BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780495|ref|YP_003064908.1| superoxide dismutase
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780495|ref|YP_003064908.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040172|gb|ACT56968.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 205

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS
Sbjct: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS
Sbjct: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES
Sbjct: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180

Query: 181 FITNLVNWEYVCERYETAMLAQKVT 205
           FITNLVNWEYVCERYETAMLAQKVT
Sbjct: 181 FITNLVNWEYVCERYETAMLAQKVT 205


>gi|315122318|ref|YP_004062807.1| superoxide dismutase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495720|gb|ADR52319.1| superoxide dismutase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 206

 Score =  348 bits (892), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 180/203 (88%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD LSPYMS ETL+YHH VHHK YADNALKLASDAEMLH  LEEIIIKS
Sbjct: 1   MAFELPNLPYDYDALSPYMSPETLKYHHGVHHKTYADNALKLASDAEMLHSPLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +GSNAGLFNNASQYYNHNLFW CMKKN G  K+PQ LSDAI+ NFGS+EKFKSD ITAA 
Sbjct: 61  YGSNAGLFNNASQYYNHNLFWLCMKKNGGGEKIPQVLSDAINSNFGSYEKFKSDFITAAC 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQF SGW WLSVKNGKLEISKTQNAENPLINGA PILGIDVWEHAYYLDF+Y+R+ Y+E+
Sbjct: 121 TQFASGWTWLSVKNGKLEISKTQNAENPLINGATPILGIDVWEHAYYLDFQYKRSSYVEN 180

Query: 181 FITNLVNWEYVCERYETAMLAQK 203
           F+++L+NWEYV ERYE+ +L QK
Sbjct: 181 FVSHLINWEYVHERYESTILTQK 203


>gi|15888217|ref|NP_353898.1| superoxide dismutase [Agrobacterium tumefaciens str. C58]
 gi|15155867|gb|AAK86683.1| superoxide dismutase [Agrobacterium tumefaciens str. C58]
          Length = 200

 Score =  270 bits (690), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 154/198 (77%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+PYMS+ETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK+ G  K+P  L  A   + G ++KFK+D I A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWMKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW+YV ERYE A
Sbjct: 181 FVDNLINWDYVLERYEAA 198


>gi|325292253|ref|YP_004278117.1| Superoxide dismutase [Agrobacterium sp. H13-3]
 gi|325060106|gb|ADY63797.1| Superoxide dismutase [Agrobacterium sp. H13-3]
          Length = 200

 Score =  267 bits (683), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 121/199 (60%), Positives = 154/199 (77%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+PYMS+ETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  +KK+ G  K+P  L  A   + G ++KFK+D I A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWLKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NW+YV ERYE A 
Sbjct: 181 FVDNLINWDYVLERYEAAF 199


>gi|222085262|ref|YP_002543792.1| superoxide dismutase protein [Agrobacterium radiobacter K84]
 gi|221722710|gb|ACM25866.1| superoxide dismutase protein [Agrobacterium radiobacter K84]
          Length = 200

 Score =  267 bits (682), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD LSP+MS+ETLEYHHD HHK Y DN  KLA++A +  LSLEEI+ KS
Sbjct: 1   MAFELPELPYDYDALSPFMSRETLEYHHDKHHKAYVDNGNKLAAEAGLSDLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI +L+NW+YV ERYE A
Sbjct: 181 FIDSLINWDYVLERYEAA 198


>gi|116251108|ref|YP_766946.1| superoxide dismutase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255756|emb|CAK06837.1| putative superoxide dismutase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 200

 Score =  264 bits (675), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 153/198 (77%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D  TA +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFATAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW+YV ERYE A
Sbjct: 181 FVDSLINWDYVLERYEAA 198


>gi|86356843|ref|YP_468735.1| superoxide dismutase protein [Rhizobium etli CFN 42]
 gi|86280945|gb|ABC90008.1| superoxide dismutase protein [Rhizobium etli CFN 42]
          Length = 200

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLADLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI +L+NW+YV ERYE A
Sbjct: 181 FIDSLINWDYVLERYEEA 198


>gi|190890912|ref|YP_001977454.1| superoxide dismutase [Rhizobium etli CIAT 652]
 gi|190696191|gb|ACE90276.1| superoxide dismutase protein [Rhizobium etli CIAT 652]
          Length = 200

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI +L+NW+YV ERYE A
Sbjct: 181 FIDSLINWDYVLERYEEA 198


>gi|241203704|ref|YP_002974800.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857594|gb|ACS55261.1| Superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 200

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW+YV ERYE A
Sbjct: 181 FVDSLINWDYVLERYEEA 198


>gi|327192626|gb|EGE59569.1| Superoxide dismutase [Rhizobium etli CNPAF512]
          Length = 200

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI +L+NW+YV ERYE A
Sbjct: 181 FIDSLINWDYVLERYEEA 198


>gi|209548448|ref|YP_002280365.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|218674122|ref|ZP_03523791.1| Superoxide dismutase [Rhizobium etli GR56]
 gi|209534204|gb|ACI54139.1| Superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 200

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW+YV ERYE A
Sbjct: 181 FVDSLINWDYVLERYEEA 198


>gi|260462419|ref|ZP_05810627.1| Superoxide dismutase [Mesorhizobium opportunistum WSM2075]
 gi|259031913|gb|EEW33181.1| Superoxide dismutase [Mesorhizobium opportunistum WSM2075]
          Length = 199

 Score =  261 bits (666), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A +  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A+D + G ++KFK+D I A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW++V E YE A
Sbjct: 181 FVDSLINWDHVLEMYEKA 198


>gi|319784588|ref|YP_004144064.1| Manganese/iron superoxide dismutase-like protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317170476|gb|ADV14014.1| Manganese/iron superoxide dismutase-like protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 199

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 152/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A +  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A+D + G ++KFK+D I A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW++V E YE A
Sbjct: 181 FVDSLINWDHVLELYEKA 198


>gi|13476344|ref|NP_107914.1| superoxide dismutase [Mesorhizobium loti MAFF303099]
 gi|14027105|dbj|BAB54059.1| superoxide dismutase [Mesorhizobium loti MAFF303099]
          Length = 199

 Score =  260 bits (664), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 151/198 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A M  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGMGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A D + G ++KFK+D + A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPAALQKAFDSDLGGYDKFKADFVAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW++V E YE A
Sbjct: 181 FVDSLINWDHVLELYEKA 198


>gi|307304303|ref|ZP_07584055.1| Superoxide dismutase [Sinorhizobium meliloti BL225C]
 gi|307321702|ref|ZP_07601092.1| Superoxide dismutase [Sinorhizobium meliloti AK83]
 gi|306892666|gb|EFN23462.1| Superoxide dismutase [Sinorhizobium meliloti AK83]
 gi|306902771|gb|EFN33364.1| Superoxide dismutase [Sinorhizobium meliloti BL225C]
          Length = 200

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 147/198 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D I A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW+YV E YE A
Sbjct: 181 FVDNLINWDYVLELYEAA 198


>gi|227821306|ref|YP_002825276.1| superoxide dismutase contains Mn [Sinorhizobium fredii NGR234]
 gi|227340305|gb|ACP24523.1| superoxide dismutase contains Mn [Sinorhizobium fredii NGR234]
          Length = 200

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/199 (58%), Positives = 149/199 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A + +LS+EEI+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSNLSVEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  +KK  G   +P  L  AI  + G ++KF++D I A +
Sbjct: 61  YGTNQPLFNNAGQHYNHIHFWKWLKKGGGGTSLPGKLDAAIKSDLGGYDKFRTDFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NW+YV E YE A+
Sbjct: 181 FVDNLINWDYVLEMYEAAV 199


>gi|150395811|ref|YP_001326278.1| superoxide dismutase [Sinorhizobium medicae WSM419]
 gi|150027326|gb|ABR59443.1| Superoxide dismutase [Sinorhizobium medicae WSM419]
          Length = 200

 Score =  256 bits (653), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 147/198 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D + A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFVAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW+YV E YE A
Sbjct: 181 FVDNLINWDYVLELYEAA 198


>gi|304393547|ref|ZP_07375475.1| superoxide dismutase (Fe) [Ahrensia sp. R2A130]
 gi|303294554|gb|EFL88926.1| superoxide dismutase (Fe) [Ahrensia sp. R2A130]
          Length = 199

 Score =  255 bits (652), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 146/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  YMS ETLEYHHD HHK Y DN  KLA +A M   SLEEI+  S
Sbjct: 1   MAFTLPELPYAYDALGDYMSAETLEYHHDKHHKAYVDNGNKLAEEAGMADKSLEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HG+NAGLFNNA+Q++NH  FW  M  N G  K+P  L  AI+ + G ++KFK+D + A +
Sbjct: 61  HGTNAGLFNNAAQHFNHEHFWHWMAPNGGGKKMPSELEKAINGDLGGYDKFKADFMAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKLEISKT N ENPL++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWCWVSVKDGKLEISKTPNGENPLVHGATPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW+YV E Y  A
Sbjct: 181 FVDNLINWDYVAELYSKA 198


>gi|115525836|ref|YP_782747.1| superoxide dismutase [Rhodopseudomonas palustris BisA53]
 gi|115519783|gb|ABJ07767.1| Superoxide dismutase [Rhodopseudomonas palustris BisA53]
          Length = 198

 Score =  254 bits (649), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 142/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALAPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G  K+P AL+  ID++ G FEKFK+D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHMHFWKWMKPNGGGDKLPGALAKKIDEDLGGFEKFKTDFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISK+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKSANGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ N++NWEYV E Y  A
Sbjct: 181 FVENMINWEYVEEMYSKA 198


>gi|299132184|ref|ZP_07025379.1| Manganese/iron superoxide dismutase-like protein [Afipia sp. 1NLS2]
 gi|298592321|gb|EFI52521.1| Manganese/iron superoxide dismutase-like protein [Afipia sp. 1NLS2]
          Length = 199

 Score =  254 bits (648), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 141/193 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPDLPYAHDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH LFW  MK   G  K+P  L+  ID++ G FEKFK+D   A +
Sbjct: 61  FGKNAGLFNNAAQHYNHTLFWKMMKPKGGGTKLPGKLAKKIDEDLGGFEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLE++KT N ENPL++G  PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEVTKTPNGENPLVHGGSPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCE 193
           FI NLVNWEYV E
Sbjct: 181 FIENLVNWEYVEE 193


>gi|15964726|ref|NP_385079.1| superoxide dismutase Fe protein [Sinorhizobium meliloti 1021]
 gi|7388259|sp|Q9XD74|SODF_RHIME RecName: Full=Superoxide dismutase [Mn]
 gi|5163197|gb|AAD40579.1| superoxide dismutase [Sinorhizobium meliloti]
 gi|15073904|emb|CAC45545.1| Probable superoxide dismutase FE protein [Sinorhizobium meliloti
           1021]
          Length = 200

 Score =  254 bits (648), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 146/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D   A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFSAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW+YV E YE A
Sbjct: 181 FVDNLINWDYVLELYEAA 198


>gi|209884047|ref|YP_002287904.1| superoxide dismutase [Oligotropha carboxidovorans OM5]
 gi|209872243|gb|ACI92039.1| superoxide dismutase [Oligotropha carboxidovorans OM5]
          Length = 199

 Score =  253 bits (645), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/198 (58%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L PYMSKETLEYHHD HH+ Y  N   L    E    SLE+I+  S
Sbjct: 1   MTFTLPDLPYAHDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEDIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+Q+YNH LFW  MK N G  K+P  L+  ID++ G FEKFK+D   A +
Sbjct: 61  FGKNQGLFNNAAQHYNHTLFWKWMKPNGGGSKLPGKLAKKIDEDLGGFEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLE+SKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEVSKTPNGENPLVHGASPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNWEYV E +  A
Sbjct: 181 FVDHLVNWEYVEELFSKA 198


>gi|222147937|ref|YP_002548894.1| superoxide dismutase [Agrobacterium vitis S4]
 gi|221734925|gb|ACM35888.1| superoxide dismutase [Agrobacterium vitis S4]
          Length = 200

 Score =  252 bits (643), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P+MS ETLE+HHD HH+ Y  N   L  D+ +  LSLEE++ +S
Sbjct: 1   MAFELPALPYAYDALGPFMSAETLEFHHDKHHQAYVTNGNNLLKDSGLEGLSLEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G NAGLFNNA Q+YNH  FW  +KK+ G  K+P  L  AI  + G ++KFK+D I A +
Sbjct: 61  YGKNAGLFNNAGQHYNHVHFWNWLKKDGGGTKLPGKLEAAIASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLSVK+GKLEISKT N ENPLI+GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLSVKDGKLEISKTPNGENPLIHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW+YV E YE A
Sbjct: 181 FVDSLINWDYVAELYEAA 198


>gi|17987650|ref|NP_540284.1| superoxide dismutase (Mn) [Brucella melitensis bv. 1 str. 16M]
 gi|17983362|gb|AAL52548.1| superoxide dismutase (mn) [Brucella melitensis bv. 1 str. 16M]
          Length = 243

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 45  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 104

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 105 FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 164

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 165 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 224

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 225 FVDSLVNWDYVLEMYEKA 242


>gi|326408590|gb|ADZ65655.1| superoxide dismutase [Brucella melitensis M28]
 gi|326538310|gb|ADZ86525.1| superoxide dismutase, Fe-Mn family protein [Brucella melitensis
           M5-90]
          Length = 266

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|225852095|ref|YP_002732328.1| superoxide dismutase [Brucella melitensis ATCC 23457]
 gi|256044276|ref|ZP_05447180.1| superoxide dismutase (Mn) [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113109|ref|ZP_05453986.1| superoxide dismutase (Mn) [Brucella melitensis bv. 3 str. Ether]
 gi|256264394|ref|ZP_05466926.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260563629|ref|ZP_05834115.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 1
           str. 16M]
 gi|265990686|ref|ZP_06103243.1| superoxide dismutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994518|ref|ZP_06107075.1| superoxide dismutase [Brucella melitensis bv. 3 str. Ether]
 gi|225640460|gb|ACO00374.1| superoxide dismutase, Fe-Mn family protein [Brucella melitensis
           ATCC 23457]
 gi|260153645|gb|EEW88737.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 1
           str. 16M]
 gi|262765631|gb|EEZ11420.1| superoxide dismutase [Brucella melitensis bv. 3 str. Ether]
 gi|263001470|gb|EEZ14045.1| superoxide dismutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094689|gb|EEZ18468.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 2
           str. 63/9]
          Length = 199

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|316935145|ref|YP_004110127.1| manganese/iron superoxide dismutase-like protein [Rhodopseudomonas
           palustris DX-1]
 gi|315602859|gb|ADU45394.1| Manganese/iron superoxide dismutase-like protein [Rhodopseudomonas
           palustris DX-1]
          Length = 198

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/198 (58%), Positives = 142/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q+YNH  FW  MK N G  K+P AL+  ID++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHYNHIHFWKWMKPNGGGTKLPGALAKKIDEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ +R  Y+++
Sbjct: 121 GQFGSGWAWLAVKDGKLEISKTSNGENPLVHGATPILGVDVWEHSYYIDYRNKRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI NL+NWEYV E Y  A
Sbjct: 181 FIENLINWEYVEEMYAKA 198


>gi|153010027|ref|YP_001371242.1| superoxide dismutase [Ochrobactrum anthropi ATCC 49188]
 gi|151561915|gb|ABS15413.1| Superoxide dismutase [Ochrobactrum anthropi ATCC 49188]
          Length = 198

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 146/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLE HHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLELHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N GLFNNA Q+YNH LFW  MKKN G  K+P  L  AI+ + G ++KF++D I A  
Sbjct: 61  YGKNQGLFNNAGQHYNHILFWKWMKKNGGGKKLPGKLEKAIESDLGGYDKFRADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGATPILGVDVWEHSYYVDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWE+V E YE A
Sbjct: 181 FVDSLINWEFVEELYEKA 198


>gi|146343080|ref|YP_001208128.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           ORS278]
 gi|146195886|emb|CAL79913.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           ORS278]
          Length = 199

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  YMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPPLPYAYDALGAYMSKETLEYHHDKHHQAYVTNGNNLIKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA +FNNA Q+YNH  FW+ MK N G  K+P AL   I+++ G +EKFK+D I A  
Sbjct: 61  FGKNAPIFNNAGQHYNHIHFWSWMKPNGGGTKLPGALEKKINEDLGGYEKFKTDFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N E+PL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTANGESPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVENLINWEYVEELYSKAV 199


>gi|225627074|ref|ZP_03785112.1| superoxide dismutase, Fe-Mn family protein [Brucella ceti str.
           Cudo]
 gi|225617909|gb|EEH14953.1| superoxide dismutase, Fe-Mn family protein [Brucella ceti str.
           Cudo]
          Length = 266

 Score =  247 bits (631), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 SQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|260168327|ref|ZP_05755138.1| superoxide dismutase (Mn) [Brucella sp. F5/99]
 gi|261757787|ref|ZP_06001496.1| manganese and iron superoxide dismutase [Brucella sp. F5/99]
 gi|261737771|gb|EEY25767.1| manganese and iron superoxide dismutase [Brucella sp. F5/99]
          Length = 199

 Score =  247 bits (631), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 SQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|39934763|ref|NP_947039.1| superoxide dismutase [Rhodopseudomonas palustris CGA009]
 gi|39648613|emb|CAE27134.1| superoxide dismutase [Rhodopseudomonas palustris CGA009]
          Length = 198

 Score =  247 bits (630), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 141/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q++NH  FW  MK N G  K+P AL   I+++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHFNHIHFWKWMKPNGGGSKLPGALEKKINEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWEYV E Y  A
Sbjct: 181 FVDSLINWEYVEELYSKA 198


