HHsearch results for GI: 254780495 and protein with PDBid: 2nyb_A

>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A
Probab=100.00  E-value=0  Score=480.77  Aligned_cols=191  Identities=45%  Similarity=0.861  Sum_probs=179.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             87799999986555864699999998732887899889998500023320045789764101114554332225689998
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFW   81 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~IS~~tl~~Hy~kHh~~YV~~lN~~~~~~~~~~~~l~~~~~~~~~~~~~~~nnagg~~nH~lff   81 (205)
                      .|+||||||+|++|||+||++||++||+|||++||+++|+++++++.++.++.+++..   .+..++||+|||+||+|||
T Consensus         1 sf~Lp~LpY~~~~LeP~iS~~~~~~H~~kh~~~YV~~lN~~~~~~~~~~~~~~~~~~~---~~~~~~n~~gg~~nH~~f~   77 (192)
T 2nyb_A            1 SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRS---SEGGVFNNAAEVWNHTFYW   77 (192)
T ss_dssp             CCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHTTSTTTTCCHHHHHTT---CCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH---HHHHCCCHHHHHHHHHHHH
T ss_conf             9979999898564667379999999999999999999999965057626888999976---3121241066799999998


Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECC-CCEEEEEECCCCCCCCCCCCCCEEEEE
Q ss_conf             5078888876406899999974308999999999998620143431001034-101234431476754001478535643
Q gi|254780495|r   82 ACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGID  160 (205)
Q Consensus        82 ~~l~p~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~-~~~L~i~~~~n~~~p~~~~~~PlL~iD  160 (205)
                      +||+|++ ++.|++.|+++|+++|||+|+||++|+++|+++|||||+||+.+ +++|.|+++.||++|++.+.+||||||
T Consensus        78 ~~l~p~~-~~~p~g~L~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wL~~~~~~~l~~~~~~n~~~p~~~~~~PiL~iD  156 (192)
T 2nyb_A           78 NCLAPNA-GGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVD  156 (192)
T ss_dssp             HTBCTTC-CSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEECTTSCEEEEEEETTCCGGGSSCEEEEEEE
T ss_pred             HHCCCCC-CCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEECCCCCCCCCCCEEEEEEE
T ss_conf             0218999-999898999999998299999999999998467866799988704674589862378787557972179752


Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             7687769875177499999998613598999999999
Q gi|254780495|r  161 VWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYET  197 (205)
Q Consensus       161 vWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~  197 (205)
                      |||||||+||||+|++||++| |++|||++||+||.+
T Consensus       157 vWEHAYyldY~n~R~~Yi~~f-~~~iNW~~v~~R~~a  192 (192)
T 2nyb_A          157 VWEHAYYIDYRNARPGYLEHF-WALVNWEFVAKNLAA  192 (192)
T ss_dssp             CSGGGTHHHHTTCHHHHHHHH-HTTBCHHHHHHHHHC
T ss_pred             HHHHHHHHHHCCCHHHHHHHH-HHHCCHHHHHHHHCC
T ss_conf             677887988554799999999-963199999876359