            ++    LP  + D  +L  P+ TP TK+       D+ ++   I     +  +    + 
Sbjct: 127 GEVCGIRLPAGLVDGSRLTPPIFTPATKAELG--DHDENVTYEYISRL--IGEDDAAAVR 182

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKK----QNIILADEIHTPDSSRYWEVETY 234
              L++++R  ++A   GLIL D+K+EFG+ +     + I+LADE+ TPDSSRYW+   +
Sbjct: 183 RLTLAVYQRADEIARGCGLILADTKFEFGVRQDDLGIRTIVLADEVLTPDSSRYWDASQW 242

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKIT 290
                 G      DKD IR W+L+  + +        P++PE I+ RT   Y+ AYEK+T
Sbjct: 243 HP----GSAIPSFDKDVIRRWLLSPESGWDRAAGGPPPELPEEIVARTRAKYVEAYEKLT 298

Query: 291 GLKF 294
           G +F
Sbjct: 299 GHRF 302


>gi|190151374|ref|YP_001969899.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307264731|ref|ZP_07546310.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|189916505|gb|ACE62757.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306869927|gb|EFN01692.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 285

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E      +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--NHDINISYEEC--EHQIGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|240125274|ref|ZP_04738160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|240127728|ref|ZP_04740389.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 282

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 146/291 (50%), Gaps = 27/291 (9%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICS 72
             YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I  
Sbjct: 3   KIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHIMP 62

Query: 73  NHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           NH                  +   +V ++L    +E IVRGYLAG+              
Sbjct: 63  NHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK-----TG 117

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +  
Sbjct: 118 SVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEEVRD 173

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y     
Sbjct: 174 KAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY----E 229

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 230 VGINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 280


>gi|285017094|ref|YP_003374805.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas albilineans GPE PC73]
 gi|283472312|emb|CBA14818.1| probable phosphoribosylaminoimidazole-succinocarboxamide synthase
           protein [Xanthomonas albilineans]
          Length = 308

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 91/315 (28%), Positives = 146/315 (46%), Gaps = 38/315 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CIP 50
             L ++ +P LP  + GKVR+ + L               + +ATDRLSAFD  +   IP
Sbjct: 3   TTLLQSDLPGLPLRHRGKVRDVFDLPRDRLPANAPTGDYLLMVATDRLSAFDVVLPDPIP 62

Query: 51  YKGEVLNQITQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIEL 96
            KGE+L Q++ +WF  T  +  NH                       +V ++L+  P+E 
Sbjct: 63  GKGEMLCQVSNFWFKKTEHLMPNHLTGIDVAAVLPEGVDTALYAKRAVVTRKLKPVPVEA 122

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           I RGYL G+              K+    LPD +   +KL  P+ TP+TK++      D+
Sbjct: 123 IARGYLIGSGWKDYQR-----TGKVSGIELPDGLRQAEKLAEPIFTPSTKAAVG--DHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMV--KTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDLDGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + Y      G +P   DK F+R+++ T         P +P+++I 
Sbjct: 234 MDEMLTPDSSRYWPADEY----EIGTSPPSYDKQFVRDYLETLDWGKTVPGPRLPQDVIE 289

Query: 277 RTSQTYIAAYEKITG 291
           RT   Y  A +++ G
Sbjct: 290 RTRSKYAEALQRLAG 304


>gi|325203844|gb|ADY99297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M01-240355]
          Length = 287

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   GLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E      + +     
Sbjct: 121 -TGSVCGIRLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECERS--IGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --EVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|158522380|ref|YP_001530250.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfococcus oleovorans Hxd3]
 gi|229564390|sp|A8ZVI6|PUR7_DESOH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|158511206|gb|ABW68173.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfococcus oleovorans Hxd3]
          Length = 293

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 92/306 (30%), Positives = 148/306 (48%), Gaps = 31/306 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +++     P L     GKVR+ Y   D   + +ATDRLSAFD  +   IP KGE+L QI+
Sbjct: 3   QVVYHTDFPGLNLLKRGKVRDVYDFGD-RLLIVATDRLSAFDVVMPDPIPGKGEILTQIS 61

Query: 61  QYWFHHTSDICSNHTLDYPD---------------PNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +                      ++  + +   IE +VRGYL+G+
Sbjct: 62  LFWFDQVKDIVRNHLISSDVNDYPEACRPYAETLAGRSMLVTKTEPLAIECVVRGYLSGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
              S         R +    LPD + ++ +LP P+ TP+TK+       D  IS +E   
Sbjct: 122 GWKSYQK-----DRTVCGISLPDGLRESDRLPEPIFTPSTKAEAGQ--HDINISFDE--A 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             I  R   E     +L+++ RG ++A   G+I+ D+K+EFG      +IL DE+ TPDS
Sbjct: 173 ANIAGRETTEKARDLSLAIYRRGVEVADARGIIIADTKFEFGF-VDGELILIDEVLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y     +       DK ++R+++L+     +   PD+P +++  T + Y  A
Sbjct: 232 SRFWPRDGYAPGGPQ----QSFDKQYVRDYLLSLNWNQKPPAPDLPPDVVANTRKKYSEA 287

Query: 286 YEKITG 291
            + + G
Sbjct: 288 LDLLVG 293


>gi|29830689|ref|NP_825323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces avermitilis MA-4680]
 gi|39931881|sp|Q82FV6|PUR7_STRAW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|29607801|dbj|BAC71858.1| putative phosphoribosylaminoimidazole- succinocarboxamide
           synthetase [Streptomyces avermitilis MA-4680]
          Length = 299

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 92/301 (30%), Positives = 153/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DRLSAFD  +   IP KG VL Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYQNEAGDLVMVASDRLSAFDWVLPTEIPDKGRVLTQLSLWWFDR 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             D+  NH L    P           L+ + L+M P+E + RGYL G+            
Sbjct: 72  LVDLAPNHVLSTELPPGAPADWQGRTLICKSLKMEPVECVARGYLTGSGLVEYNE----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +       +
Sbjct: 127 TRTVCGLALPEGLVDGSELPGPIFTPATKAAVGE--HDENVSYEEVARQ--VGAETAAKL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A   G+IL D+K+EFG D    ++LADE+ TPDSSR+W  + +E  
Sbjct: 183 RQTTLAVYARARDIARRRGIILADTKFEFGFDGD-TLVLADEVLTPDSSRFWPADQWEPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK F+R+W+ +  + +        P +P++++  T   Y+ AYE++TG  
Sbjct: 242 RAQ----PSFDKQFVRDWLTSPESGWDRKSEQPPPPLPQHVVDATRAKYVEAYERLTGAN 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|240013648|ref|ZP_04720561.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI18]
          Length = 282

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 145/291 (49%), Gaps = 27/291 (9%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICS 72
             YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I  
Sbjct: 3   KIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHIMP 62

Query: 73  NHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           NH                  +   +V ++L    +E IVRGYLAG+              
Sbjct: 63  NHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK-----TG 117

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +  
Sbjct: 118 SVCGIRLPEGMREAQQLPEVIFTPSTKAAVG--DHDENISFEECGR--IIGKELAEEVRD 173

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + Y     
Sbjct: 174 KAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQY----E 229

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 230 VGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 280


>gi|115522576|ref|YP_779487.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisA53]
 gi|115516523|gb|ABJ04507.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisA53]
          Length = 305

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 82/316 (25%), Positives = 146/316 (46%), Gaps = 30/316 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P LP    GKVR+ Y + D   + + TDR+SAFD  +   IP+KG VL Q+
Sbjct: 1   MTTMLTSDLP-LPQIGRGKVRDIYAVDDDRLLLVTTDRISAFDVVMAETIPHKGAVLTQL 59

Query: 60  TQYWFHHTSDICSNHTLD------------------YPDPNVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAWWFRQLEGVVLHHMISADIDAIIDDVPELRDHRAMLKGRTMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           L+G+               +    LP  + +++KL   + +P TK+       D+ I+  
Sbjct: 120 LSGSAWKEYAAH-----GTLAGEALPQGLQESEKLEPAIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
           ++  R ++      T+ S + +++  G  +A E G+I+ D+K+EFG D +  IIL DE+ 
Sbjct: 172 QM--REVVGDEDAYTLESMSRAVYTAGEAIAREQGIIIADTKFEFGRDTEGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W  + Y+    +        +D +               P +P +++  TS  
Sbjct: 230 TPDSSRFWATDVYQPGRPQPSFDKQPLRDHLDAERRAGRWNGEAPPPPLPASVVEATSFR 289

Query: 282 YIAAYEKITGLKFIAD 297
           Y  A+ ++TG     D
Sbjct: 290 YRDAFRRLTGHDLRID 305


>gi|220913927|ref|YP_002489236.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter chlorophenolicus A6]
 gi|219860805|gb|ACL41147.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrobacter chlorophenolicus A6]
          Length = 313

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 88/311 (28%), Positives = 149/311 (47%), Gaps = 35/311 (11%)

Query: 6   KAYIPELPNYYSGKVRENYFLSD---------GTRITIATDRLSAFDQNIAC-IPYKGEV 55
              +P   + YSGKVR+ Y  +D            + +A+DR+SA+D  ++  IP KG +
Sbjct: 15  TLDLPGWTHVYSGKVRDLYEPADESVKERVGQDCVLVVASDRISAYDHVLSSEIPDKGRI 74

Query: 56  LNQITQYWFHHTS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           L Q++ +WF               +      +   ++ ++L MFP+E I RGYL G+   
Sbjct: 75  LTQLSLWWFEQLGVEHHVLGSTVEDGVPAEVEGRAMICKKLDMFPVECIARGYLTGSGLL 134

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       +    LPD + D  +L + + TP+ K++      D+ I+ + ++    
Sbjct: 135 EY-----RASGTVCNIPLPDGLVDGSRLEHAIFTPSAKAAVGE--HDENITYDAVVAL-- 185

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILADEIHTPDSSR 227
           +  +    +S   L ++    K+A E G+IL D+K EFG D    +I L DE+ TPDSSR
Sbjct: 186 VGDDIAARLSELTLKIYTTAEKIARERGIILADTKVEFGYDAVSGSITLGDEVLTPDSSR 245

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYI 283
           +W+  TY+    +       DK ++R+W+ +  + +        P +P  ++ RT   Y+
Sbjct: 246 FWDAATYQPGQAQ----PSYDKQYVRDWLTSAESGWDKASDTPPPALPAEVVDRTRSRYV 301

Query: 284 AAYEKITGLKF 294
            AYEKITG  F
Sbjct: 302 EAYEKITGRTF 312


>gi|302331406|gb|ADL21600.1| Phosphoribosylaminoimidazole-succino carboxamide synthase
           [Corynebacterium pseudotuberculosis 1002]
          Length = 297

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 150/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+F H
Sbjct: 4   ELSQYTHVSAGKVREIYEIDDERLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFDH 63

Query: 67  TSD-------ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      LV ++L+M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGSIDDPAIPEEVLGRALVCKKLKMLPFECVARGYLTGSGLKEYQQ-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
           K+    LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   + +
Sbjct: 119 KVCGIELPEGLVEASKLPSPIFTPATKADFG--DHDENVSFDAVVDK--LGEARANELRA 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++     +A   G+IL D+K+EFG+D+  N++LADE  TPDSSRYW  + YE+   
Sbjct: 175 VTLKIYSEAAAIAESRGIILADTKFEFGLDEDGNLVLADEALTPDSSRYWPADGYEEGKA 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +    +  DK ++RNW+    + +        P +P +++  T + Y+ A+E ITG KF
Sbjct: 235 Q----LSFDKQYVRNWLTGPKSGWSTDSLSPPPSLPGSVVEATRERYVEAFESITGKKF 289


>gi|294339376|emb|CAZ87732.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Thiomonas sp. 3As]
          Length = 294

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 89/290 (30%), Positives = 146/290 (50%), Gaps = 28/290 (9%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNHT 75
            GKVRENY +     + +ATDR+SAFD  +   IP KGE+L ++ ++WF    D+  NH 
Sbjct: 18  RGKVRENYAVGADRLLMVATDRISAFDVIMAEPIPGKGEILTRMARFWFGLLHDVAPNHL 77

Query: 76  LDYPDPNV-------------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           LD     V             +V ++L+  P+E +VRGYLAG+              ++ 
Sbjct: 78  LDIDPETVVAADERNQVRGRAMVVKRLKPLPVEAVVRGYLAGSGWKDY-----QATGEVC 132

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP  +    KLP P+ TP TK+       D+ IS  ++     +       +   ++
Sbjct: 133 GVALPKGLKLASKLPAPIFTPATKAELGE--HDENISFAQM--EQAIGAELAAQVRDISI 188

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +L++R    +   G+++ D+K+EFG+D+   + L DE+ TPDSSR+W  +T+ +    G 
Sbjct: 189 TLYQRAADYSAARGILIADTKFEFGLDESGTLTLMDEVLTPDSSRFWPADTWLE----GS 244

Query: 243 TPIGLDKDFIRNWILT-RCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           +P   DK F+R+W+        +   P +P ++I  T   Y  A E++TG
Sbjct: 245 SPPSFDKQFLRDWLEGVPGWNKQPPPPTLPADVIEHTLARYREALERLTG 294


>gi|297563555|ref|YP_003682529.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296848003|gb|ADH70023.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 301