>gi|23501455|ref|NP_697582.1| Fe/Mn family superoxide dismutase [Brucella suis 1330]
 gi|161618540|ref|YP_001592427.1| superoxide dismutase (Fe) [Brucella canis ATCC 23365]
 gi|163842843|ref|YP_001627247.1| superoxide dismutase (Fe) [Brucella suis ATCC 23445]
 gi|254703907|ref|ZP_05165735.1| superoxide dismutase (Fe) [Brucella suis bv. 3 str. 686]
 gi|260566845|ref|ZP_05837315.1| manganese and iron superoxide dismutase [Brucella suis bv. 4 str.
           40]
 gi|261754557|ref|ZP_05998266.1| superoxide dismutase [Brucella suis bv. 3 str. 686]
 gi|23347358|gb|AAN29497.1| superoxide dismutase, Fe-Mn family [Brucella suis 1330]
 gi|161335351|gb|ABX61656.1| Superoxide dismutase (Fe) [Brucella canis ATCC 23365]
 gi|163673566|gb|ABY37677.1| Superoxide dismutase (Fe) [Brucella suis ATCC 23445]
 gi|260156363|gb|EEW91443.1| manganese and iron superoxide dismutase [Brucella suis bv. 4 str.
           40]
 gi|261744310|gb|EEY32236.1| superoxide dismutase [Brucella suis bv. 3 str. 686]
          Length = 199

 Score =  247 bits (630), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLAGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|86748800|ref|YP_485296.1| superoxide dismutase [Rhodopseudomonas palustris HaA2]
 gi|86571828|gb|ABD06385.1| Superoxide dismutase [Rhodopseudomonas palustris HaA2]
          Length = 199

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 141/199 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q++NH  FW  MK N G  K+P AL   I+++ G  +KFK+D   A +
Sbjct: 61  FGKNAPLFNNAGQHFNHIHFWKWMKPNGGGTKLPGALEKKINEDLGGLDKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTANGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVDNLINWEYVEELYSKAV 199


>gi|148559931|ref|YP_001258565.1| Fe/Mn family superoxide dismutase [Brucella ovis ATCC 25840]
 gi|254701362|ref|ZP_05163190.1| superoxide dismutase (Mn) [Brucella suis bv. 5 str. 513]
 gi|254709701|ref|ZP_05171512.1| superoxide dismutase (Mn) [Brucella pinnipedialis B2/94]
 gi|254712877|ref|ZP_05174688.1| superoxide dismutase (Mn) [Brucella ceti M644/93/1]
 gi|254716769|ref|ZP_05178580.1| superoxide dismutase (Mn) [Brucella ceti M13/05/1]
 gi|254718718|ref|ZP_05180529.1| superoxide dismutase (Mn) [Brucella sp. 83/13]
 gi|256031192|ref|ZP_05444806.1| superoxide dismutase (Mn) [Brucella pinnipedialis M292/94/1]
 gi|256159289|ref|ZP_05457084.1| superoxide dismutase (Mn) [Brucella ceti M490/95/1]
 gi|256254599|ref|ZP_05460135.1| superoxide dismutase (Mn) [Brucella ceti B1/94]
 gi|256369007|ref|YP_003106513.1| superoxide dismutase, Fe-Mn family [Brucella microti CCM 4915]
 gi|261218565|ref|ZP_05932846.1| superoxide dismutase [Brucella ceti M13/05/1]
 gi|261221773|ref|ZP_05936054.1| superoxide dismutase [Brucella ceti B1/94]
 gi|261317231|ref|ZP_05956428.1| superoxide dismutase [Brucella pinnipedialis B2/94]
 gi|261320586|ref|ZP_05959783.1| superoxide dismutase [Brucella ceti M644/93/1]
 gi|261751899|ref|ZP_05995608.1| superoxide dismutase [Brucella suis bv. 5 str. 513]
 gi|265983693|ref|ZP_06096428.1| superoxide dismutase [Brucella sp. 83/13]
 gi|265988270|ref|ZP_06100827.1| superoxide dismutase [Brucella pinnipedialis M292/94/1]
 gi|265997737|ref|ZP_06110294.1| superoxide dismutase [Brucella ceti M490/95/1]
 gi|294851937|ref|ZP_06792610.1| superoxide dismutase [Brucella sp. NVSL 07-0026]
 gi|306838695|ref|ZP_07471530.1| Fe/Mn family superoxide dismutase [Brucella sp. NF 2653]
 gi|306842163|ref|ZP_07474832.1| Fe/Mn family superoxide dismutase [Brucella sp. BO2]
 gi|148371188|gb|ABQ61167.1| superoxide dismutase, Fe-Mn family [Brucella ovis ATCC 25840]
 gi|255999165|gb|ACU47564.1| superoxide dismutase, Fe-Mn family [Brucella microti CCM 4915]
 gi|260920357|gb|EEX87010.1| superoxide dismutase [Brucella ceti B1/94]
 gi|260923654|gb|EEX90222.1| superoxide dismutase [Brucella ceti M13/05/1]
 gi|261293276|gb|EEX96772.1| superoxide dismutase [Brucella ceti M644/93/1]
 gi|261296454|gb|EEX99950.1| superoxide dismutase [Brucella pinnipedialis B2/94]
 gi|261741652|gb|EEY29578.1| superoxide dismutase [Brucella suis bv. 5 str. 513]
 gi|262552205|gb|EEZ08195.1| superoxide dismutase [Brucella ceti M490/95/1]
 gi|264660467|gb|EEZ30728.1| superoxide dismutase [Brucella pinnipedialis M292/94/1]
 gi|264662285|gb|EEZ32546.1| superoxide dismutase [Brucella sp. 83/13]
 gi|294820526|gb|EFG37525.1| superoxide dismutase [Brucella sp. NVSL 07-0026]
 gi|306287750|gb|EFM59181.1| Fe/Mn family superoxide dismutase [Brucella sp. BO2]
 gi|306406182|gb|EFM62426.1| Fe/Mn family superoxide dismutase [Brucella sp. NF 2653]
          Length = 199

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|148252893|ref|YP_001237478.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           BTAi1]
 gi|146405066|gb|ABQ33572.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           BTAi1]
          Length = 199

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 140/199 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PYMSKETLEYHHD HH+ Y  N        E    SLEEI+  S
Sbjct: 1   MTFTLPPLPYAYEALGPYMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  +FNNA Q++NH  FW+ +K N G  K+P AL   ID++ G +EKFK+D I A  
Sbjct: 61  FGKNPAVFNNAGQHFNHIHFWSWLKPNGGGTKLPGALEKKIDEDLGGYEKFKADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTANGENPLVYGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVENLINWEYVEELYSKAV 199


>gi|240850110|ref|YP_002971503.1| superoxide dismutase [Bartonella grahamii as4aup]
 gi|240267233|gb|ACS50821.1| superoxide dismutase [Bartonella grahamii as4aup]
          Length = 200

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 147/196 (75%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD LSPYMS+ETLEYHHD HH  Y +N      +  + + SLE+I+ KS
Sbjct: 1   MAFELPPLPYDYDALSPYMSRETLEYHHDKHHLAYLNNTNNFVKELGLENESLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK+ G  K+P+ L+ AID + G ++KF++D I AAS
Sbjct: 61  FGKNIGLFNNAAQYYNHNHFWLWMKKDGGGQKLPEKLAKAIDADLGGYDKFRADFIAAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+ES
Sbjct: 121 AQFGSGWAWVAVKDGKLEIMKTPNGENPLIHNARPILGVDVWEHSYYIDYRNARPKYLES 180

Query: 181 FITNLVNWEYVCERYE 196
           F+ +L+NW+YV + YE
Sbjct: 181 FVDHLINWDYVLKLYE 196


>gi|91978086|ref|YP_570745.1| superoxide dismutase [Rhodopseudomonas palustris BisB5]
 gi|91684542|gb|ABE40844.1| Superoxide dismutase [Rhodopseudomonas palustris BisB5]
          Length = 198

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 138/195 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q++NH  FW  MK N G  K+P AL   I+++ G  EKFK+D   A +
Sbjct: 61  FGKNAALFNNAGQHFNHIHFWKWMKPNGGGTKLPGALEKKINEDLGGLEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GK EISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKFEISKTANGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERY 195
           F+ NL+NWEYV E Y
Sbjct: 181 FVDNLINWEYVEELY 195


>gi|192290286|ref|YP_001990891.1| Superoxide dismutase [Rhodopseudomonas palustris TIE-1]
 gi|192284035|gb|ACF00416.1| Superoxide dismutase [Rhodopseudomonas palustris TIE-1]
          Length = 198

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q++NH  FW  MK N G  K+P  L   I+++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHFNHIHFWKWMKPNGGGSKLPGVLEKKINEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWEYV E Y  A
Sbjct: 181 FVDSLINWEYVEELYSKA 198


>gi|256060699|ref|ZP_05450863.1| superoxide dismutase (Mn) [Brucella neotomae 5K33]
 gi|261324689|ref|ZP_05963886.1| superoxide dismutase [Brucella neotomae 5K33]
 gi|261300669|gb|EEY04166.1| superoxide dismutase [Brucella neotomae 5K33]
          Length = 199

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G + KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYNKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|62289534|ref|YP_221327.1| Fe-Mn superoxide dismutase [Brucella abortus bv. 1 str. 9-941]
 gi|82699463|ref|YP_414037.1| manganese and iron superoxide dismutase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023791|ref|YP_001934559.1| Manganese and iron superoxide dismutase [Brucella abortus S19]
 gi|254688852|ref|ZP_05152106.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 6
           str. 870]
 gi|254693334|ref|ZP_05155162.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 3
           str. Tulya]
 gi|254696982|ref|ZP_05158810.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729884|ref|ZP_05188462.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 4
           str. 292]
 gi|256257100|ref|ZP_05462636.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 9
           str. C68]
 gi|260545710|ref|ZP_05821451.1| manganese and iron superoxide dismutase [Brucella abortus NCTC
           8038]
 gi|260754335|ref|ZP_05866683.1| superoxide dismutase [Brucella abortus bv. 6 str. 870]
 gi|260757554|ref|ZP_05869902.1| superoxide dismutase [Brucella abortus bv. 4 str. 292]
 gi|260761379|ref|ZP_05873722.1| superoxide dismutase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883360|ref|ZP_05894974.1| superoxide dismutase [Brucella abortus bv. 9 str. C68]
 gi|261213581|ref|ZP_05927862.1| superoxide dismutase [Brucella abortus bv. 3 str. Tulya]
 gi|297247947|ref|ZP_06931665.1| Fe-Mn family superoxide dismutase [Brucella abortus bv. 5 str.
           B3196]
 gi|62195666|gb|AAX73966.1| Fe-Mn superoxide dismutase [Brucella abortus bv. 1 str. 9-941]
 gi|82615564|emb|CAJ10547.1| Manganese and iron superoxide dismutase:ATP/GTP-binding site motif
           A (P-loop) [Brucella melitensis biovar Abortus 2308]
 gi|189019363|gb|ACD72085.1| Manganese and iron superoxide dismutase [Brucella abortus S19]
 gi|260097117|gb|EEW80992.1| manganese and iron superoxide dismutase [Brucella abortus NCTC
           8038]
 gi|260667872|gb|EEX54812.1| superoxide dismutase [Brucella abortus bv. 4 str. 292]
 gi|260671811|gb|EEX58632.1| superoxide dismutase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674443|gb|EEX61264.1| superoxide dismutase [Brucella abortus bv. 6 str. 870]
 gi|260872888|gb|EEX79957.1| superoxide dismutase [Brucella abortus bv. 9 str. C68]
 gi|260915188|gb|EEX82049.1| superoxide dismutase [Brucella abortus bv. 3 str. Tulya]
 gi|297175116|gb|EFH34463.1| Fe-Mn family superoxide dismutase [Brucella abortus bv. 5 str.
           B3196]
          Length = 199

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   S EEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|328544593|ref|YP_004304702.1| Superoxide dismutase [polymorphum gilvum SL003B-26A1]
 gi|326414335|gb|ADZ71398.1| Superoxide dismutase [Polymorphum gilvum SL003B-26A1]
          Length = 199

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L PYMS ETLEYHHD HH  Y  N   L  D+ +   S+EE++ +S
Sbjct: 1   MSFQLPDLPYAYDALGPYMSAETLEYHHDKHHLAYVSNGNNLLKDSGLEGKSVEEVVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA Q+YNH  FW  MK N G  K+P AL+  ID + G ++KF++D I A  
Sbjct: 61  FGKNPGLFNNAGQHYNHIHFWKWMKPNGGGTKLPGALASKIDSDLGGYDKFRADFINAGI 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL++K+GKL I KT N ENPL++GA P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLALKDGKLAIMKTPNGENPLVHGAAPLLGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E YE A
Sbjct: 181 FVDNLVNWDYVLEMYEAA 198


>gi|237815031|ref|ZP_04594029.1| Superoxide dismutase [Fe] [Brucella abortus str. 2308 A]
 gi|237789868|gb|EEP64078.1| Superoxide dismutase [Fe] [Brucella abortus str. 2308 A]
          Length = 266

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   S EEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|306845181|ref|ZP_07477757.1| Fe/Mn family superoxide dismutase [Brucella sp. BO1]
 gi|306274340|gb|EFM56147.1| Fe/Mn family superoxide dismutase [Brucella sp. BO1]
          Length = 199

 Score =  244 bits (622), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y  L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYGALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|220925732|ref|YP_002501034.1| manganese and iron superoxide dismutase [Methylobacterium nodulans
           ORS 2060]
 gi|219950339|gb|ACL60731.1| manganese and iron superoxide dismutase [Methylobacterium nodulans
           ORS 2060]
          Length = 199

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 141/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL   +E+   S+EE++  S
Sbjct: 1   MAFTLPELPYAYDALQPYMSKETLEFHHDKHHKAYVDTGNKLLEGSELAGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G G +P AL   I  + G  +KFK+D I A  
Sbjct: 61  YGQNQALFNNAGQHYNHIHFWQWMKPNGG-GAIPGALEKKIAQDLGGTDKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WL+VKNGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 SQFGSGWAWLAVKNGKLEIMKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWE+V + Y  A
Sbjct: 180 FIENLVNWEHVEKMYAEA 197


>gi|163867903|ref|YP_001609107.1| hypothetical protein Btr_0682 [Bartonella tribocorum CIP 105476]
 gi|161017554|emb|CAK01112.1| Superoxide dismutase [Bartonella tribocorum CIP 105476]
          Length = 200

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/200 (56%), Positives = 145/200 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YD LSPYMS+ETLEYHHD HH  Y  N   L  DA + + SLEEI+  S
Sbjct: 1   MAFELAALPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNLIKDAGLENESLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK+ G  K+P+ L+ AI+ + G ++KF++D I A  
Sbjct: 61  FGKNIGLFNNAAQYYNHNHFWNWMKKDGGGQKLPEKLAKAIESDLGGYDKFRADFIAAGG 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VKNGKLEI KT N ENPL++ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVAVKNGKLEIMKTLNGENPLVHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV + YE   L
Sbjct: 181 FVDHLINWDYVLKLYEDCGL 200


>gi|170743405|ref|YP_001772060.1| superoxide dismutase [Methylobacterium sp. 4-46]
 gi|168197679|gb|ACA19626.1| Superoxide dismutase [Methylobacterium sp. 4-46]
          Length = 199

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 143/199 (71%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL   +E+   S+EE++  S
Sbjct: 1   MAFTLPELPYAYDALQPYMSKETLEFHHDKHHKAYVDTGNKLLEGSELAGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G G +P AL   I ++ G  +KFK+D I A  
Sbjct: 61  YGQNQPLFNNAGQHYNHIHFWQWMKPNGG-GAIPGALEKKIAEDLGGADKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WL+V+NGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 SQFGSGWAWLAVRNGKLEIMKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           FI NLVNWE+V + Y  A+
Sbjct: 180 FIENLVNWEHVEKMYHEAI 198


>gi|217977839|ref|YP_002361986.1| Superoxide dismutase [Methylocella silvestris BL2]
 gi|217503215|gb|ACK50624.1| Superoxide dismutase [Methylocella silvestris BL2]
          Length = 199

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 143/198 (72%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PYMSKETLEYHHD HH+ Y  N   L  D+ +   SLE+I+ +S
Sbjct: 1   MSFTLPELPYAYEALQPYMSKETLEYHHDKHHQAYVTNGNNLLKDSGLEGKSLEDIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  +K N G G +P  L  AI D+ GS EK K+DLI A  
Sbjct: 61  FGKNAGLFNNAAQHYNHLHFWNWLKPNGG-GAIPGELEKAIIDSLGSVEKAKADLIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GK+ +SK+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWAWLAVKDGKIIVSKSANGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWEY  E Y  A
Sbjct: 180 FVDNLINWEYAAELYAKA 197


>gi|218531553|ref|YP_002422369.1| superoxide dismutase [Methylobacterium chloromethanicum CM4]
 gi|254562473|ref|YP_003069568.1| superoxide dismutase [Methylobacterium extorquens DM4]
 gi|218523856|gb|ACK84441.1| Superoxide dismutase [Methylobacterium chloromethanicum CM4]
 gi|254269751|emb|CAX25723.1| superoxide dismutase [Methylobacterium extorquens DM4]
          Length = 199

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 142/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G+ P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGG-GQPPAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWEYV + Y  A
Sbjct: 180 FIENLVNWEYVEKLYGEA 197


>gi|298290674|ref|YP_003692613.1| superoxide dismutase [Starkeya novella DSM 506]
 gi|296927185|gb|ADH87994.1| Superoxide dismutase [Starkeya novella DSM 506]
          Length = 198

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+P+MS+ETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPELPYAYDALAPFMSRETLEYHHDKHHQAYVTNGNNLLKGTEWEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G NAGLFNNA Q+YNH  FW  MK N G G +P  L   I ++ GS EKFK D   A  
Sbjct: 61  YGKNAGLFNNAGQHYNHIHFWKWMKPNGG-GAIPGELEKKIVEDLGSVEKFKEDFAQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GKL I+KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWAWLAVKDGKLVITKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           FI +LVNW+YV E Y  A+
Sbjct: 180 FIDSLVNWDYVAELYSKAV 198


>gi|163852713|ref|YP_001640756.1| superoxide dismutase [Methylobacterium extorquens PA1]
 gi|163664318|gb|ABY31685.1| Superoxide dismutase [Methylobacterium extorquens PA1]
          Length = 199

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 142/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEATDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G+ P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGG-GQPPAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWEYV + Y  A
Sbjct: 180 FIENLVNWEYVEKLYGEA 197


>gi|254502359|ref|ZP_05114510.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Labrenzia alexandrii DFL-11]
 gi|222438430|gb|EEE45109.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Labrenzia alexandrii DFL-11]
          Length = 200

