RPSBLAST alignment for GI: 254780493 and conserved domain: TIGR02735

>gnl|CDD|131782 TIGR02735, purC_vibrio, phosphoribosylaminoimidazole-succinocarboxamide synthase, Vibrio type. Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence and gap pattern from a form (see TIGR00081) shared by a broad range of bacteria and eukaryotes. Members of this family are found within the gammaproteobacteria in the genera Vibrio, Shewanella, and Colwellia, and also (reported as a fragment) in the primitive eukarote Guillardia theta. Length = 365
 Score =  120 bits (303), Expect = 4e-28
 Identities = 102/331 (30%), Positives = 153/331 (46%), Gaps = 66/331 (19%)

Query: 16  YSGKVRENYFLS--DGTR----------------ITIATDRLSAFDQNIACI-------- 49
           +SGKVR  Y+L+  D  R                I + +DR+SAFD    CI        
Sbjct: 22  HSGKVRSVYWLTEEDSRRLIEEKGYPVAHDAPLAIMVISDRISAFD----CIWHAEGGLN 77

Query: 50  --PYKGEVLNQITQYWFH--HTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGN 105
             P KG  LN I+ +WF     + +  +H LD P P V + Q+ +   IE I R Y+ G 
Sbjct: 78  GVPGKGAALNAISNHWFKLFAEAGLAESHILDIPHPFVWIVQKAKPVKIEAICRQYITG- 136

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS-ESASGC----DQPISP 160
              S+   Y  G+R      LP+ ++ +Q+LP  +ITP+TK   E   G     D  I+ 
Sbjct: 137 ---SMWRAYAKGERVFCGIDLPEGLAKDQRLPELLITPSTKGILEGIPGVPAIDDVNITR 193

Query: 161 NEI-IHRGILTRNQWETISSYALSLFERGCKL---ALEN-GLILVDSKYEFG----IDKK 211
            +I  +       Q E I  Y   L   G  +    L   G + VD+K+EFG    ++  
Sbjct: 194 ADIERNWSAFNFEQPEDIDHYE-RLLREGFAVISDRLSKLGQLFVDTKFEFGYVTDVEGT 252

Query: 212 QNIILADEIHTPDSSRYWE---------VETYEKSFREGITPIGLDKDFIRN--WILTRC 260
           + +I  DE+ TPDSSR W+         VE  ++ FR+ +     D D + N   ++ R 
Sbjct: 253 RKLIYMDEVGTPDSSRIWDAGAYAQGKIVENSKEGFRQALLNWFPDPDILLNKDRMVERA 312

Query: 261 NPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
              RDN   +P+ +++  S+TY+   EKITG
Sbjct: 313 ALARDNA--LPQEMLMDVSETYLGIAEKITG 341