HHsearch results for GI: 254780495 and protein with PDBid: 1ma1_A

>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1
Probab=100.00  E-value=0  Score=485.40  Aligned_cols=195  Identities=36%  Similarity=0.638  Sum_probs=178.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             87799999986555864699999998732887899889998500023320045789764101114554332225689998
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFW   81 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~IS~~tl~~Hy~kHh~~YV~~lN~~~~~~~~~~~~l~~~~~~~~~~~~~~~nnagg~~nH~lff   81 (205)
                      .|+||||||+|++|||+||++||++||+||||+||++||+++++++.+..+..+++...  ....+++|+|||+||+|||
T Consensus         8 ~f~lp~LpY~~~~Lep~iS~~t~~~H~~kHh~~YV~~LN~~~~~~~~~~~~~~~~~~~~--~~~~~~~n~~g~~nH~~fw   85 (205)
T 1ma1_A            8 FYELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIKA--ALKELSFHVGGYVLHLFFW   85 (205)
T ss_dssp             CCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTTCCCCHHH--HHHHHHHHHHHHHHHHHHH
T ss_pred             CEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH--HHHHHHHHHHCCHHHHHHH
T ss_conf             01389998885646461699999999999999999989877565376533462889998--7678888871739999999


Q ss_pred             HHCCCCC-CCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECC--CCEEEEEECCCCCCCCCCCCCCEEE
Q ss_conf             5078888-876406899999974308999999999998620143431001034--1012344314767540014785356
Q gi|254780495|r   82 ACMKKND-GKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILG  158 (205)
Q Consensus        82 ~~l~p~~-~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~--~~~L~i~~~~n~~~p~~~~~~PlL~  158 (205)
                      ++|+|.+ ++++|++.|+++|+++|||+|+||++|+++|.++|||||||||++  +++|.|++++||++|++.+.+||||
T Consensus        86 ~~l~p~~~~~~~p~~~L~~~I~~~FGS~d~fk~~F~~~a~~~fGSGW~wLv~~~~~~~l~i~~~~n~~~p~~~~~~PlL~  165 (205)
T 1ma1_A           86 GNMGPADECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTYCQRTDRLFIMQVEKHNVNVIPHFRILLV  165 (205)
T ss_dssp             HTBCCTTTSCSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHTCSSSEEEEEEEETTTTEEEEEEEETTTBSCCTTCCCSEE
T ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEECCCCCCCCCCCCEEEEE
T ss_conf             22386444689999899999998808999999999998972756853899885367832354036888886779767887


Q ss_pred             EEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             43768776987517749999999861359899999999999
Q gi|254780495|r  159 IDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAM  199 (205)
Q Consensus       159 iDvWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~a~  199 (205)
                      |||||||||+||||+|++||++| |++|||++||+||++|+
T Consensus       166 iDvWEHAYylDY~n~R~~Yv~~~-~~~inW~~v~~r~~~~~  205 (205)
T 1ma1_A          166 LDVWEHAYYIDYRNVRPDYVEAF-WNIVNWKEVEKRFEDIL  205 (205)
T ss_dssp             EECSGGGTHHHHTTCHHHHHHHH-TTTBCHHHHHHHHHTTC
T ss_pred             EEHHHHHHHHHHCCCHHHHHHHH-HHHCCHHHHHHHHHHHC
T ss_conf             31445665887544689999999-98519999999999629