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L+PYMS ETLE+HHD HH+ Y     +L + + +   SLE+++ +S
Sbjct: 1   MSFELPDLPYAYDALAPYMSAETLEFHHDKHHQAYVTKGNELLAGSGLEGKSLEDVVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MKK+ G   +P AL+ AID + G ++KF++D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHIHFWKWMKKDGGGTSLPGALASAIDSDLGGYDKFRADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKLEI KT N ENPL++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLAVKDGKLEIMKTPNGENPLVHGASPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI N++NW+YV E YE A
Sbjct: 181 FIDNMINWDYVLEMYEAA 198


>gi|90418815|ref|ZP_01226726.1| iron/manganese superoxide dismutase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336895|gb|EAS50600.1| iron/manganese superoxide dismutase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 224

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 108/198 (54%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMS ETLE+HHD HH+ Y     +LA  A M  LSLEE++ KS
Sbjct: 25  MAFTLPELPYAYDALGPYMSAETLEFHHDKHHQAYVTKGNELAEKAGMADLSLEEVVKKS 84

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G++  LFNNA Q+YNH  FW  M  N G   +P  L  A D + G ++KFK+D   A +
Sbjct: 85  YGTDQALFNNAGQHYNHIHFWQWMTPNGGGKSLPGKLQTAFDSDLGGYDKFKADFEAAGA 144

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VKNGKLEI KT N ENPL++GA+PILG+DVWEH+YY+D++  R  Y+ +
Sbjct: 145 GQFGSGWAWVAVKNGKLEIMKTPNGENPLVHGAVPILGVDVWEHSYYIDYRNARPKYLSA 204

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW++V E YE A
Sbjct: 205 FVDNLINWDHVLECYEKA 222


>gi|240140048|ref|YP_002964525.1| superoxide dismutase [Methylobacterium extorquens AM1]
 gi|240010022|gb|ACS41248.1| superoxide dismutase [Methylobacterium extorquens AM1]
          Length = 199

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 142/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G+ P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGG-GQPPAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++G+ PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGSTPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWEYV + Y  A
Sbjct: 180 FIENLVNWEYVEKLYGEA 197


>gi|158424677|ref|YP_001525969.1| superoxide dismutase [Azorhizobium caulinodans ORS 571]
 gi|158331566|dbj|BAF89051.1| superoxide dismutase [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score =  240 bits (613), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 141/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPYSYD L+PYMS+ETLEYHHD HH  Y +N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPDLPYSYDALAPYMSRETLEYHHDKHHLAYVNNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G G +P  L   I ++FGS EKFK D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHLHFWHWMKPNGG-GAIPGELEKKIVEDFGSVEKFKEDFIAAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I+KT N E+PL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLSIAKTPNGESPLVSGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWEYV E Y  A+
Sbjct: 180 FVDHLVNWEYVAELYGKAI 198


>gi|49474022|ref|YP_032064.1| superoxide dismutase [Bartonella quintana str. Toulouse]
 gi|49239525|emb|CAF25882.1| Superoxide dismutase [Bartonella quintana str. Toulouse]
          Length = 200

 Score =  240 bits (612), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 111/196 (56%), Positives = 142/196 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  + + SLE I+ KS
Sbjct: 1   MAFELAKLPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLEHIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P+ L+ AI+ + G + KF++D I AA 
Sbjct: 61  FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYNKFRADFIAAAV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N+ENPL++ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVAVKDGKLEIMKTSNSENPLVHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYE 196
           F+ NL+NW+YV + YE
Sbjct: 181 FVDNLINWDYVLKLYE 196


>gi|114705427|ref|ZP_01438335.1| probable superoxide dismutase fe protein [Fulvimarina pelagi
           HTCC2506]
 gi|114540212|gb|EAU43332.1| probable superoxide dismutase fe protein [Fulvimarina pelagi
           HTCC2506]
          Length = 200

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L PYMS ETLEYHHD HH  Y     +LA +A M   S+EE++  S
Sbjct: 1   MAFELPDLPYAYDALGPYMSAETLEYHHDKHHNAYVTKGNELAKEAGMDGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HGSN  LFNNA+Q+YNH  FW  MK N G   +P +L  A D + G ++KFK+D   A +
Sbjct: 61  HGSNQPLFNNAAQHYNHIHFWKWMKPNGGGKNLPGSLKTAFDRDLGGYDKFKADFEAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++V+NGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+ +
Sbjct: 121 GQFGSGWAWVAVENGKLEIMKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLSA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWE+V E Y  A
Sbjct: 181 FVDNLINWEHVEEMYRQA 198


>gi|110633218|ref|YP_673426.1| manganese and iron superoxide dismutase [Mesorhizobium sp. BNC1]
 gi|110284202|gb|ABG62261.1| manganese and iron superoxide dismutase [Chelativorans sp. BNC1]
          Length = 200

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 148/198 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY Y+ L PYMSKETLE+HHD HHK Y D   KLA++A + +LS+EEI+ +S
Sbjct: 1   MAFELPDLPYDYEALQPYMSKETLEFHHDKHHKAYVDTGNKLAAEAGLDNLSVEEIVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q++NH  FW  MKK  G   +P AL  AID + G ++KF++D + A  
Sbjct: 61  YGKNQPLFNNAGQHFNHVHFWKWMKKGGGGKSLPGALQTAIDSDLGGYDKFRNDFVQAGM 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W++VKNGKLEI KT N ENPL++G  PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWIAVKNGKLEIMKTPNGENPLVHGGAPILGVDVWEHSYYIDYRNARQKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E YE A
Sbjct: 181 FVDNLVNWDYVLELYEKA 198


>gi|188582738|ref|YP_001926183.1| superoxide dismutase [Methylobacterium populi BJ001]
 gi|179346236|gb|ACB81648.1| Superoxide dismutase [Methylobacterium populi BJ001]
          Length = 199

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G+ P  L+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGG-GQPPAELAKKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWEYV + Y  A
Sbjct: 180 FIENLVNWEYVEKLYGEA 197


>gi|170750886|ref|YP_001757146.1| superoxide dismutase [Methylobacterium radiotolerans JCM 2831]
 gi|170657408|gb|ACB26463.1| Superoxide dismutase [Methylobacterium radiotolerans JCM 2831]
          Length = 199

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 141/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  +
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLQGKSVEEIVKAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G +P AL+  ID++ G  EKFK+D I A  
Sbjct: 61  YNTNQPLFNNAGQHYNHIHFWQWMKPNGG-GAIPGALAKKIDEDLGGAEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAIMKTPNGENPLVHGAQPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWE+V + Y  A
Sbjct: 180 FIENLVNWEHVEKMYAEA 197


>gi|254471705|ref|ZP_05085106.1| superoxide dismutase protein [Pseudovibrio sp. JE062]
 gi|211958907|gb|EEA94106.1| superoxide dismutase protein [Pseudovibrio sp. JE062]
          Length = 199

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 142/199 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L +LPY+YD L+PYMS ETLE+HHD HH  Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MSFALEDLPYAYDALAPYMSAETLEFHHDKHHMAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+NAGLFNNA Q+ NH  FW  MK N G   +P  L+  +D++ G F+KF++D I A  
Sbjct: 61  YGTNAGLFNNAGQHLNHLHFWKWMKPNGGGSSLPGVLAKKVDEDLGGFDKFRADFINAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GKL + KT N ENP+++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLAVKDGKLVVMKTPNGENPIVHGATPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVDNLINWEYVEELYSAAV 199


>gi|49475260|ref|YP_033301.1| superoxide dismutase [Bartonella henselae str. Houston-1]
 gi|49238065|emb|CAF27272.1| Superoxide dismutase [Bartonella henselae str. Houston-1]
          Length = 200

 Score =  237 bits (604), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  + + SLE I+ KS
Sbjct: 1   MAFELAPLPYDYDSLSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLENIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P+ L+ AI+ + G ++KF++D I  A 
Sbjct: 61  FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYDKFRADFIATAI 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N ENPL++ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWIAVKDGKLEIMKTPNGENPLVHNAQPILGVDVWEHSYYIDYRNVRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV + YE   L
Sbjct: 181 FVDHLINWDYVLKLYEDCGL 200


>gi|218663246|ref|ZP_03519176.1| Superoxide dismutase [Rhizobium etli IE4771]
          Length = 191

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/184 (58%), Positives = 138/184 (75%)

Query: 15  LSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQY 74
           L P   +ETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS G+NAGLFNNA+Q+
Sbjct: 6   LPPSCRRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKSFGTNAGLFNNAAQH 65

Query: 75  YNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKN 134
           YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +TQFGSGW W+SVKN
Sbjct: 66  YNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGATQFGSGWAWVSVKN 125

Query: 135 GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCER 194
           GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+FI +L+NW+YV ER
Sbjct: 126 GKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEAFIDSLINWDYVLER 185

Query: 195 YETA 198
           YE A
Sbjct: 186 YEEA 189


>gi|92118893|ref|YP_578622.1| superoxide dismutase [Nitrobacter hamburgensis X14]
 gi|91801787|gb|ABE64162.1| Superoxide dismutase [Nitrobacter hamburgensis X14]
          Length = 199

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/198 (54%), Positives = 139/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L+PYMSKETLEYHHD HH+ Y  N        E    SLE+I+  +
Sbjct: 1   MTFTLPDLPYAHDALAPYMSKETLEYHHDKHHQAYVTNGNNALKGTEYEGKSLEDIVRAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HG N  +FNNA Q+YNH  FW  MK N G  K+P  L   I ++F S +KFK+D + A +
Sbjct: 61  HGKNPSVFNNAGQHYNHLHFWKWMKPNGGGNKLPGRLEKKIIEDFTSLDKFKADFVAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VKNGKL++SKT NAE+PL+ GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLQVKNGKLQVSKTANAESPLVQGATPILGCDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E +  A
Sbjct: 181 FLDNLVNWDYVDELFSKA 198


>gi|319403873|emb|CBI77459.1| Superoxide dismutase [Bartonella rochalimae ATCC BAA-1498]
          Length = 200

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 142/197 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YDDLSPYMS+ETLEYHHD HH  Y  N      D  + + +L ++I +S
Sbjct: 1   MTFELVELPYDYDDLSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLGNKNLTDLIKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P  L+ AI+ + G ++KF++D + A  
Sbjct: 61  FGKNPGLFNNAAQYYNHNHFWHWMKKGGGGQKLPAKLAKAIESDLGGYDKFRADFMAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+++K+GKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVALKDGKLEIMKTPNGENPLIHNAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV E YE+
Sbjct: 181 FVDHLINWDYVLELYES 197


>gi|307946139|ref|ZP_07661474.1| superoxide dismutase (Fe) [Roseibium sp. TrichSKD4]
 gi|307769803|gb|EFO29029.1| superoxide dismutase (Fe) [Roseibium sp. TrichSKD4]
          Length = 233

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 106/198 (53%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY++D L PYMS ETLE+HHD HH  Y     +L + + +   SLEE++ +S
Sbjct: 35  MSFELPDLPYAHDALGPYMSSETLEFHHDKHHMAYVTKGNELLAGSGLEGKSLEEVVKES 94

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G  A LFNNA Q++NH  FW  MK N G   +P AL+  ID + G F+KF++D I A  
Sbjct: 95  FGKYAPLFNNAGQHFNHIHFWNWMKPNGGGTSLPGALASKIDSDLGGFDKFRADFIAAGV 154

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL +K+GKLEI KT N ENPL++GA P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 155 GQFGSGWAWLVLKDGKLEIMKTPNGENPLVHGAAPLLGVDVWEHSYYIDYRNARPKYLEA 214

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E YE A
Sbjct: 215 FVDNLVNWDYVLELYEAA 232


>gi|27382885|ref|NP_774414.1| superoxide dismutase [Bradyrhizobium japonicum USDA 110]
 gi|27356058|dbj|BAC53039.1| superoxide dismutase [Bradyrhizobium japonicum USDA 110]
          Length = 213

 Score =  233 bits (595), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 110/198 (55%), Positives = 135/198 (68%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  +MSKETLE+HHD HH+ Y  N        E    SLEEI+  S
Sbjct: 16  MTFTLPPLPYAYDALGQFMSKETLEFHHDKHHQAYVTNGNNALKGTEWEGKSLEEIVKGS 75

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  +FNNA Q+YNH  FW+ MK N G  K+P  L   I+++ G FEKFK+D   A  
Sbjct: 76  FGKNPAVFNNAGQHYNHIHFWSWMKPNGGGTKLPGKLEKKINEDLGGFEKFKTDFQAAGV 135

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VKNGKLEISKT N ENPL++GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 136 GQFGSGWCWLQVKNGKLEISKTPNGENPLVHGATPILGCDVWEHSYYIDYRNRRPDYLKA 195

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNWEYV   ++ A
Sbjct: 196 FVENLVNWEYVESLFDKA 213


>gi|319408236|emb|CBI81889.1| Superoxide dismutase [Bartonella schoenbuchensis R1]
          Length = 200

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  L Y YD L PYMS+ETLEYH D HH  Y  N   L  D  + + SLE+II +S
Sbjct: 1   MAFELAELSYDYDALLPYMSRETLEYHRDKHHFAYLTNTNNLVKDLGLENKSLEDIIKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+Q YNH+ FW  MKK  G  K+P  L+ AI+ + G +EKF++D I A S
Sbjct: 61  FGKNPGLFNNAAQSYNHHHFWNWMKKGGGGQKLPGKLAKAIESDLGGYEKFRTDFIAAGS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W++VKNGKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWIAVKNGKLEIMKTPNGENPLIHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NW+YV E YE  
Sbjct: 181 FVDHLINWDYVLELYENC 198


>gi|239831421|ref|ZP_04679750.1| Superoxide dismutase [Fe] [Ochrobactrum intermedium LMG 3301]
 gi|239823688|gb|EEQ95256.1| Superoxide dismutase [Fe] [Ochrobactrum intermedium LMG 3301]
          Length = 221

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLE HHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 24  MAFELPALPYDYDALAPFMSRETLELHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N GLFNNA Q+YNH  FW  MKK  G  K+P  L  AI+ + G ++KF+ D I A  
Sbjct: 84  YGTNQGLFNNAGQHYNHIQFWKWMKKGGGGKKLPGKLEKAIESDLGGYDKFREDFIAAGV 143

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 144 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYVDYRNLRPKYLEA 203

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWE+V E YE A
Sbjct: 204 FVDNLINWEFVEELYEKA 221


>gi|75675106|ref|YP_317527.1| manganese and iron superoxide dismutase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419976|gb|ABA04175.1| manganese and iron superoxide dismutase [Nitrobacter winogradskyi
           Nb-255]
          Length = 201

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/197 (56%), Positives = 140/197 (71%), Gaps = 2/197 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LPNLPYS+D L+P+MSKETLEYHHD HH+ Y  N        E    SLE+I+  S
Sbjct: 1   MTFTLPNLPYSHDALAPHMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEDIVRSS 60

Query: 61  HGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +G +A  G+FNNA Q+YNH  FW  MK N G  K+P  L   I ++FGS EKFK+D   A
Sbjct: 61  YGKSASVGVFNNAGQHYNHLHFWNWMKPNGGGDKLPGRLEKKIIEDFGSLEKFKADFAAA 120

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            + QFGSGW WL VKNGKLE+SKT NAENPLI+ A PILG DVWEH+YY+D++ RR  Y+
Sbjct: 121 GAGQFGSGWAWLQVKNGKLEVSKTPNAENPLIHNATPILGCDVWEHSYYIDYRNRRPDYL 180

Query: 179 ESFITNLVNWEYVCERY 195
           ++F+ +LVNW+YV + Y
Sbjct: 181 KAFLDHLVNWDYVDQLY 197


>gi|90425222|ref|YP_533592.1| superoxide dismutase [Rhodopseudomonas palustris BisB18]
 gi|90107236|gb|ABD89273.1| Superoxide dismutase [Rhodopseudomonas palustris BisB18]
          Length = 199

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (70%), Gaps = 1/196 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+YD L+PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPDLPYAYDALAPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA+Q+YNH  FW  MK N G  K+P  L   I ++ G  EKFK+D   A  
Sbjct: 61  FGKNAPLFNNAAQHYNHIEFWKWMKPNGGGDKLPGRLEKKITEDLGGLEKFKTDFAAAGV 120

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            QFGSGW WLSV K+GKLEI+KT N ENPL++GA P+LG+DVWEH+YY+D++ +R  Y++
Sbjct: 121 GQFGSGWAWLSVSKDGKLEITKTPNGENPLVHGATPLLGVDVWEHSYYIDYRNKRPDYLK 180

Query: 180 SFITNLVNWEYVCERY 195
           +F+ +L+NW+YV E +
Sbjct: 181 AFVDHLINWDYVDELF 196


>gi|121602729|ref|YP_988738.1| superoxide dismutase [Bartonella bacilliformis KC583]
 gi|120614906|gb|ABM45507.1| superoxide dismutase [Bartonella bacilliformis KC583]
          Length = 198

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 140/196 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L +LPY+YD L PYMS ETLEYHHD H+  Y  N      D  +   ++E I+I+S
Sbjct: 1   MAFTLVDLPYTYDALEPYMSAETLEYHHDKHYLAYLTNTNNFVKDLSLEDKTIENIVIES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+N GLFNNA+QYYNH  FW  MKK     K+P+ L++AI+ + G ++KF++D I A +
Sbjct: 61  FGTNPGLFNNAAQYYNHTHFWKWMKKGGSGRKLPEKLNNAIERDLGGYDKFRADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N ENPL+ GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWIAVKDGKLEIMKTLNGENPLVYGAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYE 196
           F+ NL++W+YV   YE
Sbjct: 181 FVDNLIDWDYVLALYE 196


>gi|319406884|emb|CBI80519.1| Superoxide dismutase [Bartonella sp. 1-1C]
          Length = 200

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 106/197 (53%), Positives = 139/197 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YDDLSPYMS+ETLEYHHD HH  Y  N      D  +   +L ++I +S
Sbjct: 1   MTFELVELPYDYDDLSPYMSRETLEYHHDKHHLTYLTNTNNFVKDLSLGDKNLTDLIKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA+QYYNHN FW  MKK  G  K+P  L+ AI+ + G ++KF++D + A  
Sbjct: 61  FGKNPNLFNNAAQYYNHNHFWNWMKKGGGGQKLPAKLAKAIESDLGGYDKFRADFMAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+ +K+GKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVVLKDGKLEIMKTPNGENPLIHNAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV E YE+
Sbjct: 181 FVDHLINWDYVLELYES 197


>gi|182678620|ref|YP_001832766.1| superoxide dismutase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634503|gb|ACB95277.1| Superoxide dismutase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 199