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 92/299 (30%), Positives = 151/299 (50%), Gaps = 27/299 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +  L + ++GKVRE Y  +DG+ + +A+DR+SA+D  +   IP KG +L Q++ +WF   
Sbjct: 13  VEGLTHLHTGKVRELYAAADGSLVMVASDRVSAYDWVLPTEIPGKGRLLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
             +  NH +    P           LV ++L M P+E + RGYL G+             
Sbjct: 73  GGLVPNHVVSDVLPEGAPADWAGRTLVCRRLDMVPVECVARGYLTGSGLEEY-----RAD 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LPD + D  +LP P+ TP TK+       D+ +S   +             + 
Sbjct: 128 GTVCGIALPDGLVDGSELPEPIFTPATKAEVG--DHDENVSFEAVAAAHGAGL--AAELR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L ++ RG +LA E G+IL D+K+E+G D    ++LADE+ TPDSSRYW  +T+    
Sbjct: 184 DLTLRVYGRGRELARERGIILADTKFEYGRDASGELVLADEVFTPDSSRYWPADTWAPGG 243

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLK 293
            +       DK  +R+W+ +  + +        P++PE+++ RT   Y+  YE++TG K
Sbjct: 244 PQ----TSFDKQVLRDWLRSPESGWDRASETPPPELPEHVVQRTLDRYVEIYERLTGTK 298


>gi|114321406|ref|YP_743089.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227800|gb|ABI57599.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 297

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 94/305 (30%), Positives = 150/305 (49%), Gaps = 28/305 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L +A +  L   + GKVR+ Y + D   + + TDRLSAFD  +   IP KG+VL  ++
Sbjct: 6   EALYEANLKSLECLHQGKVRDIYAVDDRRMLIVTTDRLSAFDVILPDPIPGKGQVLTSVS 65

Query: 61  QYWFHHTSDICSNHTLDYPDPNV--------------LVGQQLQMFPIELIVRGYLAGNT 106
            +WF HT  I +NH LD     V              +V ++++  P+E I RGY+ G+ 
Sbjct: 66  NFWFEHTRHIIANHLLDDRPEEVIPDPAEQARVAGRAVVVRRVRPLPVEAIARGYIIGSG 125

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                        ++    LP  +     LP P+ TP+TK++    G D+ +  + ++  
Sbjct: 126 WKDY-----QATGQVCGIPLPPGLRQADALPEPIFTPSTKAAVG--GHDENVRFDAVV-- 176

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +     E I    L L+      A E G+I+ D+K+EFG+D+  N++L DE  TPDSS
Sbjct: 177 KAIGAPLAERIREVTLRLYSEAAAYARERGIIIADTKFEFGVDEDDNLLLIDEALTPDSS 236

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y      G +P   DK F+R+++ T         P +PE I+ RT++ Y  A 
Sbjct: 237 RFWPADQYRP----GSSPPSFDKQFVRDYLETLDWDKTPPGPRLPEEILRRTAEKYREAQ 292

Query: 287 EKITG 291
            ++ G
Sbjct: 293 RRLLG 297


>gi|50843435|ref|YP_056662.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium acnes KPA171202]
 gi|50841037|gb|AAT83704.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium acnes KPA171202]
          Length = 421

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 90/314 (28%), Positives = 158/314 (50%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++ +LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-DLPLLAEGKVRRLYRLPDQPGCLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDLLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQR--- 116

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
              R +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 117 --NRAVCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|170729408|ref|YP_001774841.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa M12]
 gi|229568635|sp|B0U1N3|PUR7_XYLFM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|167964201|gb|ACA11211.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Xylella
           fastidiosa M12]
          Length = 308

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 95/316 (30%), Positives = 150/316 (47%), Gaps = 38/316 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-I 49
           +  L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   I
Sbjct: 2   LTTLLQSDLPGLPLRHCGKVRDVFDIPRKRLPVDTRSGEYLLIVATDRLSAFDVVLPDPI 61

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIE 95
           P KGE+L QI+ +WF  T  +  NH                       +V ++L+   IE
Sbjct: 62  PGKGEILCQISNFWFQKTEHLMPNHLTGINVASVLPDGIDKTLYTQRAVVTKKLKPVGIE 121

Query: 96  LIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCD 155
            I RGYL G+              K+    LPD + + +KLP P+ TP+TK++      D
Sbjct: 122 AIARGYLIGSGWKDYQR-----TGKVSGIQLPDGLQEAEKLPDPIFTPSTKAAVGH--HD 174

Query: 156 QPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNII 215
           + I  +  +    +     E +    L ++    K A E G++L D+K+EFG D    + 
Sbjct: 175 ENIDFDTTVKM--IGAELAERVRDATLRIYHFAAKYAAECGILLADTKFEFGTDIDGRLY 232

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           + DE+ TPDSSRYW ++ Y    + G +P   DK F+RN++ T         P +P++II
Sbjct: 233 VMDEMLTPDSSRYWPIDEY----QVGTSPPSYDKQFVRNYLETLDWDKTAPGPTLPQDII 288

Query: 276 LRTSQTYIAAYEKITG 291
            RT   Y  A +++ G
Sbjct: 289 DRTRAKYTEALQRLAG 304


>gi|165977464|ref|YP_001653057.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|303250452|ref|ZP_07336649.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307251292|ref|ZP_07533212.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307251493|ref|ZP_07533400.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|165877565|gb|ABY70613.1| phosphoribosylaminoimidazole succinocarboxamide(SAICAR) synthase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|302650440|gb|EFL80599.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306856690|gb|EFM88826.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306860957|gb|EFM92963.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 285

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|302342798|ref|YP_003807327.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfarculus baarsii DSM 2075]
 gi|301639411|gb|ADK84733.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfarculus baarsii DSM 2075]
          Length = 298

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 86/307 (28%), Positives = 146/307 (47%), Gaps = 31/307 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           + + +  +  +P    GKVR+ Y L +   + +A+DR+SAFD  +   IP KG+VL QI+
Sbjct: 4   KPVIQTNLEGVPLVGRGKVRDIYDLGE-HLLIVASDRVSAFDVIMPDPIPDKGKVLTQIS 62

Query: 61  QYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF   +D+ +NH +               D      ++ ++ +   IE IVRGY+ G 
Sbjct: 63  LFWFEQMADLTANHLVAWEVADFPKQLHKFADQLAGRSMLVKKARPLAIEAIVRGYITGT 122

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                         ++  Y LP  + ++QKL  P+ TP+TK+       D+ I   +   
Sbjct: 123 GWKDY-----QATGQVCGYKLPQGLQESQKLDEPLFTPSTKADLG--LHDENIDMQQ--A 173

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             I+       ++  AL+++ R    A   G+I+ D+K+EFG      +IL DE+ TPDS
Sbjct: 174 AKIVGDETARQVAQRALAIYGRARDYAAGRGIIIADTKFEFGF-HDGQLILIDEVLTPDS 232

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y     +       DK F+R+++ +     +   P +P  +I  T   Y+ A
Sbjct: 233 SRFWPADDYAPGRGQ----KSFDKQFLRDYLESIGFAKKPPAPKLPAEVIEGTRARYLEA 288

Query: 286 YEKITGL 292
             +ITG 
Sbjct: 289 LTRITGQ 295


>gi|121608519|ref|YP_996326.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verminephrobacter eiseniae EF01-2]
 gi|121553159|gb|ABM57308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verminephrobacter eiseniae EF01-2]
          Length = 325

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 94/307 (30%), Positives = 145/307 (47%), Gaps = 28/307 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
           +L  + +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KG +L Q+  
Sbjct: 26  VLHTSALTSLPLLARGKVRDNYAVGQDRILMVASDRLSAFDVIMGEPIPGKGALLTQMAL 85

Query: 62  YWFHHTSDICSNHTLDYPD-------------PNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF     +C NH                      ++ Q+L   PIE +VRGYLAG+   
Sbjct: 86  FWFDQLGHLCPNHLTGADPESVVSAREAPQIRGRSMLVQRLAPIPIEAVVRGYLAGSGWK 145

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                     + I    LP  + +  +LP P+ TP TK+       D+ IS    +    
Sbjct: 146 EY-----QATQSICGLPLPAGLGNAARLPEPIYTPATKAMAGE--HDENISFARTVAL-- 196

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  +    I   ++++++    +AL  GLI+ DSK+EFG+     ++L DE+ TPDSSRY
Sbjct: 197 IGPDLATRIRDLSIAIYQTAAAIALAKGLIIADSKFEFGLAPDGRLVLMDEVLTPDSSRY 256

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYI 283
           W V  Y  +   G  P   DK F+R+W+       R        P +P+ +I  T+  Y 
Sbjct: 257 WPVAGYAAALAAGRNPPSYDKQFVRDWLEQAQVGGRPWDKTPPAPRLPQAVIESTAAKYR 316

Query: 284 AAYEKIT 290
            A E++T
Sbjct: 317 EALERLT 323


>gi|269218089|ref|ZP_06161943.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269213024|gb|EEZ79364.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 327

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 158/314 (50%), Gaps = 33/314 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFL-------SDGTRITIATDRLSAFDQNIAC-IPYK 52
           M  +    +P   + YSGKVR+ Y          +   + +A+DR+SA+D  +   IP K
Sbjct: 26  MIGIGARNLPGWTHVYSGKVRDVYVPSGVDAHNGEDAYLIVASDRISAYDYVLPTEIPDK 85

Query: 53  GEVLNQITQYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTK 107
           G +L Q++ +WF   SD+  NH +    P       ++ ++L++FP+E +VRGYL G+  
Sbjct: 86  GRILTQLSLWWFEQLSDLTPNHVISTNVPAAVEGRAMITRRLKIFPVECVVRGYLTGSGM 145

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        +    LP  + + + L  P+ TPTTK+       DQ I+  +   R 
Sbjct: 146 AEYKRR-----GTVCGVALPPGIREAECLDRPIFTPTTKARLG--DHDQSITFADTAAR- 197

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK---QNIILADEIHTPD 224
            +       + + +++ + R  ++A E G+I+ D+K+EFG+      + IIL DE+ TPD
Sbjct: 198 -VGEGVARELRAKSIATYARAREIAAERGIIIADTKFEFGVSPDAGSEEIILGDEVLTPD 256

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQ 280
           SSR+W    YE    +      LDK F+R+W+ +  + +      + P +P+ ++ +T +
Sbjct: 257 SSRFWIANVYEPGRSQ----HSLDKQFVRDWLSSEESGWDVSSGTHPPALPDEVVDKTHE 312

Query: 281 TYIAAYEKITGLKF 294
            Y+  YE +TG ++
Sbjct: 313 RYVQIYEHLTGSRW 326


>gi|257790035|ref|YP_003180641.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Eggerthella lenta DSM 2243]
 gi|317489478|ref|ZP_07947988.1| saicar synthetase [Eggerthella sp. 1_3_56FAA]
 gi|257473932|gb|ACV54252.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Eggerthella lenta DSM 2243]
 gi|316911407|gb|EFV33006.1| saicar synthetase [Eggerthella sp. 1_3_56FAA]
          Length = 292

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 154/297 (51%), Gaps = 32/297 (10%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
             GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH
Sbjct: 10  AQGKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENH 68

Query: 75  TL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               DY     ++ ++  MFP E IVRGYLAG+            + 
Sbjct: 69  LISSDVADLPEQFQPYADYLRGRFMLVKKADMFPAECIVRGYLAGSGLKEYQK-----QG 123

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +  
Sbjct: 124 TVCGIQLPEGLVNSSKLPEPIFTPSTKAEIG--DHDENISYERLVE--IIGEDDASQLRD 179

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            AL ++      A E G+I+ D+K+EFG      IILADE+ TPDSSR+W  + Y +   
Sbjct: 180 LALKVYTTARDHAAERGVIIADTKFEFGRL-NGQIILADEVLTPDSSRFWPGDEYAEGKD 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           +       DK F+R+W+       + N+P +P++II RTS+ YI AYEKITG  F+ 
Sbjct: 239 Q----PSFDKQFVRDWLNAN-WDRQGNLPRLPQDIIDRTSEKYIQAYEKITGRTFVP 290


>gi|303251792|ref|ZP_07337963.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307246956|ref|ZP_07529021.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249093|ref|ZP_07531100.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|302649222|gb|EFL79407.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306852241|gb|EFM84481.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306854381|gb|EFM86577.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 285

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--NHDINISYEECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|253700331|ref|YP_003021520.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. M21]
 gi|259546876|sp|C6E6C1|PUR7_GEOSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|251775181|gb|ACT17762.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           sp. M21]
          Length = 296

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 90/309 (29%), Positives = 146/309 (47%), Gaps = 32/309 (10%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   +     P L     GKVR+ Y L + T + + TDR+SAFD  +   IP+KG VL Q
Sbjct: 1   MTTPVLNTDFPGLKLAARGKVRDIYDLGE-TLLIVTTDRISAFDVIMNEGIPHKGYVLTQ 59

Query: 59  ITQYWFHHTSDICSNHTLDYPD---------------PNVLVGQQLQMFPIELIVRGYLA 103
           I+ YWF     I  NH +                      +  ++ Q    E IVRGY++
Sbjct: 60  ISAYWFRQMEGIIKNHIISTDVADFPKECQPYADVLAGRSMWVKKAQPLAAECIVRGYIS 119

Query: 104 GNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
           G+               I    LP+ + ++ +LP P+ TP+TK+       D+ IS  E+
Sbjct: 120 GSGWKDYQ-----STGAICGIKLPEGLKESDRLPQPIFTPSTKAELG--THDENISFEEM 172

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTP 223
               I        +    L+++E+   +A + G+I+ D+K+E+GI +   +I+ DE  TP
Sbjct: 173 CR--ICGTEISTKVRDVTLAIYEKARDIADQKGIIIADTKFEYGIYEG-ELIIIDECMTP 229

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W  ++Y+    +       DK F+R+++ T         P +PE I+ +T + Y+
Sbjct: 230 DSSRFWPKDSYKPGGPQ----PSFDKQFLRDYLETLDWGKTAPAPPLPEEIVRKTGEKYM 285

