HHsearch results for GI: 254780495 and protein with PDBid: 1ix9_A

>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 1en5_A 1en4_A 1i08_A 1en6_A
Probab=100.00  E-value=0  Score=487.63  Aligned_cols=194  Identities=42%  Similarity=0.816  Sum_probs=178.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHH-HHHHHHHHHHHHHH----CCCHHHHHHHHHHHH
Q ss_conf             8779999998655586469999999873288789988999850002-33200457897641----011145543322256
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAE-MLHLSLEEIIIKSH----GSNAGLFNNASQYYN   76 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~IS~~tl~~Hy~kHh~~YV~~lN~~~~~~~-~~~~~l~~~~~~~~----~~~~~~~nnagg~~n   76 (205)
                      .|+||||||+|+||||+||++||++||+|||||||++||++++++. ..+.++.+++....    ..+..++||+|||+|
T Consensus         1 ~f~Lp~Lpy~~~aLeP~is~~t~~~H~~khh~gYV~~lN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~nn~gg~~n   80 (205)
T 1ix9_A            1 SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN   80 (205)
T ss_dssp             CCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHTTCHHHHTSCHHHHTTCGGGSCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             99899999985646562799999999999999999999999873299883777878887752436676899985388872


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCCEEEEEECCCCCCCCC------
Q ss_conf             89998507888887640689999997430899999999999862014343100103410123443147675400------
Q gi|254780495|r   77 HNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------  150 (205)
Q Consensus        77 H~lff~~l~p~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~~~~L~i~~~~n~~~p~~------  150 (205)
                      |+|||++|+|+   ++|++.|+++|+++|||+|+|+++|+++|+++||||||||++++++|+|++|.||++|++      
T Consensus        81 H~~fw~~l~p~---~~p~g~L~~~I~~~FGS~d~fk~~f~~~a~~~fGsGW~wL~~~~~~L~i~~~~n~~~p~~~~~~~~  157 (205)
T 1ix9_A           81 HSLFWKGLKKG---TTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISG  157 (205)
T ss_dssp             HHHHHHTBCSS---CCCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEEETTEEEEEEEETTCCGGGCHHHHS
T ss_pred             HHHHHHHCCCC---CCCCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCEEEEEEECCCCCCCCCCCCCC
T ss_conf             89998212468---999979999999981899999999999986367755999984087035774013477511664346


Q ss_pred             CCCCCEEEEEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             1478535643768776987517749999999861359899999999999
Q gi|254780495|r  151 NGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAM  199 (205)
Q Consensus       151 ~~~~PlL~iDvWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~a~  199 (205)
                      .+.+|||||||||||||+||||+|++||++| |++|||++|++||++|.
T Consensus       158 ~~~~PlL~iD~WEHAYy~dY~n~r~~Yi~~~-~~~inW~~v~~r~~~ak  205 (205)
T 1ix9_A          158 ASGFPIMGLDVWEHAYFLKFQNRRPDYIKEF-WNVVNWDEAAARFAAKK  205 (205)
T ss_dssp             CCSEEEEEEECSGGGTHHHHTTCHHHHHHHH-HHHBCHHHHHHHHHHHC
T ss_pred             CCCCCEEEEHHHHHHHHHHHCCCHHHHHHHH-HHHCCHHHHHHHHHHCC
T ss_conf             5677502203665540987654689999999-97519999999998568