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 109/199 (54%), Positives = 140/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+YD L P+MSKETLE+HHD HH+ Y  N   L  D+ +   SLE+I+ +S
Sbjct: 1   MSLTLPPLPYAYDALQPFMSKETLEFHHDKHHQAYVTNGNNLLKDSGLEGKSLEDIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA Q+YNH  FW  MK N G G +P  +  AI D+FGS +K K + I A  
Sbjct: 61  FGKNPGLFNNAGQHYNHLHFWQWMKPNGG-GAIPGTVEKAIIDSFGSVDKAKEEFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GK+ + KT N ENPL++GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWSWLAVKDGKIVVMKTPNGENPLVHGATPILGCDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWEYV E Y  A+
Sbjct: 180 FVDSLVNWEYVEELYTKAV 198


>gi|154247247|ref|YP_001418205.1| superoxide dismutase [Xanthobacter autotrophicus Py2]
 gi|154161332|gb|ABS68548.1| Superoxide dismutase [Xanthobacter autotrophicus Py2]
          Length = 198

 Score =  231 bits (588), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 109/199 (54%), Positives = 137/199 (68%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+PYMS+ETLEYHHD HH  Y +N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPELPYAYDALAPYMSRETLEYHHDKHHLAYVNNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G G +P  +   I ++ GS EKFK D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHLHFWNWMKPNGG-GAIPGEIEKKIIEDIGSVEKFKEDFIAAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL++K+GKL + K+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLALKDGKLVVLKSPNGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNW+YV E Y  A+
Sbjct: 180 FVDHLVNWDYVAELYSKAV 198


>gi|319405309|emb|CBI78923.1| Superoxide dismutase [Bartonella sp. AR 15-3]
          Length = 200

 Score =  230 bits (587), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKL  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  +   SL ++I +S
Sbjct: 1   MTFKLAELPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFIRDLGLEDKSLTDLIRES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P  L+ AI+ + G ++KF++D + A  
Sbjct: 61  FGKNPGLFNNAAQYYNHNHFWNWMKKGGGGQKLPVKLAKAIESDLGGYDKFRADFMAAGG 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+ +K+ KLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVVLKDDKLEIMKTPNGENPLIHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV E YE+
Sbjct: 181 FVDHLINWDYVLELYES 197


>gi|312115130|ref|YP_004012726.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220259|gb|ADP71627.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 200

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 102/198 (51%), Positives = 138/198 (69%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+Y+ L PYMS ETL+YHHD HH+ Y D    L   + +    LE+I+  +
Sbjct: 1   MAFELPALPYAYEALQPYMSAETLQYHHDKHHQAYVDTGNNLLKGSGLEDKGLEDIVKAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G   +P  L+  ID + G ++KF+   I A  
Sbjct: 61  YGKNQPLFNNAGQHYNHLHFWKWMKPNGGGKSLPGKLAAKIDSDLGGYDKFREAFIEAGK 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL++K+GKLE++KT N ENPL++G +P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLTLKDGKLEVTKTPNGENPLVHGGVPLLGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNWEYV E +E A
Sbjct: 181 FVDNLVNWEYVEELFEKA 198


>gi|85715876|ref|ZP_01046854.1| manganese and iron superoxide dismutase [Nitrobacter sp. Nb-311A]
 gi|85697283|gb|EAQ35163.1| manganese and iron superoxide dismutase [Nitrobacter sp. Nb-311A]
          Length = 201

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 140/201 (69%), Gaps = 2/201 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LPNLPY++D L+P+MSKETLEYHHD HH+ Y  N        E    SLE+I+  S
Sbjct: 1   MTFTLPNLPYAHDALAPHMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEDIVKSS 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +G +A +  FNNA Q+YNH  FW  MK N G  K+P  L   I ++FG+ +KFK+D   A
Sbjct: 61  YGKSAAVAVFNNAGQHYNHLHFWNWMKPNGGGNKLPGRLEKKIIEDFGTLDKFKADFAAA 120

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            + QFGSGW WL VKNGKL +SKT NAENPLI+ A PILG DVWEH+YY+D++ RR  Y+
Sbjct: 121 GAGQFGSGWAWLQVKNGKLSVSKTPNAENPLIHNATPILGCDVWEHSYYIDYRNRRPDYL 180

Query: 179 ESFITNLVNWEYVCERYETAM 199
           ++F+ +LVNW+YV E +  A+
Sbjct: 181 KAFLDHLVNWDYVDELFSKAV 201


>gi|163760499|ref|ZP_02167581.1| superoxide dismutase, Fe-Mn family protein [Hoeflea phototrophica
           DFL-43]
 gi|162282450|gb|EDQ32739.1| superoxide dismutase, Fe-Mn family protein [Hoeflea phototrophica
           DFL-43]
          Length = 200

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/199 (52%), Positives = 136/199 (68%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY YD L+PYMS+ETLE+HHD HH+ Y     +L   +     S+EEI   +
Sbjct: 1   MALELPALPYDYDALAPYMSRETLEFHHDKHHQAYVTKGNELLEGSAHAGKSIEEICKAA 60

Query: 61  HG-SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              +NAGL NN  Q+YNH  FW  MKK  G  K+P AL  AI  + G F+KF++D I A 
Sbjct: 61  FAENNAGLINNVGQHYNHMHFWNWMKKGGGGSKMPGALEKAIASDLGGFDKFRADFIAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             QFGSGW WL+VKNGKLE+ KT N ENPL++GA P+LG DVWEH+YY+D++  R  Y+E
Sbjct: 121 VGQFGSGWAWLAVKNGKLEVMKTPNGENPLMHGATPVLGCDVWEHSYYIDYRNARPKYLE 180

Query: 180 SFITNLVNWEYVCERYETA 198
           +FI N++NW+YV E Y+ A
Sbjct: 181 AFIDNMINWDYVAELYDAA 199


>gi|319898548|ref|YP_004158641.1| Superoxide dismutase [Bartonella clarridgeiae 73]
 gi|319402512|emb|CBI76055.1| Superoxide dismutase [Bartonella clarridgeiae 73]
          Length = 200

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 140/197 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKL  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  + + SL +II ++
Sbjct: 1   MTFKLVELPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFIKDLGLENKSLTDIIKET 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P  L+ AI+ + G ++KF++D I A  
Sbjct: 61  FGKNPGLFNNAAQYYNHNHFWNWMKKGGGGKKLPAKLAKAIESDLGGYDKFRADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+++K+GKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E 
Sbjct: 121 AQFGSGWAWVALKDGKLEIMKTPNGENPLIHDAQPILGVDVWEHSYYIDYRNARPKYLEV 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV E YE+
Sbjct: 181 FVDHLINWDYVLELYES 197


>gi|296445863|ref|ZP_06887815.1| Superoxide dismutase [Methylosinus trichosporium OB3b]
 gi|296256691|gb|EFH03766.1| Superoxide dismutase [Methylosinus trichosporium OB3b]
          Length = 199

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/198 (52%), Positives = 136/198 (68%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+YD L PY+SKE+ EYHHD HH  Y  NA  L    E     +EE+I+ S
Sbjct: 1   MSFTLPDLPYAYDALQPYLSKESFEYHHDKHHATYVTNANNLVKGTEFEGKPIEEVIVAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  +FNN +Q YNH+ +W  +K N G G +P  +  AI ++FGS +KFK +  T   
Sbjct: 61  YGKNVPVFNNVAQIYNHSEYWKWLKPNGG-GALPAKVEKAIVESFGSVDKFKEEFQTQGL 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VK+GKL + KT NAENPL+ GA P+L  DVWEHAYY+D++ RRA ++++
Sbjct: 120 GQFGSGWVWLEVKDGKLAVRKTPNAENPLVFGAKPLLVADVWEHAYYIDYRNRRADFLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNWEYV E YE A
Sbjct: 180 FLEHLVNWEYVEECYEAA 197


>gi|108758510|ref|YP_632987.1| superoxide dismutase, Fe [Myxococcus xanthus DK 1622]
 gi|108462390|gb|ABF87575.1| superoxide dismutase, Fe [Myxococcus xanthus DK 1622]
          Length = 193

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/196 (52%), Positives = 138/196 (70%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY  D L+P+MS ETLE+HHD HH  Y +N  KL       + SLEE+I+ S
Sbjct: 1   MSFTLPDLPYKKDALAPHMSAETLEFHHDKHHAAYVNNLNKLLDGKPEANKSLEEVILSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW CMK   G GK    L+ AID +FGSFEKFK +  TAA+
Sbjct: 61  DG---GVFNNAAQVWNHTFFWQCMKPAGG-GKPTGELAAAIDRDFGSFEKFKEEFSTAAA 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL ++ GKL+++KT NA+ P+ +G   +L IDVWEHAYY+DF+  R  +IE+
Sbjct: 117 TQFGSGWAWLVLEGGKLKVTKTGNADLPMKHGQKALLTIDVWEHAYYIDFRNARPKFIET 176

Query: 181 FITNLVNWEYVCERYE 196
           F+T+LVNW++V + ++
Sbjct: 177 FLTHLVNWDFVAQNFK 192


>gi|218441422|ref|YP_002379751.1| superoxide dismutase [Cyanothece sp. PCC 7424]
 gi|218174150|gb|ACK72883.1| Superoxide dismutase [Cyanothece sp. PCC 7424]
          Length = 199

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 136/200 (68%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +KLP+LPY Y  L P++SK TLE+HHD HH  Y +N  K     E+  +S+E++I K 
Sbjct: 1   MAYKLPDLPYDYTALEPHISKSTLEFHHDKHHAAYVNNFNKAVEGTELDSMSIEDVIKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  GLFNNA+Q +NH  +W CMK N G G    AL+D I+ +FGSF+KF  +   A
Sbjct: 61  AGDSSKTGLFNNAAQAWNHTFYWNCMKPN-GGGTPSGALADKINADFGSFDKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + NG L+++KT NA+NPL +G +P+L +DVWEHAYYLD++  R  Y+
Sbjct: 120 GGTQFGSGWAWLVLDNGTLKVTKTPNADNPLTSGQVPLLTMDVWEHAYYLDYQNSRPGYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           E FI NL+NW++V E +  A
Sbjct: 180 EKFINNLINWDFVAENFSKA 199


>gi|218506637|ref|ZP_03504515.1| Superoxide dismutase [Rhizobium etli Brasil 5]
          Length = 178

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 124/163 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWE 163
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWE
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWE 163


>gi|118593501|ref|ZP_01550881.1| Manganese and iron superoxide dismutase:ATP/GTP-binding site motif
           A (P-loop) [Stappia aggregata IAM 12614]
 gi|118433980|gb|EAV40638.1| Manganese and iron superoxide dismutase:ATP/GTP-binding site motif
           A (P-loop) [Stappia aggregata IAM 12614]
          Length = 181

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 128/179 (71%)

Query: 20  SKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNL 79
           S ETLE+HHD HH+ Y     +L + + +   SLEEI+ +S+G NA LFNNA Q+YNH  
Sbjct: 1   SAETLEFHHDKHHQAYVTKGNELLAGSGLEGKSLEEIVKESYGKNAPLFNNAGQHYNHIH 60

Query: 80  FWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEI 139
           FW  MKK+ G   +P AL+ AID + G F+KF++D I A   QFGSGW WL+VK GKLEI
Sbjct: 61  FWKWMKKDGGGSSLPGALASAIDSDLGGFDKFRADFIAAGVGQFGSGWAWLAVKGGKLEI 120

Query: 140 SKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
            KT N ENPL++GA PILG DVWEH+YY+D++  R  Y+E+FI ++VNW+YV E YE A
Sbjct: 121 MKTPNGENPLVHGAAPILGCDVWEHSYYIDYRNARPKYLEAFIDSMVNWDYVLEMYEAA 179


>gi|288958297|ref|YP_003448638.1| superoxide dismutase Fe-Zn [Azospirillum sp. B510]
 gi|288910605|dbj|BAI72094.1| superoxide dismutase Fe-Zn [Azospirillum sp. B510]
          Length = 197

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 132/196 (67%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L+PY+S ETL  HHD HH+ Y  N   L  D  +   SLEE+I  +
Sbjct: 1   MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLADASLEEVIKAA 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNNA+Q +NH  FW C+KK DG GK+P AL   I  +FGS EKFK +L  A
Sbjct: 61  AGDASKVGIFNNAAQVWNHTFFWQCLKK-DG-GKIPAALEQRIVADFGSVEKFKEELTQA 118

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL +   KL++ KT NA+ PL +G  P+  IDVWEHAYY+DF+ RRA ++
Sbjct: 119 ALTQFGSGWAWLYLDGDKLKVGKTGNADTPLAHGHKPLFTIDVWEHAYYVDFQNRRADFV 178

Query: 179 ESFITNLVNWEYVCER 194
           ++ I NL NW++  E+
Sbjct: 179 KAVIDNLANWDFAAEQ 194


>gi|262277969|ref|ZP_06055762.1| superoxide dismutase [Mn] [alpha proteobacterium HIMB114]
 gi|262225072|gb|EEY75531.1| superoxide dismutase [Mn] [alpha proteobacterium HIMB114]
          Length = 197

 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 132/194 (68%), Gaps = 3/194 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+ D L+P MS+ETL+ HH  HH+ Y  N   L  D ++   SLE+II K+
Sbjct: 1   MAFELPKLNYANDALAPVMSQETLDLHHGKHHQTYVTNLNNLVKDTDLADASLEDIIKKT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA Q++NH LFW CMK   G G +P  L   I  +FGS +KFK D I A
Sbjct: 61  AKDSSKAGIFNNAGQHWNHILFWKCMKPK-GGGAIPSELEKRIVSDFGSVDKFKEDFIQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL++ NGKL I+K+ NA NPL++   PILG DVWEH+YY+D++ RR  Y+
Sbjct: 120 GVTQFGSGWAWLAIDNGKLVITKSANASNPLVDNMKPILGCDVWEHSYYVDYRNRRPDYL 179

Query: 179 ESFITNLVNWEYVC 192
           ++FI +LVNWE+V 
Sbjct: 180 KAFINDLVNWEHVA 193


>gi|323136201|ref|ZP_08071283.1| Manganese/iron superoxide dismutase-like [Methylocystis sp. ATCC
           49242]
 gi|322398275|gb|EFY00795.1| Manganese/iron superoxide dismutase-like [Methylocystis sp. ATCC
           49242]
          Length = 198

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 134/199 (67%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L +LPY+YD L PY+S+E+ EYHHD HH  Y  NA  L    E     +EE+I+ +
Sbjct: 1   MSFTLEDLPYAYDALQPYLSRESFEYHHDKHHATYVTNANNLVKGTEYEGKPIEEVIVTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  +FNN +Q+YNH+ +W  MK N G G +P  +   I ++FGS +KFK D      
Sbjct: 61  FNRNTPIFNNVAQHYNHHHYWKWMKPNGG-GAIPGKIEKLIVESFGSVDKFKEDFQKEGL 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL +K+GKL I KT NAENPL++GA P+L  DVWEH+YY+D++ RRA Y+++
Sbjct: 120 AQFGSGWVWLEMKDGKLAIRKTPNAENPLVHGAAPLLVADVWEHSYYIDYRNRRADYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWE+V E Y+ A+
Sbjct: 180 FLDHLVNWEHVEEMYDAAV 198


>gi|166368140|ref|YP_001660413.1| superoxide dismutase [Microcystis aeruginosa NIES-843]
 gi|166090513|dbj|BAG05221.1| superoxide dismutase [Microcystis aeruginosa NIES-843]
          Length = 199

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 132/200 (66%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY Y  L P ++K TLE+HHD HH  Y +N   L  D E+  LSLEE+I+K 
Sbjct: 1   MAYTLPPLPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL+D I  +FGSFEKF     TA
Sbjct: 61  AGDASKAGVFNNAAQAWNHSFYWDCMKPGGGGAPT-GALADKIQADFGSFEKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADNPLTAGQVPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+T LVNW++V      A
Sbjct: 180 SDFLTKLVNWDFVAANLAAA 199


>gi|307150139|ref|YP_003885523.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
 gi|306980367|gb|ADN12248.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
          Length = 199

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 134/195 (68%), Gaps = 3/195 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY Y  L PY+SK TLE+HHD HH  Y +N  K  +  E+  L +EE+I K 
Sbjct: 1   MAYELPVLPYDYTALEPYISKSTLEFHHDKHHAAYVNNFNKAVAGTELDSLPIEEVIKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNNA+Q +NH  +W  +K N G G    A++D I+ +FGSFEKF  +   A
Sbjct: 61  AGDSSKTGVFNNAAQAWNHTFYWNSLKPNGG-GTPSGAIADKINADFGSFEKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ +R  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTPNADNPLTAGQVPLLTMDVWEHAYYLDYQNKRPDYI 179

Query: 179 ESFITNLVNWEYVCE 193
           E+FI+ L+NWE+V +
Sbjct: 180 ETFISKLINWEFVNQ 194


>gi|126642383|ref|YP_001085367.1| superoxide dismutase [Acinetobacter baumannii ATCC 17978]
          Length = 219

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++SKETLEYHHD HH  Y  N   L    ++   +LEEII  + G  
Sbjct: 17  LPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDA 76

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  ID+ FGS+EKF  +   AA+TQ
Sbjct: 77  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQ 135

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 136 FGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 195

Query: 181 FITNLVNWEYVCER 194
           F+ NLVNW+Y   +
Sbjct: 196 FLENLVNWDYANAK 209


>gi|330813526|ref|YP_004357765.1| superoxide dismutase, iron-dependent [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486621|gb|AEA81026.1| superoxide dismutase, iron-dependent [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 197

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 132/198 (66%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y  + L+P MS+ETL+ HH  HH+ Y  N      D ++  LSLEEII K+
Sbjct: 1   MTFELPTLNYPKNALAPVMSEETLDLHHGKHHQTYITNLNNFVKDTDLSGLSLEEIISKT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA Q++NH LFW CMK   G G +P  L   I  +FGS ++FK D I A
Sbjct: 61  AADTSKAGIFNNAGQHWNHILFWNCMKPKGG-GAMPPELEKRIISDFGSVDQFKQDFIQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL++ NGKL ++KT NA NPL++   PI G DVWEH+YY+D++ RR  Y+
Sbjct: 120 GTTQFGSGWAWLAINNGKLVVTKTANASNPLVDNMKPIFGCDVWEHSYYVDYRNRRPDYL 179