Query: 284 AAYEKITGL 292
            A  K+TG 
Sbjct: 286 EALVKLTGK 294


>gi|282854766|ref|ZP_06264100.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J139]
 gi|282581912|gb|EFB87295.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J139]
 gi|314924537|gb|EFS88368.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL001PA1]
 gi|314967343|gb|EFT11442.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL082PA2]
 gi|314981779|gb|EFT25872.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA3]
 gi|315092539|gb|EFT64515.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA4]
 gi|315094859|gb|EFT66835.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL060PA1]
 gi|315102944|gb|EFT74920.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA2]
 gi|327328542|gb|EGE70302.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL103PA1]
          Length = 421

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 88/314 (28%), Positives = 156/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++ + P    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-DFPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET+ 
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETWR 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLANESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
           +   + S+  P   
Sbjct: 287 QVSDEVSDETPHNE 300


>gi|327455758|gb|EGF02413.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL087PA3]
 gi|328757074|gb|EGF70690.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL087PA1]
          Length = 420

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 156/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|313763793|gb|EFS35157.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL013PA1]
 gi|313817044|gb|EFS54758.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL059PA1]
 gi|313829850|gb|EFS67564.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL063PA2]
 gi|314916614|gb|EFS80445.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL005PA4]
 gi|314919454|gb|EFS83285.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA1]
 gi|314920936|gb|EFS84767.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA3]
 gi|314932342|gb|EFS96173.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL067PA1]
 gi|314956793|gb|EFT00987.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL027PA1]
 gi|314959645|gb|EFT03747.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL002PA1]
 gi|315100114|gb|EFT72090.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL059PA2]
 gi|315102436|gb|EFT74412.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL046PA1]
 gi|315109648|gb|EFT81624.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL030PA2]
 gi|327335350|gb|EGE77059.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL097PA1]
 gi|327457905|gb|EGF04560.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL083PA2]
 gi|328757772|gb|EGF71388.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL025PA2]
          Length = 420

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 156/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|295106284|emb|CBL03827.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gordonibacter pamelaeae 7-10-1-b]
          Length = 287

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 101/295 (34%), Positives = 153/295 (51%), Gaps = 32/295 (10%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
             GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH
Sbjct: 7   AQGKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENH 65

Query: 75  TL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               DY     ++ ++  MFP E IVRGYLAG+            + 
Sbjct: 66  LISADVADLPEQFRPYADYLRGRFMLVKKADMFPAECIVRGYLAGSGLKEYQK-----QG 120

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +  
Sbjct: 121 TVCGIELPEGLVNSSKLPEPIFTPSTKAEIG--DHDENISFERLVE--IIGEDDASQLRD 176

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            AL ++      A E G+I+ D+K+EFG      IILADE+ TPDSSR+W  + Y +   
Sbjct: 177 LALKVYTTARDHAAERGVIIADTKFEFGRL-NGQIILADEVLTPDSSRFWPGDEYAEGKD 235

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK F+R+W+       + N P +P++II +TS+ YI AYE+ITG KF
Sbjct: 236 Q----PSFDKQFVRDWLTAN-WDRQGNPPRLPQDIIDKTSEKYIQAYERITGRKF 285


>gi|226364312|ref|YP_002782094.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus opacus B4]
 gi|254783971|sp|C1AT85|PUR7_RHOOB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226242801|dbj|BAH53149.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus opacus B4]
          Length = 294

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 144/299 (48%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F  
Sbjct: 4   SLDSYAHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFGV 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                        +   +      LV ++L M P+E + RGYL G+              
Sbjct: 64  LGGNNHLAGEPDDSRIPEEVLGRALVVRKLNMVPVECVARGYLTGSGLIDYNE-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP  K+       D+ IS   ++ +  + ++    +  
Sbjct: 119 AVCGVALPEGLVEASQLPDPIFTPARKAELGE--HDENISFEAVVEK--VGQDLAVKLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R    A + G+IL D+K EFG+D + N+ILADE+ TPDSSRYW  + YE    
Sbjct: 175 DTLDVYGRASNFAADRGIILADTKLEFGLDAQNNLILADEVLTPDSSRYWPADGYEA--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK F+RNW+    + +        P +P  I+  T   YI AYE+I+GL F
Sbjct: 232 -GKVQPSFDKQFVRNWLTGPESGWDRASDTPPPPLPAEIVEATRARYIEAYERISGLSF 289


>gi|295395679|ref|ZP_06805871.1| phosphoribosylamine-glycine ligase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971495|gb|EFG47378.1| phosphoribosylamine-glycine ligase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 751

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 98/304 (32%), Positives = 156/304 (51%), Gaps = 30/304 (9%)

Query: 8   YIPELPNYYSGKVRENYFL-------SDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
            +P   + YSGKVR+ Y              + +A+DR+SA+D  I   IP KG+VL  +
Sbjct: 459 QVPGWTHVYSGKVRDLYIPVEATNMDDADRLLMVASDRISAYDHVIPTPIPDKGKVLTGL 518

Query: 60  TQYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           T +WF   +D+  NH L    P       ++ + L+MFP+E + RG+L G+         
Sbjct: 519 TAWWFDQVTDLVGNHVLTVDVPAEVAGRGMIVKPLRMFPVECVARGHLTGSGLKDYQR-- 576

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
                 +    LP+ + +  KL   + TP TK+       D+ I+ ++ +   +L  +  
Sbjct: 577 ---TGAVCGNELPEGLGEASKLEPAIFTPATKAELG--DHDENITFDQTV--KLLGDSDA 629

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           E + S  L+LFER   +A E G+IL D+K+EFG+D    I+L DE+ TPDSSR+W+    
Sbjct: 630 EALKSLTLALFERARSIAAERGIILADTKFEFGLDFTDQIVLGDEVLTPDSSRFWD---- 685

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKIT 290
            + F EG +    DK F+R+W+ +  + +        P +P  ++  T   YI A+EK+T
Sbjct: 686 AEGFVEGQSQPSFDKQFVRDWLTSEESGWDKDSGMAPPQLPTQVVEATRARYIEAFEKLT 745

Query: 291 GLKF 294
           G KF
Sbjct: 746 GRKF 749


>gi|255545878|ref|XP_002513999.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis]
 gi|223547085|gb|EEF48582.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis]
          Length = 324

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 123/285 (43%), Positives = 179/285 (62%), Gaps = 10/285 (3%)

Query: 2   RILSKAYI----PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLN 57
             LS+  +    P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN
Sbjct: 33  NCLSETNLHLTVPGLKSKTRGKVRDIYDGGD-YLVLVTTDRQSAFDRILASIPFKGQVLN 91

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           + + +WF  T  +  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T YK G
Sbjct: 92  ETSLWWFDQTQHLTQNAVVSAPDKNVTIAKKCSVFPVEFVVRGYVTGSTDTSLWTVYKKG 151

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R      LPD +  NQKL   ++TPTTK+    +  D P++P+EII RG++TR  ++  
Sbjct: 152 VRNYCGNALPDGLVKNQKLATNILTPTTKA----ADHDVPVTPSEIIERGLMTRADYDEA 207

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
           S  AL LFE G ++ALE+GL+LVD+KYEFG     +++L DE+HTPDSSRYW   +YE+ 
Sbjct: 208 SRKALKLFEYGQRVALEHGLVLVDTKYEFGKGADGSVLLIDEVHTPDSSRYWIGHSYEER 267

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQT 281
           F++G+ P  +DK+F+R W    CNPY D + PD PE ++   +  
Sbjct: 268 FQKGLEPENIDKEFLRLWFKDHCNPYEDEVLPDAPEELVCELAWR 312


>gi|71276387|ref|ZP_00652664.1| SAICAR synthetase [Xylella fastidiosa Dixon]
 gi|71898630|ref|ZP_00680800.1| SAICAR synthetase [Xylella fastidiosa Ann-1]
 gi|71162849|gb|EAO12574.1| SAICAR synthetase [Xylella fastidiosa Dixon]
 gi|71731577|gb|EAO33638.1| SAICAR synthetase [Xylella fastidiosa Ann-1]
          Length = 308

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 95/316 (30%), Positives = 150/316 (47%), Gaps = 38/316 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIAC-I 49
           +  L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   I
Sbjct: 2   LTTLLQSDLPGLPLRHYGKVRDVFDIPRKRLPVDTRSGEYLLIVATDRLSAFDVVLPDPI 61

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIE 95
           P KGE+L QI+ +WF  T  +  NH                       +V ++L+   IE
Sbjct: 62  PGKGEILCQISNFWFQKTEHLMPNHLTGINVASVLPDGIDKTLYTQRAVVTKKLKPVGIE 121

Query: 96  LIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCD 155
            I RGYL G+              K+    LPD + + +KLP P+ TP+TK++      D
Sbjct: 122 AIARGYLIGSGWKDYQR-----TGKVSGIQLPDGLQEAEKLPDPIFTPSTKAAVGH--HD 174

Query: 156 QPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNII 215
           + I  +  +    +     E +    L ++    K A E G++L D+K+EFG D    + 
Sbjct: 175 ENIDFDTTVKM--VGAELAERVRDATLRIYHFAAKYAAECGILLADTKFEFGTDIDGRLY 232

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           + DE+ TPDSSRYW ++ Y    + G +P   DK F+RN++ T         P +P++II
Sbjct: 233 VMDEMLTPDSSRYWPIDEY----QVGTSPPSYDKQFVRNYLETLDWDKTAPGPTLPQDII 288

Query: 276 LRTSQTYIAAYEKITG 291
            RT   Y  A +++ G
Sbjct: 289 DRTRAKYTEALQRLAG 304


>gi|260578363|ref|ZP_05846277.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium jeikeium ATCC 43734]
 gi|258603385|gb|EEW16648.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium jeikeium ATCC 43734]
          Length = 297

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 87/299 (29%), Positives = 147/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + E  ++ +GKVRE Y + +   + + +DR+SA+D  +   IP KG VL  ++ ++F  
Sbjct: 4   ELCEYEHHSAGKVREIYEVDEDNLLMVVSDRISAYDYVLETEIPDKGRVLTAVSAFFFDE 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +Y     ++ ++L M P E + RGYL G+              
Sbjct: 64  IDFPNHLAGALDDERIPEYVLGRAMLCKKLDMIPFECVARGYLTGSGLKEYQE-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP TK+       D+ +S + ++    L   +   +  
Sbjct: 119 SVCGVELPEGLVEASRLPEPIFTPATKAELG--DHDENVSFDVVVE--ALGEERANELRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             LS++++   +A E GLIL D+K+EFG+D    ++LADE+ TPDSSRYW  E YE+   
Sbjct: 175 ATLSIYKKAAAIAEERGLILADTKFEFGLDADGTLVLADEVLTPDSSRYWPAEGYEE--- 231

Query: 240 EGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+          +    P +P +++  T   YI AYEK++G +F
Sbjct: 232 -GKVQPSFDKQYVRNWLTGPKSGWDKSEGTPPPPLPGSVVEATRSRYIEAYEKLSGKRF 289


>gi|239942525|ref|ZP_04694462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 15998]
 gi|239988989|ref|ZP_04709653.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 11379]
 gi|291445986|ref|ZP_06585376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 15998]
 gi|291348933|gb|EFE75837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 15998]
          Length = 304

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 89/305 (29%), Positives = 152/305 (49%), Gaps = 31/305 (10%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL +++ +WF  
Sbjct: 12  QVPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTRLSLWWFDQ 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH +    P           L+   L+M  +E + RGYL G+          + 
Sbjct: 72  LADLVPNHVISTELPPGAPADWAGRTLICTSLRMVEVECVARGYLTGSGLVEY-----DA 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + +  +LP P+ TP TK++      D+ +S  +I  +  +       +
Sbjct: 127 TRTVCGIGLPEGLVNGSELPGPIFTPATKAAVGE--HDENVSYEDIARQ--VGVETAAEL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVET 233
               L ++ R   +A E G+IL D+K+EFG     D  + +I+ADE+ TPDSSR+W   T
Sbjct: 183 RRTTLDVYRRARDIAHERGIILADTKFEFGFETTEDGTERLIIADEVLTPDSSRFWPAAT 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKI 289
           +E    +       DK F+R+W+ +  + +        P +P+ I+  T   YI A+E +
Sbjct: 243 WEPGRAQ----PSYDKQFVRDWLTSPASGWDRKSEQPPPALPQEIVDATRAKYIEAFEVL 298

Query: 290 TGLKF 294
           TG  +
Sbjct: 299 TGTSW 303


>gi|319778524|ref|YP_004129437.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Taylorella equigenitalis MCE9]
 gi|317108548|gb|ADU91294.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Taylorella equigenitalis MCE9]
          Length = 296

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 88/304 (28%), Positives = 147/304 (48%), Gaps = 27/304 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
            + ++ I  LP    GKVR+ Y + D   + IATDR+SAFD  +   IP KG VL  +T+
Sbjct: 2   AMYESSIKSLPLVSRGKVRDMYQVDDDKLLIIATDRISAFDVVLDDPIPNKGMVLTSLTE 61

Query: 62  YWFHHTSDICSNHT-------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKT 108
           +W      I  NH              +D      +V ++L+   +E +VRGY+ G+   
Sbjct: 62  FWLEKLGGIMPNHATGILPEEVVAKDEIDQVAGRGMVVKKLKPILVEAVVRGYIIGSGWK 121

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                       I    LP  +    +L  P+ TP  K+       D+ I  + +    +
Sbjct: 122 DYQE-----NGAICGIHLPKGLELASELNEPIFTPAEKAEPGK--HDENIGFDYMA--KL 172

