HHsearch alignment for GI: 254780495 and conserved domain: KOG0876

>KOG0876 consensus.
Probab=100.00  E-value=0  Score=438.77  Aligned_cols=198  Identities=43%  Similarity=0.751  Sum_probs=170.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH-HHHHHCCCH-HHHHHHHHHHHHHH
Q ss_conf             8779999998655586469999999873288789988999850002332004578-976410111-45543322256899
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEI-IIKSHGSNA-GLFNNASQYYNHNL   79 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~IS~~tl~~Hy~kHh~~YV~~lN~~~~~~~~~~~~l~~~-~~~~~~~~~-~~~nnagg~~nH~l   79 (205)
T Consensus        27 ~~~lp~lp~~~~alep~~s~e~~~lh~~kHh~~yV~~ln~~~~~~~~~~~~~~~~~~~t~~~~~~a~~Fn~~~~~~Nh~f  106 (234)
T KOG0876          27 KATLPDLPYDYDALEPIISAEIMELHWDKHHRTYVNNLNKAVEGLSELYSKLFVELSLTAIAPQPAPKFNGAGHIYNHSF  106 (234)
T ss_pred             EECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHHHCCCCCCCCCCHH
T ss_conf             20179998772216553338888888998999999789998721443123412466674048454320487330125412


Q ss_pred             HHHHCCCCCCCCCHHH-HHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCC--CEEEEEECCCCCCCCCCC---C
Q ss_conf             9850788888764068-999999743089999999999986201434310010341--012344314767540014---7
Q gi|254780495|r   80 FWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLING---A  153 (205)
Q Consensus        80 ff~~l~p~~~~~~p~~-~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~~--~~L~i~~~~n~~~p~~~~---~  153 (205)
T Consensus       107 Fw~~l~p~gg-~~p~~~~L~~aI~~~FGS~ee~~k~~~~~~~~v~GsGW~WLv~~~~~~kL~i~~T~Na~~P~~~~t~~~  185 (234)
T KOG0876         107 FWENLAPPGG-GKPEGEALLKAIDSSFGSLEEFVKELNAAAAAVFGSGWLWLVYNKELKKLFILTTYNAGDPLVWTTGQL  185 (234)
T ss_pred             HHHHCCCCCC-CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEEEEECCCCCCCEECCCCCC
T ss_conf             5653268888-998618899999874057999999999987763278548999817778478982378889755467770


Q ss_pred             CCEEEEEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             853564376877698751774999999986135989999999999973
Q gi|254780495|r  154 IPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA  201 (205)
Q Consensus       154 ~PlL~iDvWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~a~~~  201 (205)
T Consensus       186 vPLl~IDvWeHAYyldY~n~R~~Yi~~~-wd~inW~~v~~R~~~~k~~  232 (234)
T KOG0876         186 VPLLGIDVWEHAYYLDYGNVRAEYIKAI-WDVINWKVVSERFEAAKIQ  232 (234)
T ss_pred             CCEEEEECCHHHHHHHHCCCHHHHHHHH-HHHHCHHHHHHHHHHHHHC
T ss_conf             1057873114676877456668999999-9871679999999876640