Query: 179 ESFITNLVNWEYVCERYE 196
           ++F+ +L NWE+V  + +
Sbjct: 180 KAFVNDLANWEFVASQLD 197


>gi|169632935|ref|YP_001706671.1| superoxide dismutase [Fe] [Acinetobacter baumannii SDF]
 gi|169795271|ref|YP_001713064.1| superoxide dismutase [Fe] [Acinetobacter baumannii AYE]
 gi|184158864|ref|YP_001847203.1| superoxide dismutase [Acinetobacter baumannii ACICU]
 gi|213158065|ref|YP_002320116.1| superoxide dismutase (Fe) [Acinetobacter baumannii AB0057]
 gi|215482804|ref|YP_002325007.1| Superoxide dismutase (Fe) [Acinetobacter baumannii AB307-0294]
 gi|260556735|ref|ZP_05828953.1| superoxide dismutase [Acinetobacter baumannii ATCC 19606]
 gi|301346884|ref|ZP_07227625.1| superoxide dismutase [Acinetobacter baumannii AB056]
 gi|301510429|ref|ZP_07235666.1| superoxide dismutase [Acinetobacter baumannii AB058]
 gi|301596780|ref|ZP_07241788.1| superoxide dismutase [Acinetobacter baumannii AB059]
 gi|332850378|ref|ZP_08432698.1| superoxide dismutase [Acinetobacter baumannii 6013150]
 gi|332871804|ref|ZP_08440239.1| superoxide dismutase [Acinetobacter baumannii 6013113]
 gi|332875292|ref|ZP_08443124.1| superoxide dismutase [Acinetobacter baumannii 6014059]
 gi|169148198|emb|CAM86061.1| superoxide dismutase [Fe] [Acinetobacter baumannii AYE]
 gi|169151727|emb|CAP00529.1| superoxide dismutase [Fe] [Acinetobacter baumannii]
 gi|183210458|gb|ACC57856.1| Superoxide dismutase [Acinetobacter baumannii ACICU]
 gi|193077882|gb|ABO12765.2| superoxide dismutase [Acinetobacter baumannii ATCC 17978]
 gi|213057225|gb|ACJ42127.1| superoxide dismutase (Fe) [Acinetobacter baumannii AB0057]
 gi|213989089|gb|ACJ59388.1| Superoxide dismutase (Fe) [Acinetobacter baumannii AB307-0294]
 gi|260409994|gb|EEX03294.1| superoxide dismutase [Acinetobacter baumannii ATCC 19606]
 gi|322507760|gb|ADX03214.1| sodB [Acinetobacter baumannii 1656-2]
 gi|323518776|gb|ADX93157.1| superoxide dismutase [Acinetobacter baumannii TCDC-AB0715]
 gi|332730649|gb|EGJ61960.1| superoxide dismutase [Acinetobacter baumannii 6013150]
 gi|332731212|gb|EGJ62511.1| superoxide dismutase [Acinetobacter baumannii 6013113]
 gi|332736549|gb|EGJ67544.1| superoxide dismutase [Acinetobacter baumannii 6014059]
          Length = 208

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++SKETLEYHHD HH  Y  N   L    ++   +LEEII  + G  
Sbjct: 6   LPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  ID+ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ NLVNW+Y   +
Sbjct: 185 FLENLVNWDYANAK 198


>gi|218245306|ref|YP_002370677.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|257058341|ref|YP_003136229.1| superoxide dismutase [Cyanothece sp. PCC 8802]
 gi|218165784|gb|ACK64521.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|256588507|gb|ACU99393.1| Superoxide dismutase [Cyanothece sp. PCC 8802]
          Length = 200

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 95/200 (47%), Positives = 134/200 (67%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LP+ Y  L P++SK TLE+HHD HH  Y +N     + +E+    +EE+I  I
Sbjct: 1   MGYALPELPFGYTALEPHISKSTLEFHHDKHHAAYVNNYNNAVAGSELDAKPIEEVIKAI 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AGLFNNA+Q +NH+ +W C+K N G G    AL+D I+ +FGSFE+F +    A
Sbjct: 61  AGDSSKAGLFNNAAQAWNHSFYWNCIKPNGG-GAPTGALADKINQDFGSFEEFVTAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NAENP+  G  P+L +DVWEHAYYLD++ +R  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTSNAENPMTAGQTPLLTMDVWEHAYYLDYQNKRPAYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+  L+NW++V E +  A
Sbjct: 180 DTFVEKLINWDFVAENFAKA 199


>gi|239502475|ref|ZP_04661785.1| superoxide dismutase [Acinetobacter baumannii AB900]
          Length = 208

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 129/194 (66%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++SKETLEYHHD HH  Y  N   L    ++   +LEEII  + G  
Sbjct: 6   LPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  ID+ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSIIKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ NLVNW+Y   +
Sbjct: 185 FLENLVNWDYANAK 198


>gi|260549765|ref|ZP_05823982.1| superoxide dismutase [Acinetobacter sp. RUH2624]
 gi|293609678|ref|ZP_06691980.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|260407282|gb|EEX00758.1| superoxide dismutase [Acinetobacter sp. RUH2624]
 gi|292828130|gb|EFF86493.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122898|gb|ADY82421.1| superoxide dismutase [Acinetobacter calcoaceticus PHEA-2]
          Length = 208

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/194 (52%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++SKETLEYHHD HH  Y  N   L    ++   +LEEII  + G  
Sbjct: 6   LPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  ID+ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ +LVNW+Y   +
Sbjct: 185 FLESLVNWDYANAK 198


>gi|226952607|ref|ZP_03823071.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
 gi|294649918|ref|ZP_06727311.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
 gi|226836687|gb|EEH69070.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
 gi|292824186|gb|EFF82996.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
          Length = 208

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++++ETLEYHHD HH  Y  N   L    ++   +LEEII  S G  
Sbjct: 6   LPALPYGYDDLAPHITRETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKASAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  ID+ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSITKTANADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ +LVNW+Y   +
Sbjct: 185 FLESLVNWDYANAK 198


>gi|300869320|ref|ZP_07113911.1| Superoxide dismutase (Fe) [Oscillatoria sp. PCC 6506]
 gi|300332697|emb|CBN59109.1| Superoxide dismutase (Fe) [Oscillatoria sp. PCC 6506]
          Length = 201

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 133/202 (65%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY  + L S  MS +T  +HHD HH  Y  N  KL    E+   SLEEI+  
Sbjct: 1   MAFELPPLPYPDNALESGNMSAKTFSFHHDKHHAAYVTNLNKLIEGTELADKSLEEIVSA 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLI 116
           S    S AG+FNNA+Q +NH  FW+C+K   G G VP  AL+D I  +FGSF+KFK +  
Sbjct: 61  SFKDSSKAGIFNNAAQVWNHTFFWSCLKP--GGGGVPTGALADKITADFGSFDKFKEEFK 118

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+TQFGSGW WL + NG L+++KT NAENPL++G  P+L +DVWEHAYYLDF+ RR  
Sbjct: 119 NAAATQFGSGWAWLVLDNGTLKVTKTANAENPLVHGQTPLLTLDVWEHAYYLDFQNRRPD 178

Query: 177 YIESFITNLVNWEYVCERYETA 198
           +I +F+ NL NW++  E    A
Sbjct: 179 FIANFLDNLANWDFAAENLAKA 200


>gi|170076871|ref|YP_001733509.1| Mn-superoxide dismutase [Synechococcus sp. PCC 7002]
 gi|169884540|gb|ACA98253.1| Mn-superoxide dismutase [Synechococcus sp. PCC 7002]
          Length = 199

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 95/200 (47%), Positives = 133/200 (66%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LP+LPY Y  L P++SK TLE+HHD HH +Y        +  +M   S+E++I  +
Sbjct: 1   MGYELPSLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNDAVAGTDMDSKSIEDVIKAV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            +  + AGLFNNA+Q +NH+ +W CMK   G G+   AL+D I+ +FGSF+KF     TA
Sbjct: 61  AADPAKAGLFNNAAQAWNHSFYWNCMKPG-GGGQPTGALADKINADFGSFDKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + NG L+++KT NA NP+  G  P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GGTQFGSGWAWLVLDNGTLKVTKTGNAGNPMTEGQTPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F+T+LVNW++V      A
Sbjct: 180 NTFLTSLVNWDFVAANLAAA 199


>gi|159026977|emb|CAO86696.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 199

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 132/200 (66%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY Y  L P ++K TLE+HHD HH  Y +N   L  D E+  LSLEE+I+K 
Sbjct: 1   MAYTLPPLPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL+  I+ +FGSFEKF     TA
Sbjct: 61  AGDASKAGVFNNAAQAWNHSFYWDCMKPGGGGAPT-GALAAKINADFGSFEKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADNPLTVGQVPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+T LVNW++V      A
Sbjct: 180 SDFLTKLVNWDFVAANLAAA 199


>gi|50084526|ref|YP_046036.1| superoxide dismutase [Acinetobacter sp. ADP1]
 gi|49530502|emb|CAG68214.1| superoxide dismutase [Fe] [Acinetobacter sp. ADP1]
          Length = 208

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 129/196 (65%), Gaps = 5/196 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPY+YD L P++SKETLEYHHD HH+ Y  N   L    E+    LE+II  S G
Sbjct: 4   ITLPALPYAYDALEPHISKETLEYHHDKHHQTYVTNLNNLIKGTELEGQELEDIIKASAG 63

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S AG+FNNA+Q +NH  +W  +  N G GK   AL+  ID+ FGS+EKF  +  TAA+
Sbjct: 64  DSSKAGIFNNAAQVWNHTFYWNSIAPNGG-GKPTGALAAKIDEAFGSYEKFAEEFTTAAT 122

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL     NGKL I+KT NA+ PL +G + +L IDVWEHAYY+D++  R  YI
Sbjct: 123 TQFGSGWAWLVADEINGKLSITKTSNADTPLAHGQVAVLTIDVWEHAYYIDYRNARPKYI 182

Query: 179 ESFITNLVNWEYVCER 194
            +F+ +LVNW+Y   +
Sbjct: 183 STFLESLVNWDYANAK 198


>gi|255318406|ref|ZP_05359639.1| superoxide dismutase [Acinetobacter radioresistens SK82]
 gi|262378636|ref|ZP_06071793.1| superoxide dismutase [Acinetobacter radioresistens SH164]
 gi|255304398|gb|EET83582.1| superoxide dismutase [Acinetobacter radioresistens SK82]
 gi|262299921|gb|EEY87833.1| superoxide dismutase [Acinetobacter radioresistens SH164]
          Length = 208

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/191 (51%), Positives = 127/191 (66%), Gaps = 5/191 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YD L P++SKETLE+HHD HH  Y  N +K     ++    L++II  + G  
Sbjct: 6   LPPLPYDYDALEPHISKETLEFHHDKHHNTYVVNLVKAIEGTDLEGKELDDIIKATAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W CM KN G GK    +++ ID  FGS+EKF  +  TAA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNCMTKNGG-GKATGPVAEKIDAAFGSYEKFAEEFATAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NG L I KT NA+ PL +G + IL IDVWEHAYY+D++  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGNLSIMKTSNADTPLAHGKVAILTIDVWEHAYYIDYRNARPKYIST 184

Query: 181 FITNLVNWEYV 191
           F+ +LVNWEYV
Sbjct: 185 FLESLVNWEYV 195


>gi|262372140|ref|ZP_06065419.1| superoxide dismutase [Acinetobacter junii SH205]
 gi|262312165|gb|EEY93250.1| superoxide dismutase [Acinetobacter junii SH205]
          Length = 208

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++++ETLEYHHD HH  Y  N   L    ++   SLEEII  S G  
Sbjct: 6   LPALPYGYDDLAPHITRETLEYHHDKHHNTYVVNLNNLIKGTDLEGKSLEEIIKASAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  I++ FGS++KF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIEEAFGSYDKFAEEFTAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G + +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSITKTSNADTPLAHGQVAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ +LVNW+Y   +
Sbjct: 185 FLESLVNWDYANAK 198


>gi|126729466|ref|ZP_01745280.1| Superoxide dismutase, Fe-Mn family protein [Sagittula stellata
           E-37]
 gi|126710456|gb|EBA09508.1| Superoxide dismutase, Fe-Mn family protein [Sagittula stellata
           E-37]
          Length = 199

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 135/201 (67%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS+ET+EYHHD+HHK Y DN  KL +  E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALASSGMSRETMEYHHDIHHKAYVDNGNKLIAGTEWEGKSVEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S A    G+FNNASQ++NH  FW  M  N  KG +P  L  AI D+FG+ +KFK D 
Sbjct: 61  TYNSGAVAQSGIFNNASQHWNHCQFWEMMGAN--KGAMPSELEAAIKDSFGTVDKFKEDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A   QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 AAAGGGQFGSGWAWL-VKDTDGGLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+++F+ NLVNWE V  R
Sbjct: 178 RPAYLQNFLDNLVNWENVASR 198


>gi|209526156|ref|ZP_03274687.1| Superoxide dismutase [Arthrospira maxima CS-328]
 gi|284053428|ref|ZP_06383638.1| Superoxide dismutase [Arthrospira platensis str. Paraca]
 gi|209493412|gb|EDZ93736.1| Superoxide dismutase [Arthrospira maxima CS-328]
          Length = 201

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LP+  D L S  MS  TL YHH  HH  Y  N        +M ++SLEEII  
Sbjct: 1   MAFELPSLPFDQDALESSKMSANTLSYHHGKHHAAYVKNLNAAIEGTDMANMSLEEIIKA 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           ++   S +G+FNNA+Q +NH+ FW C+K N G G+   AL+D I  +FGSF+ F  +   
Sbjct: 61  TYNDPSKSGIFNNAAQVWNHSFFWKCLKPN-GGGQPTGALADKIQADFGSFDAFIQEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL + NG L+++KT NA NP++ G  P+L +DVWEHAYYLDF+  R  +
Sbjct: 120 AAATQFGSGWAWLVLDNGTLKVTKTANAVNPMVEGKTPLLTLDVWEHAYYLDFQNARPGF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++FI NLVNW++V E   +A
Sbjct: 180 IDNFIENLVNWDFVAENLASA 200


>gi|16330619|ref|NP_441347.1| superoxide dismutase [Synechocystis sp. PCC 6803]
 gi|2500827|sp|P77968|SODF_SYNY3 RecName: Full=Superoxide dismutase [Fe]
 gi|1653111|dbj|BAA18027.1| superoxide dismutase [Synechocystis sp. PCC 6803]
          Length = 199

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 129/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LPNLPY Y  L P +SK TLE+HHD HH  Y +N     +  ++ + S+E++I  +
Sbjct: 1   MAYALPNLPYDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDNQSIEDVIKAV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA+Q +NH+ +W CMK   G G+   AL+D I+ +FGSF+ F      A
Sbjct: 61  AGDASKAGIFNNAAQAWNHSFYWNCMKPG-GGGQPSGALADKINADFGSFDAFVEAFKQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NAENP+  G  P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNAENPMTAGQTPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LVNW++V      A
Sbjct: 180 ADFLGKLVNWDFVAANLAAA 199


>gi|262376017|ref|ZP_06069248.1| superoxide dismutase [Acinetobacter lwoffii SH145]
 gi|262309111|gb|EEY90243.1| superoxide dismutase [Acinetobacter lwoffii SH145]
          Length = 214

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/197 (51%), Positives = 131/197 (66%), Gaps = 5/197 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPY Y+DL+P++SKETLEYHHD HH  Y  N   L +  E+   +LEEII  + G
Sbjct: 10  ITLPALPYGYEDLAPHISKETLEYHHDKHHNTYVVNLNNLIAGTELEGKTLEEIITATAG 69

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S AG+FNNA+Q +NH  +W CM KN G GK    L+  ID+ FGS+EKF  +   AA+
Sbjct: 70  DASKAGVFNNAAQVWNHTFYWNCMAKNGG-GKATGTLAAKIDEAFGSYEKFAEEFAAAAT 128

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL     NG+L I KT NA+ P+ +G I +L IDVWEHAYY+DF+  R  YI
Sbjct: 129 TQFGSGWAWLVADEVNGQLSIMKTSNADTPMAHGKIAVLTIDVWEHAYYIDFRNARPKYI 188

Query: 179 ESFITNLVNWEYVCERY 195
            +F+ +LVNW+Y   +Y
Sbjct: 189 STFLESLVNWDYANAKY 205


>gi|83858670|ref|ZP_00952192.1| superoxide dismutase [Oceanicaulis alexandrii HTCC2633]
 gi|83853493|gb|EAP91345.1| superoxide dismutase [Oceanicaulis alexandrii HTCC2633]
          Length = 198

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 133/200 (66%), Gaps = 4/200 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+ D L+P++S ETL +HH  HHK Y D A       +   LSLEE+I KS
Sbjct: 1   MAFTLPDLPYAQDALAPHISGETLSFHHGKHHKAYVDKANDAIKGTDYEGLSLEEVIKKS 60

Query: 61  HGS-NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
               N G+FNNA+Q +NH  +W  M  N G GK   A+++AID +FGS++KF  +   A 
Sbjct: 61  WSEKNMGVFNNAAQIWNHTFYWNSMSPNGG-GKPTGAIAEAIDKSFGSYDKFAEEFKAAG 119

Query: 120 STQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           + QFGSGW WL VKNG KLE+ KT NAENP+ +GA P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 AGQFGSGWAWL-VKNGDKLEVRKTLNAENPITDGATPLLTMDVWEHAYYLDYQNRRPDYI 178

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LVNW++  +   +A
Sbjct: 179 GDFLGKLVNWDFANQNLASA 198


>gi|163797602|ref|ZP_02191551.1| Superoxide dismutase [alpha proteobacterium BAL199]
 gi|159177077|gb|EDP61639.1| Superoxide dismutase [alpha proteobacterium BAL199]
          Length = 201

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 132/196 (67%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L+PYMS ETLE+HHD HH  Y  N   L  D+ +   SLEE++  S
Sbjct: 1   MAFELPPLPYAYDALAPYMSAETLEFHHDKHHNAYVVNGNNLLKDSGLEGKSLEEVVKAS 60

Query: 61  HGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           + ++  AGLFNNA+Q++NH  FW  MK   G G +P  L   I  +FGS  KFK D + A
Sbjct: 61  YKNDKLAGLFNNAAQHWNHIEFWQWMKPKGG-GAMPGELEKRIAADFGSVAKFKEDFVNA 119

