RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780494|ref|YP_003064907.1| cation diffusion facilitator family transporter, putative [Candidatus Liberibacter asiaticus str. psy62] (314 letters) >gnl|CDD|162291 TIGR01297, CDF, cation diffusion facilitator family transporter. This model describes a broadly distributed family of transporters, a number of which have been shown to transport divalent cations of cobalt, cadmium and/or zinc. The family has six predicted transmembrane domains. Members of the family are variable in length because of variably sized inserts, often containing low-complexity sequence. Length = 268 Score = 52.6 bits (127), Expect = 1e-07 Identities = 44/217 (20%), Positives = 92/217 (42%), Gaps = 20/217 (9%) Query: 24 FMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQF 83 + + ++ G ++ S +++ D +S + +A++LL ++ R D R F Sbjct: 1 LLMLIKIVGGLLSGSLALLADAIHSLSDVAASAIALLALRISRR---PADER-----HPF 52 Query: 84 GFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGV 143 G E + N + L+ VAL+ +I +I+ +I+ +I + V + L++ + Sbjct: 53 GHGRAEILAALLNGLFLVVVALFILYEAIERLINPEPEIDGGTMLIVAIVGLIVNLILAL 112 Query: 144 YENRCNREIKSDFIALDAKSWIVAGYLL--LAVVIAFLCAMLLRDSAYDWIIPYVDSMVL 201 Y +R + S +AL A + V L + V+I L + W + D + Sbjct: 113 YLHRVGHRLGS--LALRAAALHVLSDALSSVGVLIGALLIY------FGW--HWADPIAA 162 Query: 202 MFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREA 238 + I L IL +A +K + + + D + + Sbjct: 163 LLISLLILYTAFRLLKESINVLLDAAPDEEDLEEIKK 199 >gnl|CDD|181095 PRK07734, motB, flagellar motor protein MotB; Reviewed. Length = 259 Score = 28.2 bits (63), Expect = 3.3 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 191 WIIPYVDSMVLMFICLFILPSAICTMKSATFE 222 W+IPY D + L+ LFI+ A+ ++ +A F+ Sbjct: 19 WLIPYADLLTLLL-ALFIVLFAMSSIDAAKFK 49 >gnl|CDD|162087 TIGR00883, 2A0106, metabolite-proton symporter. This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc. Length = 394 Score = 27.2 bits (61), Expect = 5.1 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Query: 163 SWIVAGY---LLLAVVIAFLCAMLLRDSAYD---WIIPYVDSMVLMFICLFI 208 S+ G LLLA + L + LL D A W IP++ S VL+ I L++ Sbjct: 135 SFQQVGAPVGLLLAALTVLLLSYLLGDDALLEWGWRIPFLVSAVLVLIGLYL 186 >gnl|CDD|131035 TIGR01980, sufB, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. Length = 448 Score = 27.3 bits (61), Expect = 5.2 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Query: 33 GTITNSSSIVFDGFYSYLEAGMTAL-------SLLVAKLIARDVSKVDYR 75 G T SI F G +L+ G + S +++K I++ K YR Sbjct: 300 GAKTEFLSIAFAGKGQHLDTGAKMIHLAPNTSSTIISKSISKGGGKSTYR 349 >gnl|CDD|132708 TIGR03669, urea_ABC_arch, urea ABC transporter, substrate-binding protein, archaeal type. Members of this protein family are identified as the substrate-binding protein of a urea ABC transport system by similarity to a known urea transporter from Corynebacterium glutamicum, operon structure, proximity of its operons to urease (urea-utilization protein) operons, and by Partial Phylogenetic Profiling vs. urea utilization. Length = 374 Score = 27.0 bits (60), Expect = 5.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 233 SQVREALYPIVIRHGFLDFYT 253 S REA+ PI+ R+ L FYT Sbjct: 78 SATREAIRPIIDRNEQLYFYT 98 >gnl|CDD|172956 PRK14483, PRK14483, DhaKLM operon coactivator DhaQ; Provisional. Length = 329 Score = 26.9 bits (60), Expect = 7.4 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Query: 256 TKVGRSRIIEIYLI----VPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKK 311 ++G S I + PA+ P+ + S D EI IG GE + F++ + Sbjct: 174 EQLGLSLTENIATLGVALSPANLPVAGLPSFDLNEDEISYGIGIHGEPGYRKEPFSSSEI 233 Query: 312 WAI 314 AI Sbjct: 234 LAI 236 >gnl|CDD|150465 pfam09801, SYS1, Integral membrane protein S linking to the trans Golgi network. Members of this family are integral membrane proteins involved in protein trafficking between the late Golgi and endosome. They may also serve as a receptor for ADP-ribosylation factor-related protein 1 (ARFRP1). Sys1p is a small integral membrane protein with four predicted transmembrane domains that localizes to the Trans Golgi network TGN in yeast and human cells. Length = 144 Score = 26.8 bits (60), Expect = 7.5 Identities = 7/51 (13%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Query: 169 YLLLAVVIAFLCAMLLRDSAYDWIIPY-----VDSMVLMFICLFILPSAIC 214 YL V++ + + D I + ++ + ++L S + Sbjct: 23 YLTAGVLMYLTALLAGYSFSLDLIFSWESLRFDTTIGWLLGLAWLLNSLVG 73 >gnl|CDD|182959 PRK11097, PRK11097, endo-1,4-D-glucanase; Provisional. Length = 376 Score = 26.8 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Query: 47 YSYLEAG-------MTALSLLVAKLIARD 68 YS LEAG TAL + K IAR+ Sbjct: 123 YSLLEAGRLWKEPRYTALGTALLKRIARE 151 >gnl|CDD|182163 PRK09952, PRK09952, shikimate transporter; Provisional. Length = 438 Score = 26.6 bits (59), Expect = 8.2 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Query: 163 SWIVAGY---LLLAVVIAFLCAMLLRDSAY---DWIIPYVDSMVLMFICLFI 208 S + GY LLL+ + L +M+ D + W IP++ S+VL+ I L++ Sbjct: 164 SGVQVGYGVGLLLSTGLVSLISMMTTDEQFLSWGWRIPFLFSIVLVLIALWV 215 >gnl|CDD|148600 pfam07086, DUF1352, Protein of unknown function (DUF1352). This family consists of several hypothetical eukaryotic proteins of around 190 residues in length. The function of this family is unknown. Length = 183 Score = 26.6 bits (59), Expect = 8.8 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 7/56 (12%) Query: 162 KSWIVAGYLLLAVVIAFLCAMLLRD-------SAYDWIIPYVDSMVLMFICLFILP 210 K I L+ ++ A + L Y W P++ S+ F+ L P Sbjct: 38 KKLIFVHLLIWVLMAAKVGVSHLLLISHLQVPMPYQWEYPWLLSVFPSFLGLLSFP 93 >gnl|CDD|129918 TIGR00838, argH, argininosuccinate lyase. This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens. Length = 455 Score = 26.5 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 216 MKSATFEIFQMTSPDLDSQVREALYP 241 ++ T E Q SP+ D V EAL P Sbjct: 400 LEELTLEELQKFSPEFDEDVYEALDP 425 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.330 0.141 0.428 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,132,491 Number of extensions: 334557 Number of successful extensions: 1014 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1011 Number of HSP's successfully gapped: 42 Length of query: 314 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 221 Effective length of database: 3,984,929 Effective search space: 880669309 Effective search space used: 880669309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 57 (25.7 bits)