RPSBLAST alignment of GI: 254780493 and SCOP domain: d2cnqa1

Alignment
>d2cnqa1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 304
 Score =  185 bits (470), Expect = 5e-48
 Identities = 90/308 (29%), Positives = 153/308 (49%), Gaps = 38/308 (12%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFD-QNIACIPYKGEVLNQITQYWFHHTSD 69
            LP    GKVR+ Y +  GT + +ATDR+SA+D      IP KG +L +++++WF   S+
Sbjct: 10  ILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSN 69

Query: 70  ICSNHTLDYPDP----------------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
              NH +D                            L+  + ++ P+E+IVRGY+ G+  
Sbjct: 70  DVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAW 129

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        ++    P  + ++Q+ P P+ TP+TK+ +     +   + +      
Sbjct: 130 KE-----YVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQ----GEHDENISPAQAAE 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 181 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 240

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y+     G +    DK F+R+W+        +    +P++I+ RT   YI AY
Sbjct: 241 RFWNGASYK----VGESQDSYDKQFLRDWLTANKLNGVNG-VKMPQDIVDRTRAKYIEAY 295

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 296 ETLTGSKW 303

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: SAICAR synthase-like
superfamily: SAICAR synthase-like
family: SAICAR synthase
domain: SAICAR synthase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]