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
             TQFGSGW WL+V  +GKL+++KT N  NP+  G   +LG DVWEH+YY+D++ RR  Y
Sbjct: 120 GVTQFGSGWCWLAVGSDGKLKVTKTANGVNPVALGETALLGCDVWEHSYYIDYRNRRPDY 179

Query: 178 IESFITNLVNWEYVCE 193
           +++F+ ++VNWE V E
Sbjct: 180 VKAFLDSMVNWERVAE 195


>gi|126657346|ref|ZP_01728505.1| superoxide dismutase [Cyanothece sp. CCY0110]
 gi|126621333|gb|EAZ92045.1| superoxide dismutase [Cyanothece sp. CCY0110]
          Length = 200

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 129/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LP LPY Y  L P++SK TLE+HHD HH +Y           +     +EE+I  I
Sbjct: 1   MGYELPKLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNAAVEGTDHDSKPIEEVIKAI 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S  GLFNNA+Q +NH+ +W CMK   G G+   AL+D I+ +FGSF+KF  +   A
Sbjct: 61  AGDASKQGLFNNAAQAWNHSFYWNCMKPG-GGGQPTGALADKINADFGSFDKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L++ KT NAENP+ +G  P+L +DVWEHAYYLD++  R  YI
Sbjct: 120 GATQFGSGWAWLVLNNGTLKVVKTLNAENPITSGQTPLLTMDVWEHAYYLDYQNSRPGYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++FI NL+NW++V +    A
Sbjct: 180 DTFINNLINWDFVADNMSKA 199


>gi|315499893|ref|YP_004088696.1| superoxide dismutase [Asticcacaulis excentricus CB 48]
 gi|315417905|gb|ADU14545.1| Superoxide dismutase [Asticcacaulis excentricus CB 48]
          Length = 203

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 128/200 (64%), Gaps = 2/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L P+MS  T  +HH  HHK Y DN  KL    E    SL EI+  S
Sbjct: 1   MAFELPALPYPTDALEPHMSANTFSFHHAKHHKAYVDNLNKLIDGTEFADKSLVEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+N G+FNNA+Q +NH  FW  MK N G G+   A++D I+ +FGSF+ F     TA +
Sbjct: 61  EGTNPGVFNNAAQVWNHTFFWHSMKPNGG-GQPTGAIADKINADFGSFDAFVEAFKTAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL + ++GKL++ KT NAE P   G  PIL +DVWEHAYYLD++  R  +IE
Sbjct: 120 TQFGSGWAWLVLGQDGKLKVVKTGNAETPFTKGDKPILTLDVWEHAYYLDYQNLRPKFIE 179

Query: 180 SFITNLVNWEYVCERYETAM 199
           +++T+LVNW++     +  +
Sbjct: 180 TYLTSLVNWDFANSNLDAPL 199


>gi|114570445|ref|YP_757125.1| superoxide dismutase [Maricaulis maris MCS10]
 gi|114340907|gb|ABI66187.1| Superoxide dismutase [Maricaulis maris MCS10]
          Length = 201

 Score =  197 bits (502), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (63%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+ D L+P++S +TL++HH  HH  Y      L    ++  LSLE++I K+
Sbjct: 1   MAFTLPDLPYAKDALAPHISSQTLDFHHGKHHNAYVGKLNGLVEGTDLAALSLEDVIKKT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  + AG+FNNA+Q +NH  +W  M+ N G G     L+  ID +FGS + FK+    A
Sbjct: 61  AGNSAKAGIFNNAAQIWNHTFYWQSMRPN-GGGAPSGDLAAMIDRDFGSLDAFKTAFADA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WL +  GKLE+ KT NAE PL  +G  P+L +DVWEHAYYLDF+ RR  Y
Sbjct: 120 GATQFGSGWAWLVLAGGKLEVRKTLNAETPLTEDGVTPLLTMDVWEHAYYLDFQNRRPDY 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I +F+  LVNWE+  E    A
Sbjct: 180 ITTFLDKLVNWEFAAENLAAA 200


>gi|194334011|ref|YP_002015871.1| Superoxide dismutase [Prosthecochloris aestuarii DSM 271]
 gi|194311829|gb|ACF46224.1| Superoxide dismutase [Prosthecochloris aestuarii DSM 271]
          Length = 201

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++ P+LPY+ + L PY+S  T+ +H+  HH  Y     ++ +   +   S+EE++  +
Sbjct: 1   MAYQQPSLPYAENALEPYISANTISFHYGKHHATYVKKFNEMVAGTPLDQQSIEEVVKTV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNN +Q +NH+ +W C+   DG GK   +L+D ID +FGS++ F+ +L  A
Sbjct: 61  AGDASKAGIFNNGAQAWNHSFYWNCLSP-DGGGKPSGSLADKIDQDFGSYDTFREELANA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+++KT NA+ P+  G  PIL IDVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVTKTANAQTPVTEGMTPILTIDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            S I NLVNW++    +E A
Sbjct: 180 ASLIDNLVNWDFATSNFEAA 199


>gi|332717240|ref|YP_004444706.1| Superoxide dismutase [Agrobacterium sp. H13-3]
 gi|325063925|gb|ADY67615.1| Superoxide dismutase [Agrobacterium sp. H13-3]
          Length = 199

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 134/200 (67%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+P  MS+ETL++HHD+HHK Y DN  K  S  E  + SLEEI+  
Sbjct: 1   MAFQLPDLPYAHDALAPSGMSEETLKFHHDLHHKAYVDNLNKAISGTEWENSSLEEIVRA 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNNASQ++NHNLFW  M     K  +P+ L DA+  +FGS   FK + 
Sbjct: 61  TYEKGAVAQSGIFNNASQHWNHNLFWEIMGPQ--KHAIPKVLEDALTQSFGSVALFKQNF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A ++QFGSGW WL    +G L+I++T+N  NPL  G   ILG DVWEH+YY+DF+ +R
Sbjct: 119 ALAGASQFGSGWAWLVADTDGTLKITRTENGVNPLCFGQKAILGCDVWEHSYYIDFRSKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             YIE+F+ NLVNW+ V  R
Sbjct: 179 PAYIENFLDNLVNWQTVAAR 198


>gi|134647|sp|P18655|SODF_SYNE7 RecName: Full=Superoxide dismutase [Fe]
 gi|79688|pir||S04423 superoxide dismutase (EC 1.15.1.1) (Fe) - Synechococcus sp
 gi|6018363|emb|CAB57855.1| superoxide dismutase [Synechococcus elongatus PCC 7942]
          Length = 201

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 128/192 (66%), Gaps = 3/192 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LP LP+ Y  L+PY++KETLE+HHD HH  Y +N      D ++    +E +I  I
Sbjct: 1   MSYELPALPFDYTALAPYITKETLEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAI 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AGLFNNA+Q +NH+ +W  +K N G G    AL+D I  +FGSFE F ++   A
Sbjct: 61  AGDASKAGLFNNAAQAWNHSFYWNSIKPN-GGGAPTGALADKIAADFGSFENFVTEFKQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+I+KT NA+ P+ +G  P+L IDVWEHAYYLD++ RR  YI
Sbjct: 120 AATQFGSGWAWLVLDNGTLKITKTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEY 190
            +F+  L NW++
Sbjct: 180 STFVEKLANWDF 191


>gi|159464723|ref|XP_001690591.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gi|158280091|gb|EDP05850.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gi|257071857|gb|ACV41089.1| chloroplast Fe superoxide dismutase 1 precursor [Chlamydomonas
           reinhardtii]
          Length = 234

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 128/199 (64%), Gaps = 4/199 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS-- 60
            +L + PY+ D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S  
Sbjct: 35  LELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLASWN 94

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G    +FNNA+Q +NH  FW  MK N G G    AL++AI  +FGS +KFK +   A  
Sbjct: 95  NGQPTPVFNNAAQVWNHTFFWESMKPNGG-GAPTGALAEAITRDFGSLDKFKEEFKQAGM 153

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL+  K GKL ISK+ NA NP++ G  PIL +DVWEHAYY+D + RR  YI 
Sbjct: 154 TQFGSGWAWLNADKTGKLSISKSPNAVNPVVEGKTPILTVDVWEHAYYIDVQNRRPDYIT 213

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+  L+NW+ V +RY  A
Sbjct: 214 TFMEKLINWDAVAQRYAAA 232


>gi|81299612|ref|YP_399820.1| superoxide dismutase [Synechococcus elongatus PCC 7942]
 gi|81168493|gb|ABB56833.1| Superoxide dismutase [Synechococcus elongatus PCC 7942]
          Length = 229

 Score =  197 bits (500), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 128/192 (66%), Gaps = 3/192 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LP LP+ Y  L+PY++KETLE+HHD HH  Y +N      D ++    +E +I  I
Sbjct: 29  MSYELPALPFDYTALAPYITKETLEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAI 88

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AGLFNNA+Q +NH+ +W  +K N G G    AL+D I  +FGSFE F ++   A
Sbjct: 89  AGDASKAGLFNNAAQAWNHSFYWNSIKPNGG-GAPTGALADKIAADFGSFENFVTEFKQA 147

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+I+KT NA+ P+ +G  P+L IDVWEHAYYLD++ RR  YI
Sbjct: 148 AATQFGSGWAWLVLDNGTLKITKTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYI 207

Query: 179 ESFITNLVNWEY 190
            +F+  L NW++
Sbjct: 208 STFVEKLANWDF 219


>gi|726293|gb|AAB04944.1| superoxide dismutase precursor [Chlamydomonas reinhardtii]
          Length = 234

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 128/199 (64%), Gaps = 4/199 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS-- 60
            +L + PY+ D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S  
Sbjct: 35  LELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLASWN 94

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G    +FNNA+Q +NH  FW  MK N G G    AL++AI  +FGS +KFK +   A  
Sbjct: 95  NGQPTPVFNNAAQVWNHTFFWESMKPNGG-GAPTGALAEAITRDFGSLDKFKEEFKQAGM 153

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL+  K GKL ISK+ NA NP++ G  PIL +DVWEHAYY+D + RR  YI 
Sbjct: 154 TQFGSGWAWLNADKTGKLSISKSPNAVNPVVEGKTPILTVDVWEHAYYIDVQNRRPDYIT 213

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+  L+NW+ V +RY  A
Sbjct: 214 TFMEKLINWDAVAQRYARA 232


>gi|77463244|ref|YP_352748.1| Fe/Mn family superoxide dismutase [Rhodobacter sphaeroides 2.4.1]
 gi|221639107|ref|YP_002525369.1| Superoxide dismutase [Rhodobacter sphaeroides KD131]
 gi|332558122|ref|ZP_08412444.1| superoxide dismutase [Rhodobacter sphaeroides WS8N]
 gi|77387662|gb|ABA78847.1| Superoxide dismutase, Fe-Mn family [Rhodobacter sphaeroides 2.4.1]
 gi|221159888|gb|ACM00868.1| Superoxide dismutase [Rhodobacter sphaeroides KD131]
 gi|332275834|gb|EGJ21149.1| superoxide dismutase [Rhodobacter sphaeroides WS8N]
          Length = 199

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 132/200 (66%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MSKET+EYHHD+HHK Y DN  KL +  E    S+EEI+  
Sbjct: 1   MAFTLPDLPYAHDALAALGMSKETMEYHHDIHHKAYVDNGNKLIAGTEWEGKSVEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S A    G+FNNASQ++NH  FW  M    G+ K+P  L  A+ D+FGS EKFK D 
Sbjct: 61  TYQSGAVAQNGIFNNASQHWNHTQFWEMM--GPGEKKMPGELEKALVDSFGSVEKFKEDF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   ++G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKDQDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+  LVNWE V  R
Sbjct: 179 PAYLSNFLEKLVNWENVASR 198


>gi|116749202|ref|YP_845889.1| superoxide dismutase [Syntrophobacter fumaroxidans MPOB]
 gi|116698266|gb|ABK17454.1| Superoxide dismutase [Syntrophobacter fumaroxidans MPOB]
          Length = 197

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 128/193 (66%), Gaps = 3/193 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY+ + L P++S  TLE+HH  HHK Y D   KL +  E  +   E ++ K 
Sbjct: 1   MSLTLPDLPYAKNALEPHISARTLEFHHGKHHKAYVDMGNKLTAGTEFENADPEAVLKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH  +W CMK N G G    A++  I+ +FGSFEKF  +   A
Sbjct: 61  VGDASKAGMFNNVAQAWNHAFYWKCMKPNGG-GAPTGAVAQKINADFGSFEKFAEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL +KNGKLE++KT NA+ P+ +G  P+L +DVWEHAYYLD++  RA+Y+
Sbjct: 120 GMTQFGSGWAWLVLKNGKLEVTKTPNADTPVAHGVKPLLVVDVWEHAYYLDYQNLRANYL 179

Query: 179 ESFITNLVNWEYV 191
            +F+  L+NW++V
Sbjct: 180 ATFVEKLINWDFV 192


>gi|126462118|ref|YP_001043232.1| superoxide dismutase [Rhodobacter sphaeroides ATCC 17029]
 gi|126103782|gb|ABN76460.1| Superoxide dismutase [Rhodobacter sphaeroides ATCC 17029]
          Length = 199

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 132/200 (66%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MSKET+EYHHD+HHK Y DN  KL +  E    S+EEI+  
Sbjct: 1   MAFTLPDLPYAHDALAALGMSKETMEYHHDIHHKAYVDNGNKLIAGTEWEGKSVEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S A    G+FNNASQ++NH  FW  +    G+ K+P  L  A+ D+FGS EKFK D 
Sbjct: 61  TYQSGAVAQNGIFNNASQHWNHTQFWEML--GPGEKKMPGELEKALVDSFGSVEKFKEDF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   ++G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKDQDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+  LVNWE V  R
Sbjct: 179 PAYLSNFLEKLVNWENVASR 198


>gi|84684673|ref|ZP_01012573.1| Superoxide dismutase, Fe-Mn family protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667008|gb|EAQ13478.1| Superoxide dismutase, Fe-Mn family protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 199

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 133/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MSKET+EYHHD+HHK Y DN  K  +  E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALADLGMSKETMEYHHDIHHKAYVDNGNKAIAGTEWEGKSVEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNNASQY+NHN FW  M    G+ K+P  L  A+ + FGS +KFK D 
Sbjct: 61  TYDPKAVAQSGIFNNASQYWNHNQFWEMM--GPGEKKMPGELEKALTEAFGSVDKFKEDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|302808782|ref|XP_002986085.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
 gi|300146233|gb|EFJ12904.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
          Length = 208

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 5/199 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY  + L P+MSK TLE+H   H + Y DN  K  S  E+  L LE+II K++G
Sbjct: 8   FELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIITKTYG 67

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
                  FNNA+Q +NH+ F+  M    GK   P   +S  I+ + GS++ F  +  TAA
Sbjct: 68  GGNAQPSFNNAAQAWNHDFFFHSMTAKGGKA--PSGDISGLINRDLGSYDNFVKEFKTAA 125

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           +TQFGSGW WLS+K+GKL + KT NA NPL++G  P+L +DVWEHAYYLDF+ RR  Y+E
Sbjct: 126 TTQFGSGWAWLSLKDGKLIVQKTANAVNPLVSGETPLLVLDVWEHAYYLDFQNRRPDYVE 185

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+  LVNW+ V  R ETA
Sbjct: 186 TFLRELVNWDTVNARLETA 204


>gi|56750746|ref|YP_171447.1| superoxide dismutase [Synechococcus elongatus PCC 6301]
 gi|56685705|dbj|BAD78927.1| superoxide dismutase [Synechococcus elongatus PCC 6301]
          Length = 229

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/192 (47%), Positives = 128/192 (66%), Gaps = 3/192 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           + ++LP LP+ Y  L+PY++KETLE+HHD HH  Y +N      D ++    +E +I  I
Sbjct: 29  VSYELPALPFDYTALAPYITKETLEFHHDKHHAAYINNYNNAVEDTDLDGQPIEAVIKAI 88

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AGLFNNA+Q +NH+ +W  +K N G G    AL+D I  +FGSFE F ++   A
Sbjct: 89  AGDASKAGLFNNAAQAWNHSFYWNSIKPN-GGGAPTGALADKIAADFGSFENFVTEFKQA 147

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+I+KT NA+ P+ +G  P+L IDVWEHAYYLD++ RR  YI
Sbjct: 148 AATQFGSGWAWLVLDNGTLKITKTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYI 207

Query: 179 ESFITNLVNWEY 190
            +F+  L NW++
Sbjct: 208 STFVEKLANWDF 219


>gi|56697199|ref|YP_167563.1| superoxide dismutase, Fe [Ruegeria pomeroyi DSS-3]
 gi|56678936|gb|AAV95602.1| superoxide dismutase, Fe [Ruegeria pomeroyi DSS-3]
          Length = 199

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 133/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +D E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIADTEWDGKSMEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  +A    G+FNN SQ +NHN FW  M    G+ K+P  L  AI ++FGS ++FKS  
Sbjct: 61  TYDKSAVAQNGIFNNISQLWNHNQFWEMMGP--GESKMPGELEKAIAESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKNADGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|85859098|ref|YP_461300.1| superoxide dismutase (Fe) [Syntrophus aciditrophicus SB]
 gi|85722189|gb|ABC77132.1| superoxide dismutase (Fe) [Syntrophus aciditrophicus SB]
          Length = 203

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 3/192 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP+LPY  + L PY+S  TLE+HH  HH+ Y DNA KL  +  +L+ ++E +I K+    
Sbjct: 11  LPDLPYPKNALEPYISARTLEFHHGKHHQAYVDNANKLLPEMVLLNETMESVIEKTSADP 70

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S  G+FNN +Q +NH  +W CMK N G G+    ++  I D +GSFEKF  +   A  TQ
Sbjct: 71  SKVGIFNNVAQVWNHTFYWNCMKPNGG-GQPTGNIAVRIKDTWGSFEKFAEEFKNAGMTQ 129

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL ++   L+I KT NA+NPL +G  P+L +DVWEHAYYLD++ RRA Y+ +F+
Sbjct: 130 FGSGWAWLVLEQDSLKIVKTGNADNPLTHGQKPLLTVDVWEHAYYLDYQNRRAEYLNTFV 189