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  N  E I   ++ L++   ++A   GLI+ D+K+EFG+D +  + L DE+ TPDSSR+
Sbjct: 173 IGENLAEDIREASIDLYKAASQIAKLKGLIIADTKFEFGLDDQGTLHLMDEVLTPDSSRF 232

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  + Y++    G  P   DK F+R+W+ ++    +   P +PE++I +T+  Y    ++
Sbjct: 233 WPADQYKE----GTNPPSFDKQFVRDWLESQDWDKKAPAPRLPEDVIQKTAAKYKEVLDR 288

Query: 289 ITGL 292
            TG 
Sbjct: 289 FTGK 292


>gi|289427984|ref|ZP_06429688.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J165]
 gi|289158867|gb|EFD07067.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J165]
          Length = 420

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 155/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKLEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|289425752|ref|ZP_06427507.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes SK187]
 gi|295131516|ref|YP_003582179.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes SK137]
 gi|289153858|gb|EFD02564.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes SK187]
 gi|291375784|gb|ADD99638.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes SK137]
 gi|313771656|gb|EFS37622.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL074PA1]
 gi|313808341|gb|EFS46812.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL087PA2]
 gi|313810479|gb|EFS48193.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL083PA1]
 gi|313813886|gb|EFS51600.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL025PA1]
 gi|313818042|gb|EFS55756.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL046PA2]
 gi|313820900|gb|EFS58614.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL036PA1]
 gi|313824030|gb|EFS61744.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL036PA2]
 gi|313827036|gb|EFS64750.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL063PA1]
 gi|313831519|gb|EFS69233.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL007PA1]
 gi|313832506|gb|EFS70220.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL056PA1]
 gi|314926927|gb|EFS90758.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL036PA3]
 gi|314961940|gb|EFT06041.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL002PA2]
 gi|314974871|gb|EFT18966.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL053PA1]
 gi|314978036|gb|EFT22130.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL045PA1]
 gi|314979658|gb|EFT23752.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL072PA2]
 gi|314984552|gb|EFT28644.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL005PA1]
 gi|314988212|gb|EFT32303.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL005PA2]
 gi|314990299|gb|EFT34390.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL005PA3]
 gi|315082235|gb|EFT54211.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL078PA1]
 gi|315083795|gb|EFT55771.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL027PA2]
 gi|315087434|gb|EFT59410.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL002PA3]
 gi|315089851|gb|EFT61827.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL072PA1]
 gi|315095460|gb|EFT67436.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL038PA1]
 gi|327326729|gb|EGE68514.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL096PA3]
 gi|327332752|gb|EGE74484.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL096PA2]
 gi|327448438|gb|EGE95092.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL043PA2]
 gi|327448447|gb|EGE95101.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL043PA1]
 gi|328757269|gb|EGF70885.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL020PA1]
 gi|328762147|gb|EGF75651.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL099PA1]
 gi|332676385|gb|AEE73201.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium acnes 266]
          Length = 420

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 155/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKLEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|78484607|ref|YP_390532.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thiomicrospira crunogena XCL-2]
 gi|78362893|gb|ABB40858.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thiomicrospira crunogena XCL-2]
          Length = 295

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 91/304 (29%), Positives = 150/304 (49%), Gaps = 28/304 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M+ L ++ +  LP    GKVR+ Y + +   + + TDR+SAFD  +   IP KG +L + 
Sbjct: 1   MQPLFESNLTSLPLINKGKVRDLYDIDENHLLIVTTDRISAFDVVLPTPIPGKGRILTET 60

Query: 60  TQYWFHHTSDICSNHTLD--------------YPDPNVLVGQQLQMFPIELIVRGYLAGN 105
            Q+W    S I  N   D                D   ++ ++L   P+E IVRGYL G+
Sbjct: 61  AQFWMKKASHILPNQLADDMQLSDVLTPDELLQLDGRGMIVRKLTPLPVEAIVRGYLVGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                        + +    LP  +   Q+LP P+ TP+TK+       D+ IS  E++ 
Sbjct: 121 GWKEYKK-----TQTVCGIELPKGLKKAQQLPEPLFTPSTKAEIG--DHDENISFEEVV- 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             ++   + + +  Y+L+L++   + A E G+I+ D+K+EFG D+   I L DE  TPDS
Sbjct: 173 -KLIGEKKAQKVKEYSLALYKMAAEFAAERGIIIADTKFEFGEDEHGVIHLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  +TY    + G  P   DK +IR+++ +         P++PE ++  T Q Y  A
Sbjct: 232 SRFWPAKTY----QVGKNPDSFDKQYIRDYLESLDWDKTAPGPELPEEVVDMTFQKYQEA 287

Query: 286 YEKI 289
             ++
Sbjct: 288 QARL 291


>gi|30913218|sp|Q9RHX2|PUR7_CORAM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|6705960|dbj|BAA89448.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amino imidazole synth
           etase [Corynebacterium ammoniagenes]
          Length = 295

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 90/300 (30%), Positives = 152/300 (50%), Gaps = 25/300 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
            + +  +  SGKVR+ Y + D T + + TDR+SA+D  +   IP KG VL   T ++F  
Sbjct: 4   QLSDYQHVSSGKVRDIYEVDDNTLLMVVTDRISAYDFALEPAIPDKGRVLTATTMFFFDA 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      ++ ++L M P E + RGYL G+          N   
Sbjct: 64  IDFPNHLAGPIDDARIPEEVLGRAIIVKKLNMLPFECVARGYLTGSGLKEY-----NANG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + +  +LP P+ TP TK+ +     D+ +S   ++    L + + E +  
Sbjct: 119 TVCGIELPEGLVEASRLPEPIFTPATKAEQG--DHDENVSFERVV--QDLGQERAEQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++    K+A E G+IL D+K+EFG+D + N++L DE+ TPDSSRYW  +TY +   
Sbjct: 175 ETLRIYSAAAKIAEEKGIILADTKFEFGLDSEGNLVLGDEVLTPDSSRYWPADTYAEGIV 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           +       DK ++RNW+ +  + +        P +P++I+  T   YI AYE+++G +FI
Sbjct: 235 Q----PSFDKQYVRNWLTSEESGWDVESETQPPVLPDDIVAATRLRYIEAYERLSGKRFI 290


>gi|226304522|ref|YP_002764480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus erythropolis PR4]
 gi|259546912|sp|C0ZRJ1|PUR7_RHOE4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226183637|dbj|BAH31741.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus erythropolis PR4]
          Length = 297

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 89/298 (29%), Positives = 151/298 (50%), Gaps = 25/298 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F+  
Sbjct: 5   LDSYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFNVL 64

Query: 68  SDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
                       +   +      LV + L M P+E +VRG+L G+          N    
Sbjct: 65  GGTNHLAGEPDDDRIPEEVLGRALVVRSLDMVPVECVVRGFLTGSGLVDY-----NNTGA 119

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP+ + +  +LP P+ TP +K++      D+ IS ++++ +  + +     +   
Sbjct: 120 VCGVALPEGLVEASRLPDPIFTPASKAALG--DHDENISFDQVVEK--VGQKLAVQLRED 175

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
            L ++ R    A + G+IL D+K EFG+D   N++LADE+ TPDSSRYW +E YE     
Sbjct: 176 TLDVYARASNFAADRGIILADTKLEFGLDSGGNLVLADEVLTPDSSRYWPLEGYEA---- 231

Query: 241 GITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           G      DK F+R+W+ +  + +        P +P+ I+  T   YI AYE+I+GL F
Sbjct: 232 GKVQPSFDKQFVRDWLTSPESGWDRSSDTTPPPLPQEIVDATRARYIEAYERISGLSF 289


>gi|90421869|ref|YP_530239.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB18]
 gi|90103883|gb|ABD85920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB18]
          Length = 305

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 81/316 (25%), Positives = 143/316 (45%), Gaps = 30/316 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  +  + +P LP    GKVR+ Y   D   + + TDR+SAFD  +   IP+KG VL Q+
Sbjct: 1   MSTMLSSDLP-LPKIGRGKVRDIYDAGDDRLLLVTTDRISAFDVVMTETIPFKGAVLTQL 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + +WF     +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAWWFGQLGGVVPHHMISADIDAIIEALPQLGAQRAALAGRTMLCRRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           L G+               +    LP  + ++ KL   + +P TK+       D+ I+  
Sbjct: 120 LTGSAWKEY-----AASGTLAGEQLPAGLLESAKLEPWIFSPATKAETG---HDENITVA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +     +      T+ S + +++ +G  +A E G+I+ D+K+EFG D +  IIL DE+ 
Sbjct: 172 RMAEL--IGEEASYTLESMSRAVYTQGEAIAREQGIIIADTKFEFGRDAEGRIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W    Y+    +        +D++               P +P++++  TS  
Sbjct: 230 TPDSSRFWAAADYQPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPALPDSVLQATSLR 289

Query: 282 YIAAYEKITGLKFIAD 297
           Y  A+ ++TG +   D
Sbjct: 290 YRDAFRRLTGAELAID 305


>gi|121634553|ref|YP_974798.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis FAM18]
 gi|120866259|emb|CAM10000.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria meningitidis FAM18]
          Length = 349

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 142/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 67  GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVH 126

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 127 IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 182

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 183 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 237

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 238 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 295

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P N+I +T + Y  A   +T
Sbjct: 296 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPANVIQKTVEKYQEALTLLT 347


>gi|28198097|ref|NP_778411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa Temecula1]
 gi|182680725|ref|YP_001828885.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa M23]
 gi|32129881|sp|Q87EX9|PUR7_XYLFT RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568634|sp|B2I6R9|PUR7_XYLF2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|28056157|gb|AAO28060.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa Temecula1]
 gi|182630835|gb|ACB91611.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa M23]
 gi|307579190|gb|ADN63159.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 308

 Score =  245 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 94/316 (29%), Positives = 148/316 (46%), Gaps = 38/316 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CI 49
           +  L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   I
Sbjct: 2   LTTLLQSDLPGLPLRHCGKVRDVFDIPRKRLPVDTRSGEYLLIVATDRLSAFDVVLPDPI 61

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIE 95
           P KGE+L QI+ +WF  T  +  NH                       +V ++L+   IE
Sbjct: 62  PGKGEILCQISNFWFQKTEHLMPNHLTGINVASVLPDGIDKTLYIQRAVVTKKLKPVGIE 121

Query: 96  LIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCD 155
            I RGYL G+              K+    LPD + + +KLP P+ TP+TK++      D
Sbjct: 122 AIARGYLIGSGWKDYQR-----TGKVSGIQLPDGLQEAEKLPDPIFTPSTKAAVGH--HD 174

Query: 156 QPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNII 215
           + I  +  +    +     E +    L ++    K A E G++L D+K EFG D    + 
Sbjct: 175 ENIDFDTTVKM--VGAELAERVRDATLRIYHFAAKYAAECGILLADTKLEFGTDIDGRLY 232

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           + DE+ TPDSSRYW ++ Y    + G +P   DK  +RN++ T         P +P++II
Sbjct: 233 VMDEMLTPDSSRYWPIDEY----QVGTSPPSYDKQLVRNYLETLDWDKTAPGPTLPQDII 288

Query: 276 LRTSQTYIAAYEKITG 291
            RT   Y  A +++ G
Sbjct: 289 DRTRAKYTEALQRLAG 304


>gi|316983742|gb|EFV62723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis H44/76]
          Length = 321

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 142/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 39  GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVH 98

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 99  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 154

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 155 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 209

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 210 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 267

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 268 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 319


>gi|311897241|dbj|BAJ29649.1| putative phosphoribosylaminoimidazole- succinocarboxamide
           synthetase [Kitasatospora setae KM-6054]
          Length = 299

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 28/301 (9%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHH 66
            +P L + ++GKVR+ Y    G  + +A+DR SA+D  +   IP KG +L Q++ +WF  
Sbjct: 12  QVPGLVHLHTGKVRDLYRDGAGNLVMVASDRTSAYDWVLPNEIPDKGRILTQLSLWWFER 71

Query: 67  TSDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +D+  NH L    P           L+ + L M P+E + RGYLAG+            
Sbjct: 72  IADLVPNHVLSTELPAGAPADWAGRTLICRSLDMVPVECVARGYLAGSGLEEYRV----- 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LP+ + +  +LP P+ TP  K+       D+ +   E   R  +      T+
Sbjct: 127 SRTVCGVALPEGLDNGSELPGPIYTPALKAEVGE--HDENVPYEETARR--VGAELAATL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + GLIL D+K+EFG+     +++ DE+ TPDSSR+W  + ++  
Sbjct: 183 RQTTLAVYARARDIARDRGLILADTKFEFGLL-DGELVIGDEVLTPDSSRFWPADEWQPG 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLK 293
             +       DK  IR+W+ +  + +     +  P +P+ +I  T Q YI AYEK+TGL 
Sbjct: 242 RDQ----PSFDKQIIRDWLTSPASGWDRKSENPPPRLPDEVIAHTRQRYIDAYEKLTGLA 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|227489432|ref|ZP_03919748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227090610|gb|EEI25922.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 297

