HHsearch results for GI: 254780495 and protein with PDBid: 1my6_A

>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1
Probab=100.00  E-value=0  Score=495.92  Aligned_cols=196  Identities=45%  Similarity=0.898  Sum_probs=184.8

Q ss_pred             CCCCCCCCCCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHH
Q ss_conf             87799999986555864-6999999987328878998899985000233200457897641--01114554332225689
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAGLFNNASQYYNHN   78 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~-IS~~tl~~Hy~kHh~~YV~~lN~~~~~~~~~~~~l~~~~~~~~--~~~~~~~nnagg~~nH~   78 (205)
                      +|+||||||+|++|||+ ||++||++||+|||||||++||+++++++..+.+..+++....  ..+..++||+||++||+
T Consensus         1 ~f~l~~Lpy~y~aLeP~~iS~~t~~~H~~khh~gYV~~lN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~g~~~nh~   80 (199)
T 1my6_A            1 AFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTTYGDAAKVGIFNNAAQVWNHT   80 (199)
T ss_dssp             CCCCCCCSSCTTTTGGGTCCHHHHHHHHHTHHHHHHHHHHHHHTTSGGGGSCHHHHHHHHTTCTTCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99799999883437856719999999999999999999999886678764046778887514445567786116899999


Q ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCCEEEEEECCCCCCCCCCCCCCEEE
Q ss_conf             99850788888764068999999743089999999999986201434310010341012344314767540014785356
Q gi|254780495|r   79 LFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILG  158 (205)
Q Consensus        79 lff~~l~p~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~~~~L~i~~~~n~~~p~~~~~~PlL~  158 (205)
                      |||++|+|++ ++.|++.|.++|+++|||+|+||++|+++|+++|||||||||+++++|+|+++.||++|++.+.+||||
T Consensus        81 ~F~~~l~p~~-~~~p~~~l~~~I~~~FGS~d~fk~~F~~~a~~~~GsGW~wL~~~~~~l~i~~~~~~~~p~~~~~~Pil~  159 (199)
T 1my6_A           81 FFWNSLKPGG-GGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLT  159 (199)
T ss_dssp             HHHHTBCTTC-CSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEEETTEEEEEEEETTCCGGGGTCEEEEE
T ss_pred             HHHHCCCCCC-CCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEECCCCCCCCCCCCCEEE
T ss_conf             9997049999-999898999999987489999999999988607776699999738953377420788985578733477


Q ss_pred             EEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             4376877698751774999999986135989999999999
Q gi|254780495|r  159 IDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA  198 (205)
Q Consensus       159 iDvWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~a  198 (205)
                      |||||||||+||||+|++||++||+++|||++||+||++|
T Consensus       160 lDvWEHAYyldY~n~r~~Yi~~f~~~~inW~~v~~r~~~A  199 (199)
T 1my6_A          160 IDVWEHAYYLDYQNRRPDFIDNFLNQLVNWDFVAKNLAAA  199 (199)
T ss_dssp             EECSGGGTHHHHTTCHHHHHHHHHHHTBCHHHHHHHHHC-
T ss_pred             EEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             6332678698864368999999999664999999999719