Query: 183 TNLVNWEYVCER 194
             L+NW++V  R
Sbjct: 190 DKLINWDFVNSR 201


>gi|85707205|ref|ZP_01038291.1| superoxide dismutase, Fe [Roseovarius sp. 217]
 gi|85668259|gb|EAQ23134.1| superoxide dismutase, Fe [Roseovarius sp. 217]
          Length = 199

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 131/200 (65%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII- 58
           M F+LP+LPY++D L+ + MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALAAHGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSLEEIITG 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
              KS  + +G+FNN SQ +NHN FW  M     K  +P AL  AI ++FGS +KFK   
Sbjct: 61  TYDKSAVAQSGIFNNISQLWNHNQFWEMMSPT--KTGMPGALEKAITESFGSVDKFKEAF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   K+G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKDKDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+ NLVNWE V  R
Sbjct: 179 PAYLTNFLDNLVNWENVASR 198


>gi|260575158|ref|ZP_05843159.1| Superoxide dismutase [Rhodobacter sp. SW2]
 gi|259022780|gb|EEW26075.1| Superoxide dismutase [Rhodobacter sp. SW2]
          Length = 199

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 132/200 (66%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+P  MS+ETLEYHHD+HHK Y DN  KL +  E    S+E+I+  
Sbjct: 1   MAFTLPDLPYAHDALAPLGMSRETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSVEDIVTG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S A    G+FNNASQ++NH LFW  M        +P AL  A+ ++FGS +KFK D 
Sbjct: 61  TYVSGAVAQSGIFNNASQHWNHALFWEVMGPK--AHSLPGALEKALVESFGSVQKFKDDF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   K+G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 AAAGAGQFGSGWAWLVRDKDGSLKVTKTENGVNPLCFGQKALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+  LVNWE V  R
Sbjct: 179 PAYLANFLDKLVNWEAVAAR 198


>gi|254293775|ref|YP_003059798.1| superoxide dismutase [Hirschia baltica ATCC 49814]
 gi|254042306|gb|ACT59101.1| Superoxide dismutase [Hirschia baltica ATCC 49814]
          Length = 196

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 126/199 (63%), Gaps = 5/199 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P+MS  T  +HH  HH  Y  N  K+    +    SLEEII  S
Sbjct: 1   MAFELPALPYATDALEPHMSANTFSFHHAKHHNAYVTNLNKMIEGTDFAGKSLEEIIKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  MK   G G+   A++D I+ +FGS+  FK    TA +
Sbjct: 61  DG---GVFNNAAQVWNHTFFWHSMKPQGG-GEPTGAIADKINADFGSYAAFKEAFATAGA 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL + NGKLE+ KT NAE PL  +G  P+L +DVWEHAYYLD++  R  YIE
Sbjct: 117 TQFGSGWAWLVLANGKLEVRKTPNAETPLTEDGVTPLLTMDVWEHAYYLDYQNARPVYIE 176

Query: 180 SFITNLVNWEYVCERYETA 198
           +F++ LVNW++V +    A
Sbjct: 177 TFLSELVNWDFVNQNLADA 195


>gi|262369512|ref|ZP_06062840.1| superoxide dismutase [Acinetobacter johnsonii SH046]
 gi|262315580|gb|EEY96619.1| superoxide dismutase [Acinetobacter johnsonii SH046]
          Length = 208

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 130/195 (66%), Gaps = 5/195 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS--HG 62
           LP LPY Y+DL+P++SKETLE+HHD HH  Y  N   L    ++   +LEEII  S    
Sbjct: 6   LPALPYGYEDLAPHISKETLEFHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIITASACDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W CM KN G GK   AL+  ID+ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNCMAKNGG-GKATGALAAKIDEAFGSYEKFAEEFAAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NG L I KT NA+ PL +G + +L IDVWEHAYY+DF+  R  YI++
Sbjct: 125 FGSGWAWLVADEVNGNLSILKTSNADTPLAHGKVAVLTIDVWEHAYYIDFRNARPVYIKT 184

Query: 181 FITNLVNWEYVCERY 195
           F+ +LVNW+Y   +Y
Sbjct: 185 FLESLVNWDYANAKY 199


>gi|312962697|ref|ZP_07777186.1| superoxide dismutase (fe) [Pseudomonas fluorescens WH6]
 gi|311283072|gb|EFQ61664.1| superoxide dismutase (fe) [Pseudomonas fluorescens WH6]
          Length = 198

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL NG  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTNGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|260433287|ref|ZP_05787258.1| superoxide dismutase (Fe) [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417115|gb|EEX10374.1| superoxide dismutase (Fe) [Silicibacter lacuscaerulensis ITI-1157]
          Length = 199

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 133/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII+ 
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSLEEIIVG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNN SQ +NHN FW  M     + K+P  L  A+ +NFGS ++FKS  
Sbjct: 61  TYQAGAVAQNGIFNNISQLWNHNQFWEMMTP--AESKMPGELEKALVENFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+D++ +
Sbjct: 119 AAAGAGQFGSGWAWL-VKNADGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDYRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+++F+ NLVNWE V  R
Sbjct: 178 RPAYLDNFLNNLVNWENVASR 198


>gi|1711435|sp|P50061|SODF_PLEBO RecName: Full=Superoxide dismutase [Fe]
 gi|608558|gb|AAA69954.1| superoxide dismutase [Leptolyngbya boryana]
          Length = 199

 Score =  194 bits (492), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 126/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+  D L PY M  ET +YH+  HH  Y  N  KL     M  LSLE++I +
Sbjct: 1   MAFTQPPLPFPKDALEPYGMKAETFDYHYGKHHAAYVTNLNKLVEGTPMESLSLEDVIKQ 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLI 116
           S G  S  G+FNNA+Q +NH  FW C+K   G G  P   L+  ID  FGS +KFK +  
Sbjct: 61  SFGDSSKVGVFNNAAQVWNHTFFWNCLKA--GGGGAPTGELAAKIDAAFGSLDKFKEEFS 118

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+TQFGSGW WL    G L+++KT NAENPL++G  P+L +DVWEHAYYLDF+  R  
Sbjct: 119 NAAATQFGSGWAWLVDDGGTLKVTKTPNAENPLVHGQKPLLTLDVWEHAYYLDFQNARPA 178

Query: 177 YIESFITNLVNWEYVCE 193
           +I++F+ NLVNW++V +
Sbjct: 179 FIKNFLDNLVNWDFVAQ 195


>gi|254477753|ref|ZP_05091139.1| superoxide dismutase (Fe) [Ruegeria sp. R11]
 gi|214031996|gb|EEB72831.1| superoxide dismutase (Fe) [Ruegeria sp. R11]
          Length = 199

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 134/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +  E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSMEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +NA    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ D+FGS +KFK + 
Sbjct: 61  TYDANAVAQNGIFNNISQLWNHNQFWEMMGP--GESKMPGELEKALVDSFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGGLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|302828926|ref|XP_002946030.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
 gi|121077704|gb|ABM47310.1| superoxide dismutase [Volvox carteri f. nagariensis]
 gi|300268845|gb|EFJ53025.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
          Length = 233

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 129/201 (64%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           ++ K P  PY  D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S
Sbjct: 34  LELKAP--PYPLDALEPHMSKQTLEFHWGKHHRAYVDNMNKQIAGTPLDGKSLEEIVLAS 91

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
              G+   +FNNA+Q +NH  FW  MK N G G     L++AI  +FGSF+KFK +  TA
Sbjct: 92  WNGGNPTPVFNNAAQVWNHTFFWESMKANGG-GAPTGKLAEAIARDFGSFDKFKEEFKTA 150

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
             TQFGSGW WL+  K+GKL ISK+ NA  P++ G  PIL +DVWEHAYY+D + RR  Y
Sbjct: 151 GMTQFGSGWAWLNADKSGKLSISKSPNAVTPVVEGKTPILTVDVWEHAYYIDVQNRRPDY 210

Query: 178 IESFITNLVNWEYVCERYETA 198
           + +FI  L++W+ V +RY  A
Sbjct: 211 LTTFIEKLIDWDVVAQRYAAA 231


>gi|22299062|ref|NP_682309.1| superoxide dismutase [Thermosynechococcus elongatus BP-1]
 gi|22295244|dbj|BAC09071.1| superoxide dismutase [Thermosynechococcus elongatus BP-1]
          Length = 200

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 134/202 (66%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+    L PY MS +TLE+H+  HHK Y DN  KL  D E+   SLE++I  
Sbjct: 1   MAFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRT 60

Query: 60  SHGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLI 116
           ++G  A  G+FNNA+Q +NH  FW  +K   G G VP   ++  I+  FGS+++FK+   
Sbjct: 61  TYGDAAKVGIFNNAAQVWNHTFFWNSLKP--GGGGVPTGDVAARINSAFGSYDEFKAQFK 118

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+TQFGSGW WL ++ G L+++KT NAENPL++G +P+L IDVWEHAYYLD++ RR  
Sbjct: 119 NAAATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPD 178

Query: 177 YIESFITNLVNWEYVCERYETA 198
           +I++F+  LVNW++V +    A
Sbjct: 179 FIDNFLNQLVNWDFVAKNLAAA 200


>gi|86607458|ref|YP_476221.1| superoxide dismutase, Fe [Synechococcus sp. JA-3-3Ab]
 gi|86556000|gb|ABD00958.1| superoxide dismutase, Fe [Synechococcus sp. JA-3-3Ab]
          Length = 199

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 125/191 (65%), Gaps = 3/191 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L PYMS ET  YHH  HH  Y  N  KL    E+ + SLEEII  +
Sbjct: 1   MAFELPALPYPADALKPYMSAETFSYHHGKHHAAYVANLNKLIEGTELANKSLEEIIKTT 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G     G+FNNA+Q +NH  FW  MK   G       ++D I+ +FG ++KF     TA
Sbjct: 61  FGDPDKVGIFNNAAQVWNHTFFWESMKPGGGGAPT-GPIADKINADFGGYDKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+++KT NAENPL++G +P+L +DVWEHAYYLD++ RR  +I
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVTKTPNAENPLVHGQVPLLTLDVWEHAYYLDYQNRRPDFI 179

Query: 179 ESFITNLVNWE 189
            +++ +LVNW+
Sbjct: 180 SAYLEHLVNWD 190


>gi|302800493|ref|XP_002982004.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
 gi|300150446|gb|EFJ17097.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
          Length = 208

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 129/199 (64%), Gaps = 5/199 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY  + L P+MSK TLE+H   H + Y DN  K  S  E+  L LE+II K++G
Sbjct: 8   FELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIITKTYG 67

Query: 63  SNAG--LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
                  FNNA+Q +NH+ F+  M    GK   P   +S  I+ + GS++ F  +   AA
Sbjct: 68  GGNAQPAFNNAAQAWNHDFFFHSMTAKGGKA--PSGDISGLINRDLGSYDNFVKEFKAAA 125

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           +TQFGSGW WLS+K+GKL + KT NA NPL++G  P+L +DVWEHAYYLDF+ RR  Y+E
Sbjct: 126 TTQFGSGWAWLSLKDGKLIVQKTANAVNPLVSGETPLLVLDVWEHAYYLDFQNRRPDYVE 185

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+  LVNW+ V  R ETA
Sbjct: 186 TFLRELVNWDTVNARLETA 204


>gi|159186233|ref|NP_356077.2| superoxide dismutase [Agrobacterium tumefaciens str. C58]
 gi|159141367|gb|AAK88862.2| superoxide dismutase [Agrobacterium tumefaciens str. C58]
          Length = 199

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/200 (47%), Positives = 134/200 (67%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+P  MS+ETL++HHD+HHK Y DN  K  +  E    SLE+I+  
Sbjct: 1   MAFQLPDLPYTHDALAPSGMSEETLKFHHDLHHKAYVDNLNKAITGTEWEKSSLEDIVRG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNNASQ++NHNLFW  M   +    +P  L DA+  +FG+   FK + 
Sbjct: 61  TYEKGAVAQSGIFNNASQHWNHNLFWEIMGPQNHA--IPSPLEDALTQSFGTVALFKQNF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A ++QFGSGW WL V  +GKL+I++T+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 ALAGASQFGSGWAWLVVDTDGKLKITRTENGVNPLCFGQKALLGCDVWEHSYYIDFRTKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+E+F+ NLVNW+ V  R
Sbjct: 179 PAYVENFLDNLVNWQAVAAR 198


>gi|300024055|ref|YP_003756666.1| superoxide dismutase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525876|gb|ADJ24345.1| Superoxide dismutase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 196

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/192 (50%), Positives = 131/192 (68%), Gaps = 2/192 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  KLP+LPY+YD L+P+MS ETLE+HHD HH  Y DN  KL + ++    SLE+I   +
Sbjct: 1   MTLKLPDLPYAYDALTPFMSAETLEFHHDKHHLAYVDNGNKLLAGSKYEGQSLEDICKNA 60

Query: 61  HG-SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           +   NAG+ NN  Q++NH  FW  MKK  G  K+P  +   +D  +G F+K + D I A 
Sbjct: 61  YADKNAGIINNVGQHWNHLHFWQWMKKGGGGKKLPGKIEKLVD-GYGGFDKVRGDFIEAG 119

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             QFGSGW WL +K+GKL + KT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E
Sbjct: 120 KGQFGSGWAWLVIKDGKLNVQKTPNGENPLMHGAKPILGVDVWEHSYYIDYRNARPKYLE 179

Query: 180 SFITNLVNWEYV 191
           ++  NLVNWE+V
Sbjct: 180 AWFDNLVNWEHV 191


>gi|229592247|ref|YP_002874366.1| putative superoxide dismutase [Pseudomonas fluorescens SBW25]
 gi|229364113|emb|CAY51733.1| putative superoxide dismutase [Pseudomonas fluorescens SBW25]
          Length = 198

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|20139970|sp|O30970|SODF_RHOCA RecName: Full=Superoxide dismutase [Fe]
 gi|2511749|gb|AAC64207.1| superoxide dismutase [Rhodobacter capsulatus]
          Length = 200

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 133/201 (66%), Gaps = 9/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY++D L+   MSKETLEYHHD+HHK Y DN  KL +  E    S+EEI+  
Sbjct: 1   MAFELPALPYAHDALASLGMSKETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSVEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNNASQ++NH  FW  M   + K K+P AL  A+ ++FGS  KFK D 
Sbjct: 61  TYCAGAVAQSGIFNNASQHWNHAQFWEMMGPGEDK-KMPGALEKALVESFGSVAKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 120 AAAGAGQFGSGWAWL-VKDSDGALKITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 178

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+  LVNWE V  R
Sbjct: 179 RPAYLTNFLDKLVNWENVASR 199


>gi|99080817|ref|YP_612971.1| superoxide dismutase [Ruegeria sp. TM1040]
 gi|99037097|gb|ABF63709.1| Superoxide dismutase [Ruegeria sp. TM1040]
          Length = 199

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 133/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  +A    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ ++FGS EKFK + 
Sbjct: 61  TYNKDAVAQNGIFNNISQLWNHNQFWEMM--GPGESKMPTELEKALVESFGSVEKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGGLKVTKTENGVNPLCFGQAALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLSNFLDNLVNWENVASR 198


>gi|34810954|pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-Superoxide Dismutase From The
           Thermophilic Cyanobacterium Thermosynechococcus
           Elongatus : Correlation Of Epr And Structural
           Characteristics
 gi|34810955|pdb|1MY6|B Chain B, The 1.6 A Structure Of Fe-Superoxide Dismutase From The
           Thermophilic Cyanobacterium Thermosynechococcus
           Elongatus : Correlation Of Epr And Structural
           Characteristics
          Length = 199

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 132/195 (67%), Gaps = 6/195 (3%)

Query: 8   LPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNA- 65
           LP+    L PY MS +TLE+H+  HHK Y DN  KL  D E+   SLE++I  ++G  A 
Sbjct: 7   LPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTTYGDAAK 66

Query: 66  -GLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAASTQF 123
            G+FNNA+Q +NH  FW  +K   G G VP   ++  I+  FGS+++FK+    AA+TQF
Sbjct: 67  VGIFNNAAQVWNHTFFWNSLKP--GGGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQF 124

Query: 124 GSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFIT 183
           GSGW WL ++ G L+++KT NAENPL++G +P+L IDVWEHAYYLD++ RR  +I++F+ 
Sbjct: 125 GSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFIDNFLN 184

Query: 184 NLVNWEYVCERYETA 198
            LVNW++V +    A
Sbjct: 185 QLVNWDFVAKNLAAA 199


>gi|70732151|ref|YP_261907.1| superoxide dismutase (Fe) [Pseudomonas fluorescens Pf-5]
 gi|68346450|gb|AAY94056.1| superoxide dismutase (fe) [Pseudomonas fluorescens Pf-5]
          Length = 198

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|262278357|ref|ZP_06056142.1| superoxide dismutase [Acinetobacter calcoaceticus RUH2202]
 gi|299769305|ref|YP_003731331.1| superoxide dismutase [Acinetobacter sp. DR1]
 gi|262258708|gb|EEY77441.1| superoxide dismutase [Acinetobacter calcoaceticus RUH2202]
 gi|298699393|gb|ADI89958.1| superoxide dismutase [Acinetobacter sp. DR1]
          Length = 208

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 130/194 (67%), Gaps = 5/194 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY YDDL+P++SKETLEYHHD HH  Y  N   L    ++   +LEEII  + G  
Sbjct: 6   LPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDA 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S AG+FNNA+Q +NH  +W  MK N G GK   A++  I++ FGS+EKF  +   AA+TQ
Sbjct: 66  SKAGIFNNAAQVWNHTFYWNSMKPNGG-GKPTGAIAAKIEEAFGSYEKFAEEFAAAATTQ 124

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL     NGKL I+KT NA+ PL +G I +L IDVWEHAYY+DF+  R  YI +
Sbjct: 125 FGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIAT 184

Query: 181 FITNLVNWEYVCER 194
           F+ +LVNW+Y   +
Sbjct: 185 FLESLVNWDYANAK 198


>gi|114771855|ref|ZP_01449248.1| superoxide dismutase, Fe [alpha proteobacterium HTCC2255]
 gi|114547671|gb|EAU50562.1| superoxide dismutase, Fe [alpha proteobacterium HTCC2255]
          Length = 202