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 94/299 (31%), Positives = 152/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    ++ +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y+F H
Sbjct: 4   ELSAYEHFSAGKVREIYEVDDETLLLVTSDRISAYDYILDSEIPDKGRVLTAMSNYFFEH 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V  +L M P E + RGYL G+            K 
Sbjct: 64  LDFPNHLAGPIDDQRIPEEVLGRAMVCHKLNMLPFECVARGYLTGSALVEYQE-----KG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LPD + +  +LP P+ TP TK+       D+ +S   ++ +  L       +  
Sbjct: 119 SVCGIELPDGLKEASRLPEPIFTPATKADYGE--HDENVSFEAVVEK--LGEKLATQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L L+ +G ++A+  G+I+ D+K+EFG+D+   + LADE+ TPDSSRYW+ +TY +   
Sbjct: 175 ATLDLYTQGAEIAIAKGVIVADTKFEFGLDENGTLTLADEVLTPDSSRYWDADTYVE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +     DN P +P +++  T + YI AYE+ITG KF
Sbjct: 232 -GKVQPSFDKQYLRNWLTGPDSGWDRASGDNPPSLPGSVVEATRERYIEAYERITGTKF 289


>gi|227541026|ref|ZP_03971075.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227183286|gb|EEI64258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 297

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 94/299 (31%), Positives = 152/299 (50%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            +    ++ +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y+F H
Sbjct: 4   ELSAYEHFSAGKVREIYEVDDETLLLVTSDRISAYDYILDSEIPDKGRVLTAMSNYFFEH 63

Query: 67  TS-------DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                     I      +      +V  +L M P E + RGYL G+            K 
Sbjct: 64  LDFPNHLAGPIDDERIPEEVLGRAMVCHKLNMLPFECVARGYLTGSALVEYQE-----KG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LPD + +  +LP P+ TP TK+       D+ +S   ++ +  L       +  
Sbjct: 119 SVCGIELPDGLKEASRLPEPIFTPATKADYGE--HDENVSFEAVVEK--LGEKLATQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L L+ +G ++A+  G+I+ D+K+EFG+D+   + LADE+ TPDSSRYW+ +TY +   
Sbjct: 175 ATLDLYTQGAEIAIAKGVIVADTKFEFGLDENGTLTLADEVLTPDSSRYWDADTYVE--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +     DN P +P +++  T + YI AYE+ITG KF
Sbjct: 232 -GKVQPSFDKQYLRNWLTGPDSGWDRASGDNPPSLPGSVVEATRERYIEAYERITGTKF 289


>gi|197118888|ref|YP_002139315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           bemidjiensis Bem]
 gi|229564396|sp|B5EGN6|PUR7_GEOBB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|197088248|gb|ACH39519.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Geobacter
           bemidjiensis Bem]
          Length = 296

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 92/309 (29%), Positives = 146/309 (47%), Gaps = 32/309 (10%)

Query: 1   MRI-LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQ 58
           M   +     P L     GKVR+ Y L + T + + TDR+SAFD  +   IP+KG VL Q
Sbjct: 1   MTTPVLNTDFPGLKLAARGKVRDIYDLGE-TLLIVTTDRISAFDVIMNEGIPHKGYVLTQ 59

Query: 59  ITQYWFHHTSDICSNHTLDYPD---------------PNVLVGQQLQMFPIELIVRGYLA 103
           I+ YWF    DI  NH +                      +  ++ +    E IVRGY++
Sbjct: 60  ISAYWFRQMEDIIKNHIISTDVTDFPKECQPYADVLAGRSMWVKKAKPLAAECIVRGYIS 119

Query: 104 GNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
           G+               I    LP+ + ++ +LP P+ TP+TK+       D+ IS  E+
Sbjct: 120 GSGWKDYQK-----TGAICGIKLPEGLKESDRLPQPIFTPSTKAELG--THDENISFEEM 172

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTP 223
               I        +    L+++E+   LA + G+I+ D+K+E+GI     +I+ DE  TP
Sbjct: 173 CR--ICGTEISTKVRDVTLAIYEKARDLADQKGIIIADTKFEYGIY-DGELIIIDECMTP 229

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W  E+Y+    +       DK F+R+++ T         P +PE I+ +T + Y+
Sbjct: 230 DSSRFWPKESYKPGGPQ----PSFDKQFLRDYLETLDWGKTAPAPPLPEEIVRKTGEKYM 285

Query: 284 AAYEKITGL 292
            A  K+TG 
Sbjct: 286 EALVKLTGK 294


>gi|159039635|ref|YP_001538888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinispora arenicola CNS-205]
 gi|254783972|sp|A8M3D4|PUR7_SALAI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|157918470|gb|ABV99897.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinispora arenicola CNS-205]
          Length = 277

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 82/290 (28%), Positives = 139/290 (47%), Gaps = 21/290 (7%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           +   +SGKVR+ Y    G  I +A+DR+S +D  +   IP KG++L  ++ +WF   +++
Sbjct: 1   MELLHSGKVRDVYA-DGGDLILVASDRISVYDVVLPTPIPDKGKLLTALSLWWFDQLAEL 59

Query: 71  CSNHTLD------YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH L             +  ++L M P+E + RGYL G                +   
Sbjct: 60  VPNHVLSATDVPPEFAGRAIRCRRLDMVPVECVARGYLTGGGFAEYQR-----TGAVSGV 114

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +   LP PV TP+TK+       DQPI+   ++ R  +     E +    L +
Sbjct: 115 ELPRGLVEAAALPEPVFTPSTKAPVGE--HDQPITFGGVVDR--VGAETAERLRRITLDV 170

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG +LA   G+++ D+K E G      + + DE+ T DSSR+W VE+Y+    +    
Sbjct: 171 YRRGAELAAGRGILIADTKIELGWAADGTLTVGDELLTSDSSRFWPVESYQPGRAQFS-- 228

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              DK ++R+W        +   P++P  ++  T   Y+  YEK+TG ++
Sbjct: 229 --YDKQYVRDWATRSGWDKQSPAPELPGEVVDATRARYVDVYEKLTGKRW 276


>gi|146337190|ref|YP_001202238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. ORS278]
 gi|146189996|emb|CAL73988.1| Putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           (SAICAR synthetase), purC-like protein [Bradyrhizobium
           sp. ORS278]
          Length = 304

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 89/313 (28%), Positives = 150/313 (47%), Gaps = 30/313 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L  + +P LP    GKVR+ Y + D   + + TDR+SAFD  +   IP KG VL QI
Sbjct: 1   MTTLLASNLP-LPIIGRGKVRDIYAVGDDRVLLLTTDRISAFDVVMNETIPMKGAVLTQI 59

Query: 60  TQYWFHHTSDICSNHTLDYPDP------------------NVLVGQQLQMFPIELIVRGY 101
           + YWF+    +  +H +                         ++ ++  +FPIE ++RGY
Sbjct: 60  SAYWFNALEGVVHHHMISADTDEIITAVPELKPHRDEILGRAMLCKRTTVFPIECVIRGY 119

Query: 102 LAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN 161
           L+G+               +    LP  + ++QKL   + +P TK+       D+ I+  
Sbjct: 120 LSGSAWKEYAAH-----GTLAGEQLPAGLVESQKLEPAIFSPATKAETG---HDENITIA 171

Query: 162 EIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIH 221
            +  R ++      T+ S   +++  G KLA E G+I+ D+K+EFG DK  +IIL DE+ 
Sbjct: 172 RM--REVVGDETAYTLESMTRAVYTLGEKLAREQGIIIADTKFEFGRDKDGHIILIDEVM 229

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQT 281
           TPDSSR+W V+ Y+    +        +D++               P +P++++  TSQ 
Sbjct: 230 TPDSSRFWAVDAYKPGQPQPSFDKQPLRDYLDAERRAGRWNGDAPPPPLPQSVVDATSQR 289

Query: 282 YIAAYEKITGLKF 294
           Y+ A+ ++T  + 
Sbjct: 290 YLEAFRRVTEREL 302


>gi|307255938|ref|ZP_07537739.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307260391|ref|ZP_07542098.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306861206|gb|EFM93199.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865642|gb|EFM97523.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 285

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + + TDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVTTDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 119 QTGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--NHDINISYEECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|258655174|ref|YP_003204330.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Nakamurella multipartita DSM 44233]
 gi|258558399|gb|ACV81341.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Nakamurella multipartita DSM 44233]
          Length = 293

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 88/299 (29%), Positives = 153/299 (51%), Gaps = 27/299 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + +  +  +GKVR+ Y + D   + +A+DR+SA+D  +   IP KG VL  ++ +WF   
Sbjct: 4   LEDYRHLSTGKVRDLYEVDDELLLMVASDRISAYDYVLPTPIPDKGRVLTAMSVFWFELL 63

Query: 68  SDICSNHTLDYPDPNVL--------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            D+  NH + Y DP +         + ++LQM P+E + RGYL G+  T           
Sbjct: 64  GDVVPNHVVSYDDPRIPDEVRGRALLVRKLQMLPVECVARGYLTGSGLTDYQR-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
           ++    LP  +++   LP P+ TP +K+ +     D+ +S +E+     +     E +  
Sbjct: 119 EVCGIALPPGLTEASMLPEPIFTPASKAEQGE--HDENVSFDEVAR--TIGAPLAEKLRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            +++L+ER    AL   +++ D+K EFG+     I+L DE+ TPDSSR+W    Y    R
Sbjct: 175 LSITLYERAAAHALTRSMLVADTKLEFGLLGD-TIVLGDELVTPDSSRFWPSFGY----R 229

Query: 240 EGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++R+W+ +  + +     +  P +P+N++  T   YI AY+ I+G  F
Sbjct: 230 VGQVQPSFDKQYVRDWLTSPESGWDRHSGEQPPPLPDNVVGATRSRYIEAYQLISGRPF 288


>gi|327449694|gb|EGE96348.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL013PA2]
          Length = 420

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 155/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKLEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEGSDETPHNE 300


>gi|314968615|gb|EFT12713.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA1]
          Length = 420

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 87/299 (29%), Positives = 152/299 (50%), Gaps = 25/299 (8%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G+          
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|206889728|ref|YP_002249081.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|229568630|sp|B5YFN3|PUR7_THEYD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|206741666|gb|ACI20723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 292

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/305 (29%), Positives = 154/305 (50%), Gaps = 32/305 (10%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
            ++ +  +  +     GKVR+ Y + D   + +ATDR+SAFD  +   IP KG++L QI+
Sbjct: 3   NVVLETNLKGVKLLRRGKVRDIYEIED-YLLIVATDRVSAFDVVLPTGIPEKGKILTQIS 61

Query: 61  QYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
            +WF    DI  NH +               +  +   ++ ++ +  P+E IVRGYL+G+
Sbjct: 62  LFWFDKVKDIVENHLVSANADEFPEPLPAYKEILEGRSMLVKKAKPLPVECIVRGYLSGS 121

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                          I    LP+ + ++ KLP PV TP+TK+ +     D  IS  E   
Sbjct: 122 GWKDYQK-----TGMICGIKLPEGLVESAKLPEPVFTPSTKAEQG---HDINISFEET-- 171

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             IL     + +   +LS++++  ++A + G+I+ D+K EFG      +IL DE+ TPDS
Sbjct: 172 IQILGEETAQKVKELSLSIYKKAAQIAEKKGIIIADTKMEFGFY-NGKLILIDELLTPDS 230

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W +E Y    R G      DK  +R+++L+     +   P +PE+I+ +T++ Y   
Sbjct: 231 SRFWSLENY----RIGYPQDSYDKQIVRDYLLSIKWDKKPPAPQLPEDIVNKTAERYKEI 286

Query: 286 YEKIT 290
           +  +T
Sbjct: 287 FRILT 291


>gi|269957903|ref|YP_003327692.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xylanimonas cellulosilytica DSM 15894]
 gi|269306584|gb|ACZ32134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xylanimonas cellulosilytica DSM 15894]
          Length = 307

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 153/314 (48%), Gaps = 40/314 (12%)

Query: 8   YIPELPNYYSGKVRENYFLS-------DGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
            +P   + YSGKVR+ Y              + +A+DR+SA+D  +A  IP KG VL Q+
Sbjct: 6   DLPGWKHVYSGKVRDLYEPDLGAAHPLGDVVLVVASDRISAYDHVLATPIPGKGVVLTQL 65

Query: 60  TQYWFHHTSDICSNHTLDYPD--------------PNVLVGQQLQMFPIELIVRGYLAGN 105
           + +WF   +D+  NH +                     +V ++L M+P+E +VRGYL G+
Sbjct: 66  SLWWFEQLADVVPNHVVSVEVSATPSDGLVPAAVAGRAMVCKRLDMYPVECVVRGYLTGS 125

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                         ++    LP  + D  +LP P+ TP TK+       D+ +  + ++ 
Sbjct: 126 GLAEY-----RSSGEVTGLPLPAGLVDGSRLPEPIFTPATKAEVGE--HDENVPFSAVVE 178

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE-IHTPD 224
           R  L +    T+    L+++ER   +A E G+IL D+K EFG+D     ++  + + TPD
Sbjct: 179 R--LGQQTATTLRDLTLAVYERAEAIARERGIILADTKLEFGVDPATGAVVLGDEVLTPD 236

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQ 280
           SSR+W V+ +E    +       DK ++R+W+ +  + +     D  P +P +++  T  
Sbjct: 237 SSRFWPVDGWEPGRAQ----PSFDKQYVRDWLTSPASGWDRTGADAPPALPADVVEPTRA 292

Query: 281 TYIAAYEKITGLKF 294
            Y+ AYE++TG   
Sbjct: 293 RYLEAYERLTGAPL 306


>gi|301156547|emb|CBW16018.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 286

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 96/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               D      +V ++L    IE IVRGYL G+           
Sbjct: 65  IMPNHFTGDSVYDVLPKEEADLVKDRAVVCKRLNPIKIESIVRGYLTGSGLKDY-----K 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K        D  IS  E      +       
Sbjct: 120 QTGTICGLKLPEGLVEASKLPEPIFTPSSKEEVG--NHDINISYEEC--EKAIGVELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 176 VREKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYKE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P+ +I +T   Y  A + +T
Sbjct: 236 ----GTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPKEVIEKTVAKYQEALDLLT 285


>gi|320107682|ref|YP_004183272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Terriglobus saanensis SP1PR4]
 gi|319926203|gb|ADV83278.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Terriglobus saanensis SP1PR4]
          Length = 307

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 84/313 (26%), Positives = 153/313 (48%), Gaps = 34/313 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L    +     + +GKVR+ Y + +   + +A+DR+SAFD  +   +P KG+VL QI
Sbjct: 1   MATLLHPDLSPRKPWLTGKVRDLYEVGEDHLLFVASDRISAFDHVLGSGVPDKGKVLTQI 60

Query: 60  TQYWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           + +WF H   +  NH +               D  +   ++ ++ +MFP+E + RGYL+G
Sbjct: 61  SLFWFEHLRALVPNHLITAKVAEYPEDLRQYADQLEGRSMLVKRAKMFPVECVARGYLSG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +               +    LP  + ++++LP P+ TP  K+       D+ I  + ++
Sbjct: 121 SGWKDYQE-----TGTVCGISLPSGLRESEELPEPIFTPAAKNHSG---HDENIGFDAVV 172

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK----QNIILADEI 220
               L     E + +  L ++    + A   GL+L D+K+EFG+ +       I LADE+
Sbjct: 173 A--ALGGETAEALRTLTLDIYRAASQHARTKGLLLADTKFEFGLIEDASGTPRITLADEV 230

Query: 221 HTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQ 280
            TPDSSRYW ++ Y     +       DK F+R+++ +     ++  P +P++++ RT +
Sbjct: 231 LTPDSSRYWPIDGYAPGGAQ----PSFDKQFVRDYLESIRWNKQEPAPSLPDDVVERTRE 286

Query: 281 TYIAAYEKITGLK 293
            Y+AA+  +T   
Sbjct: 287 KYLAAFHMLTDKS 299


>gi|325129929|gb|EGC52730.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis OX99.30304]
          Length = 287

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 142/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 5   GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDLIPSKGEILTQISNFWFKKLVH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|152978657|ref|YP_001344286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus succinogenes 130Z]
 gi|171704257|sp|A6VN04|PUR7_ACTSZ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150840380|gb|ABR74351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus succinogenes 130Z]
          Length = 286

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP+KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPHKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               D      +V ++L+   IE IVRGYL G+           
Sbjct: 65  IMPNHFTGDSVYDVLPKAEADLLKDRAVVVKRLKPIKIESIVRGYLTGSGLKDYQQ---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP  + +  KLP P+ TP++K        D  IS  E      + +     
Sbjct: 121 -TGTICGLELPKGLVEAGKLPEPIFTPSSKEEVG--DHDINISYAECERL--IGKELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 176 VRDAAIALYKEAAAYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYKE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P  +I +T   Y  A + +T
Sbjct: 236 ----GTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPAEVIEKTVAKYQEALDLLT 285


>gi|317152942|ref|YP_004120990.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943193|gb|ADU62244.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 298

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 85/310 (27%), Positives = 145/310 (46%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  + +    E      GKVR+ Y +   T + + TDR+SAFD  +   I  KG++LNQI
Sbjct: 1   MTAVMETDFKEYTRISRGKVRDIYAIDADTLLLVTTDRISAFDVVMPDPIEDKGKILNQI 60

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH +                      ++ ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDMMRDLVPNHIIATNVDDYPEPLRKYKAELQDRSVLVKRAKPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              ++  + LP N+ +++ L  P+ TP+TK+       D+ I+ +   
Sbjct: 121 SGWKDYQK-----TGQVCGHALPANLKESEMLETPLFTPSTKADLG--DHDENITLD--T 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++  +   T+ + A++++ R    A   G+I+ D+K+EFG+     +IL DE+ TPD
Sbjct: 172 AAQLIGADLMRTVETLAIAIYSRARDYARLRGIIIADTKFEFGMVGD-QLILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W VE Y      G +    DK + R+W+       +   P +P  I   T   Y+ 
Sbjct: 231 SSRFWPVEGYAP----GASQPSFDKQYFRDWLEEIGFNKQPPAPRVPPEIAESTRAKYME 286

Query: 285 AYEKITGLKF 294
           AY  +TG + 
Sbjct: 287 AYALLTGGEL 296


>gi|254671819|emb|CBA03941.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis alpha275]
 gi|325136019|gb|EGC58629.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M0579]
 gi|325200557|gb|ADY96012.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis H44/76]
 gi|325202446|gb|ADY97900.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M01-240149]
 gi|325207802|gb|ADZ03254.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis NZ-05/33]
          Length = 287

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 142/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 5   GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVH 64

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 65  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 121 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 176 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|145296591|ref|YP_001139412.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum R]
 gi|166229544|sp|A4QGZ4|PUR7_CORGB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|140846511|dbj|BAF55510.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 297

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/299 (30%), Positives = 148/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D   + +A+DR+SA+D  +   IP KG VL  ++Q++F  
Sbjct: 4   ELSQYKHLSAGKVREIYEIDDKHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFDT 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      +V ++L M P E +VRGYL G+              
Sbjct: 64  IDFPNHLAGPADDPRIPEEVLGRAMVCKKLNMLPFECVVRGYLTGSGLVEYKQ-----TS 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ +LP P+ TP TK+       D  +S + +  R  L   +   +  
Sbjct: 119 SVCGVELPEGLVESSQLPEPIFTPATKADIG--DHDINVSFDVVEER--LGEARANQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            ++++++   ++A E G+IL D+K+EFGID+   ++L DE+ TPDSSRYW +E YE    
Sbjct: 175 ASIAIYKAAAEIARERGVILADTKFEFGIDEDGTLVLGDEVLTPDSSRYWPLEGYEA--- 231

Query: 240 EGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK F+RNW+               P +P +++  T + YI AYE I+G KF
Sbjct: 232 -GSVQPSFDKQFVRNWLTGPKSGWDKDSGLEPPALPGSVVEATRERYIEAYELISGQKF 289


>gi|269837321|ref|YP_003319549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphaerobacter thermophilus DSM 20745]
 gi|269786584|gb|ACZ38727.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphaerobacter thermophilus DSM 20745]
          Length = 299

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 88/310 (28%), Positives = 150/310 (48%), Gaps = 32/310 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           ++ +  IP LP +  GKVRE + L D   + +ATDR+SA+D  +   IP KG VL Q+++
Sbjct: 4   VVDQLEIPGLPLFRRGKVRETFDLGDA-LLMVATDRISAYDSVLPTGIPDKGIVLTQLSR 62

Query: 62  YWFHHTSDICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF  T D+  NH +               +  +   +V ++ +   IE +VRGYLAG+ 
Sbjct: 63  FWFERTRDLVPNHLITTDLSDLPAAAQPFREQLEGRSMVVKKAERIDIECVVRGYLAGSA 122

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                      +  +    LP+ +++  KL  P+ TP  K+       D+ I+   ++  
Sbjct: 123 WAEYRR-----EGTVCGIRLPEGLTECAKLDEPIFTPAAKADTG---HDENITFERMVDL 174

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + R+  E +    L+++    + A   G+I+ D+K EFG+     + + DE+ TPDSS
Sbjct: 175 --VGRDLAERLREATLTIYRAAEEYARTRGIIIADTKLEFGL-VDGELTIIDELLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W+ E Y+    +       DK F+R+W+           P +P  ++  T+  Y  AY
Sbjct: 232 RFWDAERYQPGRDQ----PSFDKQFVRDWLTQSGWDREPPAPPLPPEVVEATAAKYREAY 287

Query: 287 EKITGLKFIA 296
           E+ITG     
Sbjct: 288 ERITGRPLFP 297


>gi|229494146|ref|ZP_04387909.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus erythropolis SK121]
 gi|229318508|gb|EEN84366.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus erythropolis SK121]
          Length = 297

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/298 (29%), Positives = 151/298 (50%), Gaps = 25/298 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +    +   GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F+  
Sbjct: 5   LDSYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFNVL 64

Query: 68  SDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
                       +   +      LV + L M P+E +VRG+L G+          N    
Sbjct: 65  GGTNHLAGEPDDDRIPEEVLGRALVVRSLDMVPVECVVRGFLTGSGLVDY-----NNTGA 119

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP+ + +  +LP P+ TP +K++      D+ IS ++++ +  + +     +   
Sbjct: 120 VCGVALPEGLVEASRLPDPIFTPASKAALG--DHDENISFDQVVEK--VGQKLAVQLRED 175

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
            L ++ R    A + G+IL D+K EFG+D   N++LADE+ TPDSSRYW +E YE     
Sbjct: 176 TLDVYARASNFAADRGIILADTKLEFGLDSAGNLVLADEVLTPDSSRYWPLEGYEA---- 231

Query: 241 GITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           G      DK F+R+W+ +  + +        P +P+ I+  T   YI AYE+I+GL F
Sbjct: 232 GKVQPSFDKQFVRDWLTSPESGWDRSSDTTPPPLPQEIVDATRARYIEAYERISGLSF 289


>gi|19553793|ref|NP_601795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|62391435|ref|YP_226837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|25008973|sp|Q8NMH6|PUR7_CORGL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21325369|dbj|BAB99990.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|41326776|emb|CAF21258.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
           [Corynebacterium glutamicum ATCC 13032]
          Length = 297

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/299 (29%), Positives = 148/299 (49%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  +GKVRE Y + D   + +A+DR+SA+D  +   IP KG VL  ++Q++F  
Sbjct: 4   ELSQYKHLSAGKVREIYEIDDKHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFDT 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                            +      +V ++L M P E +VRGYL G+              
Sbjct: 64  IDFPNHLAGPADDPRIPEEVLGRAMVCKKLNMLPFECVVRGYLTGSGLVEYKQ-----TS 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +    LP+ + ++ +LP P+ TP TK+       D  +S + +  R  L   +   +  
Sbjct: 119 SVCGVELPEGLVESSQLPEPIFTPATKADIG--DHDINVSFDVVEER--LGEARANQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            ++++++   ++A + G+IL D+K+EFGID+   ++L DE+ TPDSSRYW +E YE    
Sbjct: 175 ASIAIYKAAAEIARDRGVILADTKFEFGIDEDGTLVLGDEVLTPDSSRYWPLEGYEA--- 231

Query: 240 EGITPIGLDKDFIRNWIL--TRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK F+RNW+               P +P +++  T + YI AYE I+G KF
Sbjct: 232 -GSVQPSFDKQFVRNWLTGPKSGWDKDSGLEPPALPGSVVEATRERYIEAYELISGQKF 289


>gi|329666292|pdb|3R9R|A Chain A, Structure Of A
           Phosphoribosylaminoimidazole-Succinocarboxamide Synthase
           From Mycobacterium Abscessus Atcc 19977  DSM 44196
          Length = 301

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/299 (28%), Positives = 146/299 (48%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  SGKVRE Y + D   + +ATDR+SAFD  +   IP KG +L  ++ ++F  
Sbjct: 8   SLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFGL 67

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               +      L+ ++L M P+E + RGYL G+              
Sbjct: 68  LTVPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTGSGLLDYQR-----TG 122

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +  ++LP  + +  +L  P+ TP TK+       D  +  +     G++   +   +  
Sbjct: 123 AVCGHVLPQGLGEASRLDPPLFTPATKADIGE--HDMNV--DFAAVVGLVGAVRANQLRD 178

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             + ++ R    AL  G+IL D+K+EFG+D + N++LADE+ TPDSSRYW+   Y+    
Sbjct: 179 ETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQPGVV 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK F+RNW+    + +        P +P+ + + T + YI AYE+I+GL F
Sbjct: 239 Q----DSFDKQFVRNWLTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSF 293


>gi|169627791|ref|YP_001701440.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium abscessus ATCC 19977]
 gi|229564398|sp|B1MHW4|PUR7_MYCA9 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169239758|emb|CAM60786.1| Probable phosphoribosylaminoimidazole-succinocarboxamide synthase
           PurC [Mycobacterium abscessus]
          Length = 297

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/299 (28%), Positives = 146/299 (48%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  SGKVRE Y + D   + +ATDR+SAFD  +   IP KG +L  ++ ++F  
Sbjct: 4   SLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFGL 63

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               +      L+ ++L M P+E + RGYL G+              
Sbjct: 64  LTVPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTGSGLLDYQR-----TG 118

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +  ++LP  + +  +L  P+ TP TK+       D  +  +     G++   +   +  
Sbjct: 119 AVCGHVLPQGLGEASRLDPPLFTPATKADIGE--HDMNV--DFAAVVGLVGAVRANQLRD 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             + ++ R    AL  G+IL D+K+EFG+D + N++LADE+ TPDSSRYW+   Y+    
Sbjct: 175 ETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQPGVV 234

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK F+RNW+    + +        P +P+ + + T + YI AYE+I+GL F
Sbjct: 235 Q----DSFDKQFVRNWLTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSF 289


>gi|256827577|ref|YP_003151536.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cryptobacterium curtum DSM 15641]
 gi|256583720|gb|ACU94854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cryptobacterium curtum DSM 15641]
          Length = 290

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 104/302 (34%), Positives = 161/302 (53%), Gaps = 32/302 (10%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSD 69
           EL     GKVR+ Y L D   + +ATDR+SAFD  +   IPYKG+VL Q++++WF   +D
Sbjct: 5   ELKPDAQGKVRDLYDLGD-KLLLVATDRISAFDYVLEDEIPYKGKVLTQLSRFWFDLLAD 63

Query: 70  ICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           I  NH +               +Y D   ++ ++ QM+P+E IVRGYL G+   S     
Sbjct: 64  IVDNHVISTDVADLPDEFKPYEEYLDGRFMLVRKAQMYPVECIVRGYLTGSGLASYRK-- 121

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
                 +    LP+ ++++ KLP  + TP+TK+     G D+ IS +  +    +     
Sbjct: 122 ---NGTVCGIQLPEGLTESSKLPTALFTPSTKAEIG--GHDENISFDTTVDL--VGEQAA 174

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
            T+    L+++E+    A + G+I+ D+K+EFG+     +ILADE+ TPDSSR+W   TY
Sbjct: 175 TTLRDLTLAVYEKAADHAAQQGIIIADTKFEFGV-VDGKVILADEVLTPDSSRFWAAATY 233

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            +   +       DK F+RNW+         N P +PE+++ +TS+ YI AYE ITG  F
Sbjct: 234 REGEVQ----PSFDKQFVRNWLNAN-WDRSGNPPHLPEDVVQKTSEKYIQAYELITGTSF 288

Query: 295 IA 296
             
Sbjct: 289 QK 290


>gi|71900813|ref|ZP_00682932.1| SAICAR synthetase [Xylella fastidiosa Ann-1]
 gi|71729434|gb|EAO31546.1| SAICAR synthetase [Xylella fastidiosa Ann-1]
          Length = 308

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 93/316 (29%), Positives = 148/316 (46%), Gaps = 38/316 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNIA-CI 49
           +  L ++ +P LP  + GKVR+ + +               + +ATDRLSAFD  +   I
Sbjct: 2   LTTLLQSDLPGLPLRHCGKVRDVFDIPRKRLPVDTRSGEYLLIVATDRLSAFDVVLPDPI 61

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIE 95
           P KGE+L QI+ +WF  T  +  NH                       +V ++L+   IE
Sbjct: 62  PGKGEILCQISNFWFQKTKHLMPNHLTGINVASVLPDGIDKTLYTQRAVVTKKLKPVGIE 121

Query: 96  LIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCD 155
            I RGYL G+              K+    LPD + + +KLP P+ TP+TK++      D
Sbjct: 122 AIARGYLIGSGWKDYQR-----TGKVSGIQLPDGLQEAEKLPDPIFTPSTKAAVGH--HD 174

Query: 156 QPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNII 215
           + I  +  +    +     E +    L ++    K A E G++L D+K+EFG D    + 
Sbjct: 175 ENIDFDTTVKM--VGAELAERVRDATLRIYHFAAKYAAECGILLADTKFEFGTDIDGRLY 232

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           + DE+ TPDSSRYW ++ Y    + G +P   DK  +RN++ T         P +P++II
Sbjct: 233 VMDEMLTPDSSRYWPIDEY----QVGTSPPSYDKQLVRNYLETLDWDKTAPGPTLPQDII 288

Query: 276 LRTSQTYIAAYEKITG 291
             T   Y  A +++ G
Sbjct: 289 DHTRAKYTEALQRLAG 304


>gi|223041880|ref|ZP_03612066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus minor 202]
 gi|223017302|gb|EEF15728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus minor 202]
          Length = 285

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   S 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKLMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFDKLSH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDYQK---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP  + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 120 -TGTICGLELPKGLVEASKLPEPIFTPSSKAEVG--DHDINISYAECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYKEAADYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK FIR+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFIRDWLENSGWNKQAPAPRVPADVIEKTVAKYQEALDLLT 284


>gi|307824926|ref|ZP_07655148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacter tundripaludum SV96]
 gi|307733973|gb|EFO04828.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacter tundripaludum SV96]
          Length = 297

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 88/304 (28%), Positives = 143/304 (47%), Gaps = 28/304 (9%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
             L ++ +  L     GKVR+ Y + D   + + TDRLSAFD  +   IP KG VL  ++
Sbjct: 5   EALYQSTLSSLKLRARGKVRDIYDIDDKHMLIVTTDRLSAFDVILPDPIPGKGRVLTSVS 64

Query: 61  QYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFPIELIVRGYLAGNT 106
            +WF     +  NH  D P              +   +V + L+  P+E IVRGYL G+ 
Sbjct: 65  NFWFEKMKHVMPNHLSDIPLEQVVPDAAERAQIEGRAIVVKLLKPLPVEAIVRGYLIGSG 124

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         +    LP+ +   Q+LP P+ TP+TK+       D+ +S ++ +  
Sbjct: 125 WKDYQK-----SGAVCCIKLPEGLQQAQQLPEPIYTPSTKAEVDQ--HDENVSFDKTVEL 177

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + +   E +   +L L++     A E G+I+ D+K+EFG+D    + L DE  TPDSS
Sbjct: 178 --MGQELAEKVRDASLKLYKEAAAYAKERGIIIADTKFEFGVDDDGVLYLIDEALTPDSS 235

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    + GI+P   DK +IR+++ T         P +P  +    +  Y  A 
Sbjct: 236 RFWPADQY----QVGISPPSFDKQYIRDYLETLDWDKTAPGPHLPAEVAEYCAAKYREAE 291

Query: 287 EKIT 290
            ++T
Sbjct: 292 VRLT 295


>gi|227496886|ref|ZP_03927149.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces urogenitalis DSM 15434]
 gi|226833620|gb|EEH66003.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces urogenitalis DSM 15434]
          Length = 305

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/301 (28%), Positives = 149/301 (49%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSD-------GTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y  +D          + +A+DR+SA+D  ++  +P KG+VL  ++
Sbjct: 14  LPGWQHLSSGKVRDVYVPADNGPWAGKDVLLVVASDRISAYDYILSTPVPDKGKVLTALS 73

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       ++ Q+L+M+P+E + RGYL G+          
Sbjct: 74  AWWFEQLADIIPNHLVSLEVPEQVAGRAMICQRLEMYPVECVARGYLTGSGLAEY----- 128

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ +++  +LP PV TP  K+       D+ +S   +     +  +   
Sbjct: 129 RAGGAVCGVPLPEGLTEASRLPEPVFTPAVKAELG--DHDENVSFERVAEM--VGESAAS 184

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
           ++    L L+     +A E G+IL D+K+E G D    ++L DE+ TPDSSR+W  + + 
Sbjct: 185 SLREVTLRLYSAAADIARERGIILADTKFELGRDASGQMVLGDEVLTPDSSRFWPADEWV 244

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK F+R+W+    + +        P +P+++I RT   Y+ AYE++TG
Sbjct: 245 P----GQVTPSFDKQFVRDWLTGPDSGWDRSSGQQPPALPDDVIERTRARYLEAYERLTG 300

Query: 292 L 292
            
Sbjct: 301 H 301


>gi|322515376|ref|ZP_08068370.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Actinobacillus ureae ATCC 25976]
 gi|322118603|gb|EFX90831.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Actinobacillus ureae ATCC 25976]
          Length = 285

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 145/294 (49%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      ++ ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDILPKEEAEAIQHRAVICKRLTPVKIESIVRGYLTGSGLKDYNQ---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 120 -TGTICGLKLPEGLVEASKLPQPIFTPSSKAEVG--DHDINISYEECERQ--IGAELATK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVETYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPSDVIEKTVAKYQEALDLLT 284


>gi|312215083|emb|CBX95036.1| similar to phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptosphaeria maculans]
          Length = 302

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 94/310 (30%), Positives = 159/310 (51%), Gaps = 30/310 (9%)

Query: 2   RILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
             +    I   LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  +
Sbjct: 4   EAIVNIDIQGKLPKVASGKVRDLYAIDDATLLFVASDRISAYDVIMENGIPGKGALLTAM 63

Query: 60  TQYWFHHTSDICS---NHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYL 102
           + YWF++          H L    P                +  ++L++ PIE IVRGY+
Sbjct: 64  SIYWFNYLPTQVPGLKTHFLSNDLPAPLSSLPEAASLKGRSMQVRRLRILPIESIVRGYI 123

Query: 103 AGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
            G+  +            +    LP  + + QKLP P+ TP+TK+       D+ ISP +
Sbjct: 124 TGSGWSEYKK-----SGTVNGIALPKGLLEGQKLPEPLWTPSTKAELGGK--DENISPEQ 176

Query: 163 IIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
              + I   N    +   +L++++     A   G++L D+K+EFG+D++  ++L DE+ T
Sbjct: 177 AR-KTIADENVAAKVEELSLAIYKAAAARAEAVGIVLADTKFEFGLDEEGQVVLVDEVLT 235

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
           PDSSR+W  +T+E++   G      DK F+R+W+ +     ++ +  +P++I+ +T+  Y
Sbjct: 236 PDSSRFWPKDTWEQNL--GRAQPSFDKQFLRDWLTSNGLKGKEGV-TVPQDIVEKTAAKY 292

Query: 283 IAAYEKITGL 292
             AYEKITG 
Sbjct: 293 REAYEKITGQ 302


>gi|50290021|ref|XP_447442.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526752|emb|CAG60379.1| unnamed protein product [Candida glabrata]
          Length = 306

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 93/319 (29%), Positives = 161/319 (50%), Gaps = 39/319 (12%)

Query: 1   MRILSKAYIPEL-PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQ 58
           M  +S+  +  L P    GKVR+ Y + + T + +ATDR+SA+D  +   IP KG +L +
Sbjct: 1   MVTVSETQLDGLLPLVARGKVRDIYEVDEHTLLFVATDRISAYDVIMENTIPDKGVLLTK 60

Query: 59  ITQYWFHHTSDICSNHTLDYPD----------------------PNVLVGQQLQMFPIEL 96
           ++++WF    D   NH +  P                          L+ ++ ++ P+E+
Sbjct: 61  LSEFWFEFLKDEVRNHLIAIPQGKTVFDLLPAALSQDKYRSQLEGRALLVRKHKLIPLEV 120

Query: 97  IVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           IVRG++ G+            K  ++    P  + ++Q+ P P+ TP+TK+ +     D+
Sbjct: 121 IVRGFITGSAWKEY-----KAKGTVHTLPQPAGLQESQEFPQPIFTPSTKAEQGE--HDE 173

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK-QNII 215
            ISP++     ++  +    I   A+ L+ +  + A   G+I+ D+K+EFG D K   II
Sbjct: 174 NISPDQ--AAELVGEDLKNRIEQLAIRLYSKCKEYAKTKGIIIADTKFEFGYDDKTDEII 231

Query: 216 LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENII 275
           L DE+ TPDSSR+W  E Y      G +    DK F+R+W+ +     +  +  +PE+I+
Sbjct: 232 LVDEVLTPDSSRFWNGENY----AIGKSQDSYDKQFLRDWLTSNDLNGKPGV-KMPEDIV 286

Query: 276 LRTSQTYIAAYEKITGLKF 294
            RT   Y+ A+E +TG K+
Sbjct: 287 TRTRAKYVEAFEALTGEKW 305


>gi|240949796|ref|ZP_04754128.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus minor NM305]
 gi|240295828|gb|EER46515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus minor NM305]
          Length = 285

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   S 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFDKLSH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQYRAVVCKRLTPVKIESIVRGYLTGSGLKDYQK---- 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP  + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 120 -TGTICGLALPKGLVEASKLPEPIFTPSSKAEVG--DHDINISYAECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYKEAADYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK FIR+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFIRDWLENSGWNKQAPAPRVPADVIEKTVAKYQEALDLLT 284


>gi|315079301|gb|EFT51304.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL053PA2]
          Length = 375

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 154/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G           
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGLGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKLEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|313793814|gb|EFS41845.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA1]
 gi|313803128|gb|EFS44336.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA2]
 gi|313839247|gb|EFS76961.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL086PA1]
 gi|314964730|gb|EFT08830.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL082PA1]
 gi|327456146|gb|EGF02801.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL092PA1]
          Length = 420

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/314 (28%), Positives = 154/314 (49%), Gaps = 25/314 (7%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           +  +++  LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++
Sbjct: 1   MVTSHL-NLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMS 59

Query: 61  QYWFHHTSDICSNHTLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +DI  NH +    P       +V ++L MFP+E +VRGYL G           
Sbjct: 60  LWWFDQLADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTGLGWAEYQRNQA 119

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
                +    LP+ + +  +L  P+ TP  K+ +     D+ I  + +    ++  +   
Sbjct: 120 -----VCGIRLPEGLQNGSRLEEPIFTPAIKAPQGE--HDENI--DYLRLVELVGPDVAA 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L +++R  ++A + G++L D+K EFG      I+LADE+ TPDSSR+W+ ET++
Sbjct: 171 QLHDLSLRVYQRAEEIARKRGILLADTKLEFGRRVDGTIVLADEVLTPDSSRFWDAETWQ 230

Query: 236 KSFREGITPIGLDKDFIRNWIL-TRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGL 292
                G      DK ++R+W+              P +PE ++  TS+ Y  A+ ++TG 
Sbjct: 231 P----GKGADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGG 286

Query: 293 KFIADNSELPPLER 306
               + S+  P   
Sbjct: 287 HVSDEVSDETPHNE 300


>gi|262197026|ref|YP_003268235.1| phosphoribosylaminoimidazolesuccinocarboxamidesy nthase [Haliangium
           ochraceum DSM 14365]
 gi|262080373|gb|ACY16342.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase [Haliangium
           ochraceum DSM 14365]
          Length = 331

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 176/315 (55%), Gaps = 10/315 (3%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
            L +   P L   + GKVR++Y   D   I + TDRLSAFD+ +  IPYKG+VLNQ+  Y
Sbjct: 17  TLERTDFPALGEKHPGKVRDSYVRGDQRTIVV-TDRLSAFDRVLGTIPYKGQVLNQLAAY 75

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T+DI  NH +  PDPNV+V +++     E +VR YL G T TS+   Y++G R   
Sbjct: 76  WFEETADIAPNHVVRVPDPNVMVVREVTPLRAEFVVRSYLTGVTSTSIWRAYESGARTFC 135

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
            + LP+ M  NQ LP P++TP+TK+ +     D  +S  E++  G++T   ++     A+
Sbjct: 136 GHALPEGMHKNQPLPEPILTPSTKAPQGE--HDISVSREELLASGVITEEHFDRAGEIAM 193

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKK----QNIILADEIHTPDSSRYWEVETYEKSF 238
            LF  G + A E GLIL D+KYE G+ K       I++ DEIHTPDSSRYW  E +E   
Sbjct: 194 KLFAFGQQRAAERGLILADTKYEMGVAKNAAGEDEILVIDEIHTPDSSRYWHAEDFETRV 253

Query: 239 REGITPIGLDKDFIRNWI-LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIAD 297
           + G  P  LDK+++R W+   R        P +P+ + L  ++ YIA YE +TG      
Sbjct: 254 KAGQEPRSLDKEYVRRWLAEERDYRGDGEPPTLPDEVRLEAARRYIATYELVTGQ--PFA 311

Query: 298 NSELPPLERIRNNLR 312
               PP +RI   L 
Sbjct: 312 PDPAPPAQRIAQTLA 326


>gi|304387934|ref|ZP_07370107.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria meningitidis ATCC 13091]
 gi|304338031|gb|EFM04168.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria meningitidis ATCC 13091]
          Length = 321

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 142/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     
Sbjct: 39  GLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVH 98

Query: 70  ICSNHTLDY-------------PDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH                  +   +V ++L    +E IVRGYLAG+           
Sbjct: 99  IMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK---- 154

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     
Sbjct: 155 -TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVG--DHDENISFEECER--IIGKELAAE 209

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y  
Sbjct: 210 VRAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY-- 267

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             + G  P   DK F+R+W+       +   P +P N+I +T + Y  A   +T
Sbjct: 268 --KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPANVIQKTVEKYQEALTLLT 319


>gi|118471351|ref|YP_890068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium smegmatis str. MC2 155]
 gi|166230822|sp|A0R4I0|PUR7_MYCS2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|118172638|gb|ABK73534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium smegmatis str. MC2 155]
          Length = 299

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 141/302 (46%), Gaps = 29/302 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + +  +  SGKVRE Y + D   + +A+DR+SA+D  +   IP KG +L  ++ ++F H 
Sbjct: 5   LSDYQHLASGKVREIYRIDDEHLLFVASDRISAYDYILDSQIPDKGRILTAMSVFFFDHL 64

Query: 68  -----------SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                                      LV ++L M P+E + RGYL G+           
Sbjct: 65  LRTAGVPNHLAGPPDDERIPADVLGRALVVRRLDMLPVECVARGYLTGSGLIDYEK---- 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LP  + +  K   P+ TP TK+       D+ IS  ++I    +       
Sbjct: 121 -TGTVCGIALPPGLGEASKFDEPLFTPATKAEIGE--HDENISFAKVIEL--VGAELANQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L  +  G   AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y+ 
Sbjct: 176 LRDRTLQTYTAGADHALSKGIIIADTKFEFGVDRDGTVVLADEVFTPDSSRYWRADSYQP 235

Query: 237 SFREGITPIGLDKDFIRNWIL--TRCNP--YRDNIPDIPENIILRTSQTYIAAYEKITGL 292
              +       DK F+RNW+               P +P++I+  T + YI AYE+I+GL
Sbjct: 236 GVVQNS----FDKQFVRNWLTGPESGWDRHGNTPPPALPDDIVAATRERYIEAYERISGL 291

Query: 293 KF 294
            F
Sbjct: 292 SF 293


>gi|332288624|ref|YP_004419476.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallibacterium anatis UMN179]
 gi|330431520|gb|AEC16579.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallibacterium anatis UMN179]
          Length = 286

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 98/304 (32%), Positives = 151/304 (49%), Gaps = 33/304 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+ +       L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI
Sbjct: 1   MQTI------SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQI 54

Query: 60  TQYWFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF+  + I  NH                  +   +V ++L    IE IVRGYL G+ 
Sbjct: 55  SNFWFNKLAHIMPNHFTGDTVYDVLPEAEAKAIEKRAVVCKRLTPIKIESIVRGYLTGSG 114

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                         I    LP  + +  KLP P+ TP++K        D  IS  E    
Sbjct: 115 LKDYQK-----TGSICGLALPKGLVEASKLPEPIFTPSSKEEIG--NHDINISYAEC--E 165

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            ++ ++    +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSS
Sbjct: 166 KLIGKDLAAQVKEKAIALYTTAAQYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSS 225

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W V++Y++    GI P   DK FIRNW+       +   P +P+ II +T   Y  A+
Sbjct: 226 RFWSVDSYQE----GINPPSFDKQFIRNWLENSGWNKQPPAPKVPQEIIDQTVAKYQEAF 281

Query: 287 EKIT 290
           + +T
Sbjct: 282 DLLT 285


>gi|297625618|ref|YP_003687381.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921383|emb|CBL55936.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 292

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 88/295 (29%), Positives = 145/295 (49%), Gaps = 25/295 (8%)

Query: 11  ELPNYYSGKVRENYFL--SDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
            LP  ++GKVRE + L       + +ATD +SAFD  +   IP KG VL Q++ +WF   
Sbjct: 10  GLPLIHAGKVRELFDLPREPAHLLMVATDNISAFDYVLDSMIPDKGVVLTQLSLWWFKQL 69

Query: 68  SDICSNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
            DI  NH +    P+ + G+     +L M P+E + RGYL G+               + 
Sbjct: 70  GDIVDNHVVSTDVPDEVAGRAIVAEKLDMVPVECVARGYLTGSGWAEYQE-----TGSVT 124

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP  + D  +LP P+ TP TK+       D+ +S +++     +  +    I    L
Sbjct: 125 GIALPAGLHDGSRLPEPIFTPATKAPMGE--HDENVSFDQMSR--TVGYDTGAAIRDLTL 180

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            L+ +  ++A E G++L D+K+EFG      ++L DE+ TPDSSR+W+ + YE       
Sbjct: 181 RLYAKAEQIARERGIVLADTKFEFGRRPDGVLVLGDEVLTPDSSRFWDADAYEAG----- 235

Query: 243 TPIGLDKDFIRNWI-LTRCNPY--RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                DK ++R+W+           +  P +P+ I+  T + Y+ A+E++TG   
Sbjct: 236 RLESFDKQYLRDWLTHDSGWDRSSGERPPALPDAIVTATRERYLEAFERLTGAPL 290


>gi|307262521|ref|ZP_07544166.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306867898|gb|EFM99729.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 285

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 4   SLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAH 63

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               +      +V ++L    IE IVRGYL G+           
Sbjct: 64  IMPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTGSGLKDY-----K 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    L + + +  KLP P+ TP++K+       D  IS  E   +  +       
Sbjct: 119 QTGTICGLKLLEGLVEASKLPQPIFTPSSKAEVG--NHDINISYEECERQ--IGAELAAK 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY++
Sbjct: 175 VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQE 234

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 ----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|291280236|ref|YP_003497071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deferribacter desulfuricans SSM1]
 gi|290754938|dbj|BAI81315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deferribacter desulfuricans SSM1]
          Length = 292

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 99/306 (32%), Positives = 160/306 (52%), Gaps = 31/306 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M ++ K  IPEL     GKVR+ Y L +   + + TDR+SAFD  +   IPYKG VL Q+
Sbjct: 1   MDVVLKTEIPELKLIGRGKVRDIYDLGN-YLLIVTTDRISAFDVILPNGIPYKGYVLTQL 59

Query: 60  TQYWFHHTSDICSNHTLDYP---------------DPNVLVGQQLQMFPIELIVRGYLAG 104
           +++WF  TS I  NH +                  +   ++ ++ + +P+E +VRGY+ G
Sbjct: 60  SKFWFEKTSHIVKNHLITTDIEEMPEICKKYRNILEGRSMLVEKAKPYPVECVVRGYITG 119

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +              ++    LP N+ ++QKL  P+ TP TK+       D+ IS  +++
Sbjct: 120 SGWKDYQK-----TGEVCGIKLPKNLKESQKLEPPLFTPATKAEIGE--HDENISFEQMV 172

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
               + +   E +  YA+ ++    K+A E G+I+ D+K EFG +K   IIL DE+ TPD
Sbjct: 173 LM--VGQKTAEKLRDYAIKIYTYCAKIAEEKGIIIADTKMEFG-NKDGEIILIDELLTPD 229

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y    + G     +DK F+RN++ T     +   P++P+ II +TS+ Y+ 
Sbjct: 230 SSRFWFKEKY----KVGEPQESMDKQFVRNYLETLDWDKKAPGPELPKEIIEQTSKRYLE 285

Query: 285 AYEKIT 290
             E +T
Sbjct: 286 IMEILT 291


>gi|52425536|ref|YP_088673.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mannheimia succiniciproducens MBEL55E]
 gi|81825513|sp|Q65SH2|PUR7_MANSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|52307588|gb|AAU38088.1| PurC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 286

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 27/294 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
            L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + 
Sbjct: 5   SLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILEDPIPRKGEILTQISNFWFKKLAH 64

Query: 70  ICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH               D      +V ++L+   IE IVRGYL G+           
Sbjct: 65  IMPNHFTGDTVYDVLPKEEADLVKNRAVVVKRLKPIKIESIVRGYLTGSGLKDY-----K 119

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               I    LP  + +  KLP P+ TP++K        D  IS  E   +  + +     
Sbjct: 120 QTGTICGLQLPQGLVEASKLPEPIFTPSSKEEVG--DHDINISYAECERQ--IGKELAAQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY +
Sbjct: 176 VRDAAIALYKEAAAYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYRE 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               G  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 236 ----GTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPADVIQKTVDKYQEALDLLT 285


>gi|315442647|ref|YP_004075526.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. Spyr1]
 gi|315260950|gb|ADT97691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. Spyr1]
          Length = 297

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 91/298 (30%), Positives = 146/298 (48%), Gaps = 25/298 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + +  +  SGKVRE Y + DG  + +ATDR+SA+D  +   IP KG VL  ++ ++F   
Sbjct: 5   LSDYQHVASGKVRELYHVDDGHLLFVATDRISAYDHILESQIPDKGRVLTAMSVFFFGLL 64

Query: 68  SDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
                           +      LV +QL M P+E + RGYL G+    L+ + K G   
Sbjct: 65  DSPNHLAGPPDDERIPEEVLGRALVVRQLDMLPVEAVARGYLTGSG---LIDYQKTG--T 119

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP  + +  +   P+ TP TK+       D  I+ ++++    +   + E +   
Sbjct: 120 VCGIPLPSGLVEASRFDEPLFTPATKAELGE--HDVNITYDDVVEL--IGAERAERLRER 175

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
            L+++ +G   A   G+I+ D+K+EFGI     + LADE+ TPDSSRYW  + Y +   +
Sbjct: 176 TLAVYRQGADHASTRGIIVADTKFEFGIGADGELALADEVFTPDSSRYWRADDYAEGQVQ 235

Query: 241 GITPIGLDKDFIRNWIL--TRCNP--YRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                  DK F+RNW+               P +P +I+  T   YI AYE+I+GL+F
Sbjct: 236 NS----FDKQFVRNWLTGPDSGWDRNGDQAPPPLPPDIVAATRARYIEAYERISGLRF 289


>gi|256833620|ref|YP_003162347.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Jonesia
           denitrificans DSM 20603]
 gi|256687151|gb|ACV10044.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Jonesia
           denitrificans DSM 20603]
          Length = 320

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 151/329 (45%), Gaps = 45/329 (13%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTR----------ITIATDRLSAFDQNI-A 47
           M  L     ++P   + YSGKVR+ Y                 + +A+DR+SA+D  +  
Sbjct: 1   MSGLDTTAQHLPGWRHVYSGKVRDLYEPDTDALGGPHPLGDVVLVVASDRVSAYDHVLSP 60

Query: 48  CIPYKGEVLNQITQYWFHHTSDICSNHTLDYP--------------DPNVLVGQQLQMFP 93
            IP KG VL Q++ +WF   ++I  NH +                 D   ++ ++L MFP
Sbjct: 61  GIPGKGIVLTQLSVWWFEQLAEIVGNHLVSLEVSVTPTDGLIPAAVDGRAMICRRLTMFP 120

Query: 94  IELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASG 153
           IE +VRGYL G+               +    LP  ++D  +L  P+ TP  K+      
Sbjct: 121 IECVVRGYLTGSGLVEYRD-----NSTVCGVPLPAGLTDGSRLEVPIFTPAAKAEVGE-- 173

Query: 154 CDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQ- 212
            D+ I+  +   R  +     E +  + L+++     +A E+G+IL D+K EFG D    
Sbjct: 174 HDENITFEDTAQR--IGWAAAEILRDHTLAVYTHAEGIAREHGVILADTKLEFGTDPVTG 231

Query: 213 NIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD----NIP 268
            I+L DE+ TPDSSR+W+   +     +       DK FIR+W+ +  + +        P
Sbjct: 232 EILLGDEVLTPDSSRFWDALMWAPGGAQ----PSFDKQFIRDWLTSSESGWDRSSDTPPP 287

Query: 269 DIPENIILRTSQTYIAAYEKITGLKFIAD 297
            +P++++  T + Y+ AY +ITG      
Sbjct: 288 ALPQHVVAATQERYLEAYTRITGKSLTLP 316


>gi|297563358|ref|YP_003682332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847806|gb|ADH69826.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 278

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 92/293 (31%), Positives = 152/293 (51