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 134/205 (65%), Gaps = 10/205 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPYS+D L+   MS ETLE+HHD+HHK Y DN  KL S  E  + SLEEI I 
Sbjct: 1   MAFELPELPYSHDALAKGGMSAETLEFHHDLHHKAYVDNGNKLISGTEWENKSLEEITIG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S +    G+FNN SQ +NHN FW  M   DG+  +P  L  AI ++FGS E FKSD 
Sbjct: 61  TYNSTSVSQNGIFNNISQLWNHNQFWEMMGP-DGRA-MPSELEAAIVESFGSVEAFKSDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A   QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 GAAGVGQFGSGWCWL-VKDTDGSLKITKTENGVNPLCFGQKTLLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R  YI +F+ NLVNWE V  R  ++
Sbjct: 178 RPVYISNFLDNLVNWENVAARLASS 202


>gi|149913933|ref|ZP_01902465.1| Superoxide dismutase [Roseobacter sp. AzwK-3b]
 gi|149812217|gb|EDM72048.1| Superoxide dismutase [Roseobacter sp. AzwK-3b]
          Length = 199

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPYS+D L+ + MS+ETLEYHHD+HHK Y DN  K  +  E    S+EEII  
Sbjct: 1   MAFELPDLPYSHDALADHGMSRETLEYHHDIHHKAYVDNGNKAVAGTEWEGKSVEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNNASQ++NHN FW  M    G   +P  L  A+ ++FGS + FK   
Sbjct: 61  TYDPKAVAQNGIFNNASQFWNHNQFWEMMAP--GGTGMPGELEKALVESFGSVDTFKEQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 AAAGAGQFGSGWAWL-VKDTDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  YI++F+ NLVNWE V  R
Sbjct: 178 RPAYIQNFLDNLVNWENVASR 198


>gi|158336801|ref|YP_001517975.1| superoxide dismutase Mn/Fe domain-containing protein [Acaryochloris
           marina MBIC11017]
 gi|158307042|gb|ABW28659.1| superoxide dismutase Mn/Fe domain protein [Acaryochloris marina
           MBIC11017]
          Length = 199

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 136/200 (68%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP+LPY Y+ L P++S  TLE+HHD HH  Y      +  D  M  +S+EE+I  +
Sbjct: 1   MVYQLPDLPYDYNALEPHISARTLEFHHDKHHAAYVTKCNGMTKDTPMDDMSIEEVIQSA 60

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +   + AGLFNNA+Q +NH+ +W  MK   G      AL+  I+ +FG+++ FK+    A
Sbjct: 61  YKDSAKAGLFNNAAQAWNHSFYWNSMKPGGGGLPG-GALAAQINTDFGNYDNFKAAFKEA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL ++NGKL+I+KT NAENPL++G  P+L +DVWEHAYYLDF+  R  YI
Sbjct: 120 GATQFGSGWAWLVLENGKLKITKTPNAENPLVHGQTPLLTMDVWEHAYYLDFQNSRPGYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+++LVNW++  + +  A
Sbjct: 180 DTFLSSLVNWDFAAQNFGAA 199


>gi|254467123|ref|ZP_05080534.1| superoxide dismutase, Fe [Rhodobacterales bacterium Y4I]
 gi|206688031|gb|EDZ48513.1| superoxide dismutase, Fe [Rhodobacterales bacterium Y4I]
          Length = 200

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 131/200 (65%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +NA    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ ++FGS +KFK + 
Sbjct: 61  TYDANAVAQNGIFNNISQLWNHNQFWEMM--GPGENKMPGELEKALTESFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL  K +G L ++KT+N  NPL      +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKKADGSLAVTKTENGVNPLCFDQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+ NLVNWE V  R
Sbjct: 179 PAYLTNFLDNLVNWENVASR 198


>gi|325277946|ref|ZP_08143483.1| superoxide dismutase [Pseudomonas sp. TJI-51]
 gi|324096920|gb|EGB95229.1| superoxide dismutase [Pseudomonas sp. TJI-51]
          Length = 198

 Score =  191 bits (486), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AFW-NLVNWAFVAEQFE 192


>gi|254512187|ref|ZP_05124254.1| superoxide dismutase, Fe [Rhodobacteraceae bacterium KLH11]
 gi|221535898|gb|EEE38886.1| superoxide dismutase, Fe [Rhodobacteraceae bacterium KLH11]
          Length = 199

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 131/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSLEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +NA    G+FNN SQ +NHN FW  M    G   +P  L  A+ ++FGS ++FKS  
Sbjct: 61  TYDANAVAQNGIFNNISQLWNHNQFWEMMGP--GGNAMPGELEKALIESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKNADGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLSNFLDNLVNWENVASR 198


>gi|254462804|ref|ZP_05076220.1| superoxide dismutase (Fe) [Rhodobacterales bacterium HTCC2083]
 gi|206679393|gb|EDZ43880.1| superoxide dismutase (Fe) [Rhodobacteraceae bacterium HTCC2083]
          Length = 199

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY++D L+   MS+ETLEYHHD+HHK Y DN  KL +  E    +LEEII  
Sbjct: 1   MAFELPKLPYAHDALADLGMSQETLEYHHDLHHKAYVDNGNKLIAGTEWEGKTLEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + +    G+FNN SQ +NHN FW  M    G+  +P  L  AI D+FGS +KFK + 
Sbjct: 61  TYDAPSVAQNGIFNNISQLWNHNQFWEMMGP--GQSSMPSELEAAIKDSFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 AAAGAGQFGSGWAWL-VKDADGGLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLSNFMDNLVNWENVASR 198


>gi|329850667|ref|ZP_08265512.1| superoxide dismutase Fe [Asticcacaulis biprosthecum C19]
 gi|328840982|gb|EGF90553.1| superoxide dismutase Fe [Asticcacaulis biprosthecum C19]
          Length = 203

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 131/200 (65%), Gaps = 2/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P+MS  T  +HH  HHK Y DN  KL +  E  +LSL EI+  S
Sbjct: 1   MAFELPPLPYASDSLEPHMSANTFSFHHAKHHKAYVDNLNKLIAGTEFENLSLVEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N G+FNN++Q +NH  FW+ MK N G      A++D I+ +FGS++ F     TA +
Sbjct: 61  DGKNPGVFNNSAQVWNHTFFWSSMKPNGGGAAT-GAIADKINVDFGSYDAFVEQFKTAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL + ++GKL+++KT NAE P   G  P+L +DVWEHAYYLD++  R  +IE
Sbjct: 120 TQFGSGWAWLVLGEDGKLKVTKTGNAETPFTKGDKPLLTLDVWEHAYYLDYQNLRPKFIE 179

Query: 180 SFITNLVNWEYVCERYETAM 199
           +F+T+LVNW++     +  +
Sbjct: 180 TFLTSLVNWDFANANLDAPL 199


>gi|148242890|ref|YP_001228047.1| superoxide dismutase [Synechococcus sp. RCC307]
 gi|147851200|emb|CAK28694.1| Superoxide dismutase [Fe] [Synechococcus sp. RCC307]
          Length = 199

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LP LPY+ D L P++S++TLE+HH  HH  Y +N  KL    ++   S+E+ I  +
Sbjct: 1   MAHTLPVLPYALDALEPHISRQTLEFHHGKHHAGYVNNLNKLVEGTDLDGKSIEDTITAV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +   AG+FNNA+Q +NH+ +W C+K   G G+   AL+D I+ +FGSFEKF      A
Sbjct: 61  AGNAEKAGVFNNAAQVWNHSFYWQCIKPGGG-GQPTGALADKINADFGSFEKFIEAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V   +  A
Sbjct: 180 TTYLEKLVNWDFVAANFAAA 199


>gi|163739965|ref|ZP_02147370.1| Superoxide dismutase [Phaeobacter gallaeciensis BS107]
 gi|163743199|ref|ZP_02150581.1| superoxide dismutase, Fe [Phaeobacter gallaeciensis 2.10]
 gi|161383616|gb|EDQ08003.1| superoxide dismutase, Fe [Phaeobacter gallaeciensis 2.10]
 gi|161386710|gb|EDQ11074.1| Fe dependent superoxide dismutase [Phaeobacter gallaeciensis BS107]
          Length = 199

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 133/201 (66%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +  E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSMEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +NA    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ D+FGS + FK + 
Sbjct: 61  TYDANAVAQSGIFNNISQLWNHNQFWEMMGP--GESKMPGELEKALVDSFGSVDTFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NP+  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGGLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|26987651|ref|NP_743076.1| superoxide dismutase [Pseudomonas putida KT2440]
 gi|148546197|ref|YP_001266299.1| superoxide dismutase [Pseudomonas putida F1]
 gi|34098495|sp|Q88PD5|SODF_PSEPK RecName: Full=Superoxide dismutase [Fe]
 gi|24982333|gb|AAN66540.1|AE016282_8 superoxide dismutase (Fe) [Pseudomonas putida KT2440]
 gi|148510255|gb|ABQ77115.1| Superoxide dismutase [Pseudomonas putida F1]
          Length = 198

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AFW-NLVNWAFVAEQFE 192


>gi|330807973|ref|YP_004352435.1| superoxide dismutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376081|gb|AEA67431.1| Superoxide dismutase (Fe) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 198

 Score =  191 bits (484), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY +D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYPHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|84499195|ref|ZP_00997483.1| Superoxide dismutase, Fe-Mn family protein [Oceanicola batsensis
           HTCC2597]
 gi|84392339|gb|EAQ04550.1| Superoxide dismutase, Fe-Mn family protein [Oceanicola batsensis
           HTCC2597]
          Length = 199

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 130/200 (65%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MSKET+EYHHD+HHK Y DN  K  +  E    S EEII  
Sbjct: 1   MAFELPDLPYAHDALADLGMSKETMEYHHDIHHKAYVDNGNKAIAGTEWEGKSAEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  NA    G+FNNASQY+NHN FW  M    G+ K+P  L  A+ + FGS +KFK + 
Sbjct: 61  TYDPNAVAQNGIFNNASQYWNHNQFWEMMAP--GEKKMPGELEKALTEAFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   ++G L+++KT+N  NPL      +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKDQDGSLKVTKTENGVNPLCFNQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+  LVNWE V  R
Sbjct: 179 PAYLSNFLDKLVNWENVASR 198


>gi|104780334|ref|YP_606832.1| superoxide dismutase [Pseudomonas entomophila L48]
 gi|95109321|emb|CAK14021.1| superoxide dismutase [Fe] [Pseudomonas entomophila L48]
          Length = 198

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI   FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALADAITAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|126739031|ref|ZP_01754725.1| superoxide dismutase, Fe [Roseobacter sp. SK209-2-6]
 gi|126719648|gb|EBA16356.1| superoxide dismutase, Fe [Roseobacter sp. SK209-2-6]
          Length = 200

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 130/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII+ 
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSLEEIIVG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNN SQ +NHN FW  M    G   +P  L  A+ ++FGS ++FKS  
Sbjct: 61  TYDKAAVAQNGIFNNISQLWNHNQFWEMM--GPGTSAMPGELQKALVESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKNADGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|159043616|ref|YP_001532410.1| superoxide dismutase [Dinoroseobacter shibae DFL 12]
 gi|157911376|gb|ABV92809.1| superoxide dismutase [Dinoroseobacter shibae DFL 12]
          Length = 199

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 129/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSLEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNN SQ +NHN FW  M   D    +P  L  A+ ++FGS ++FKS  
Sbjct: 61  TYDKGAVAQNGIFNNISQLWNHNQFWEMMGPGDAG--MPGELEKALVESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKNSDGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|163746878|ref|ZP_02154235.1| superoxide dismutase (Fe) [Oceanibulbus indolifex HEL-45]
 gi|161379992|gb|EDQ04404.1| superoxide dismutase (Fe) [Oceanibulbus indolifex HEL-45]
          Length = 199

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 128/200 (64%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MSKETLEYHHD HH  Y  N  K     E    +LEEII  
Sbjct: 1   MAFQLPDLPYAHDALASKGMSKETLEYHHDKHHNAYVTNGNKAIEGTEWEGKTLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +NA    G+FNN SQ +NHN FW  M  ND K  +P  L  AI ++FGS +KFK + 
Sbjct: 61  TYDANAVAQNGIFNNISQLWNHNQFWEMMTPNDSK--MPGELEKAITESFGSVDKFKDEF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   K+G L++SKT+N  NP+  G   +LG DVWEH+YY+D++  R
Sbjct: 119 KAAGAGQFGSGWAWLVKAKDGGLKVSKTENGVNPVCFGQTALLGCDVWEHSYYIDYRNAR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+ NLVNWE V  R
Sbjct: 179 PDYLSNFLDNLVNWENVASR 198


>gi|282895803|ref|ZP_06303890.1| Manganese and iron superoxide dismutase [Raphidiopsis brookii D9]
 gi|281199303|gb|EFA74169.1| Manganese and iron superoxide dismutase [Raphidiopsis brookii D9]
          Length = 198

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 125/195 (64%), Gaps = 4/195 (2%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LPY ++ L  Y M  ET EYH+  HHK Y DN  KL    ++   SLEE+I  
Sbjct: 1   MAFTQLPLPYDFNALESYGMKAETFEYHYGKHHKAYVDNLNKLTEGTDLADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K   G G    AL+D I  +FGSF+KFK +  T
Sbjct: 61  SFKDPSKAGIFNNAAQVWNHTFFWNSLKPAGG-GVPTGALADKISQDFGSFDKFKEEFST 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL++G  P+L +DVWEHAYY+DFK  R  +
Sbjct: 120 AAATQFGSGWAWLVDDGGTLKVVKTPNAENPLVHGKKPLLTLDVWEHAYYIDFKNARPAF 179

Query: 178 IESFITNLVNWEYVC 192
           I++F+ NL NWE+V 
Sbjct: 180 IKNFLDNLANWEFVA 194


>gi|77460707|ref|YP_350214.1| superoxide dismutase [Pseudomonas fluorescens Pf0-1]
 gi|77384710|gb|ABA76223.1| putative superoxide dismutase [Pseudomonas fluorescens Pf0-1]
          Length = 198

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALAEAINAAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AFW-NLVNWKFVAEQFE 192


>gi|172036535|ref|YP_001803036.1| superoxide dismutase [Cyanothece sp. ATCC 51142]
 gi|171697989|gb|ACB50970.1| superoxide dismutase [Cyanothece sp. ATCC 51142]
          Length = 200

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 128/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LPNLPY Y  L P++SK TLE+HHD HH +Y           +     +EE+I  I
Sbjct: 1   MAYELPNLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNAAVEGTDHDSKPIEEVIKAI 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S  GLFNNA+Q +NH+ +W CMK   G       L+D I+ +FGSF+KF  +   A
Sbjct: 61  AGDASKQGLFNNAAQAWNHSFYWNCMKPGGGGQPT-GPLADKINADFGSFDKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L++ KT NAENP+ +G  P+L +DVWEHAYYLD++  R  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVVKTLNAENPMTSGQTPLLTMDVWEHAYYLDYQNSRPGYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+++L+NW++V +    A
Sbjct: 180 DTFVSSLINWDFVADNLAKA 199


>gi|89067734|ref|ZP_01155188.1| superoxide dismutase, Fe [Oceanicola granulosus HTCC2516]
 gi|89046704|gb|EAR52759.1| superoxide dismutase, Fe [Oceanicola granulosus HTCC2516]
          Length = 199

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 130/200 (65%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MSKETLE+HHD+HHK Y DN  KL +  E  + SLEEII  
Sbjct: 1   MAFDLPDLPYAHDALAGNGMSKETLEFHHDIHHKAYVDNGNKLIAGTEWENKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  NA    G+FNN SQ +NHN FW  M    G+  +P  L  A+ D+FGS +KFK + 
Sbjct: 61  TYDPNAVAQNGIFNNISQLWNHNQFWEMMSP--GQSSMPSELESALKDSFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL    +G L+I KT+N  NP+      +LG DVWEH+YY+DF+ +R
Sbjct: 119 AAAGAGQFGSGWAWLVKGGDGGLKIRKTENGVNPVCFDETALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+++F+ NLV+WE V  R
Sbjct: 179 PAYLDNFLNNLVDWENVASR 198


>gi|86609948|ref|YP_478710.1| Fe-superoxide dismutase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558490|gb|ABD03447.1| Fe-superoxide dismutase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 199

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 126/191 (65%), Gaps = 3/191 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L PYMS ET  +HH  HH  Y  N  KL    ++ + SLEEII  +
Sbjct: 1   MAFELPALPYPADALKPYMSAETFSFHHGKHHAAYVANLNKLIEGTDLANKSLEEIIKAT 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G     G+FNNA+Q +NH  FW  MK   G       ++D I+ +FGS++KF     TA
Sbjct: 61  FGDPDKVGIFNNAAQVWNHTFFWESMKPGGGGAPT-GPIADKINADFGSYDKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +++G L+++KT NAENPL++G  P+L +DVWEHAYYLD++ RR  +I
Sbjct: 120 AATQFGSGWAWLVLEDGTLKVTKTPNAENPLVHGQTPLLTLDVWEHAYYLDYQNRRPDFI 179

Query: 179 ESFITNLVNWE 189
            +++ +LVNW+
Sbjct: 180 NAYLEHLVNWD 190


>gi|167035466|ref|YP_001670697.1| superoxide dismutase [Pseudomonas putida GB-1]
 gi|33860110|sp|P09223|SODF_PSEPU RecName: Full=Superoxide dismutase [Fe]
 gi|1498060|gb|AAB06332.1| iron superoxide dismutase [Pseudomonas putida]
 gi|166861954|gb|ABZ00362.1| Superoxide dismutase [Pseudomonas putida GB-1]
          Length = 198

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AFW-NLVNWAFVAEQFE 192


>gi|317969077|ref|ZP_07970467.1| superoxide dismutase [Synechococcus sp. CB0205]
          Length = 199

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N   L +  ++   SLE+ I+  
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNNLVAGTDLEGKSLEDTIVAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G    AG+FNNA+Q +NH+ +W C+K N G G    AL D I+ +FGSFEKF      A
Sbjct: 61  AGDAGKAGVFNNAAQVWNHSFYWQCIKPN-GGGTPSGALLDKINADFGSFEKFVEAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 STYLDKLVNWDFVAANLAAA 199


>gi|170720167|ref|YP_001747855.1| superoxide dismutase [Pseudomonas putida W619]
 gi|169758170|gb|ACA71486.1| Superoxide dismutase [Pseudomonas putida W619]
 gi|313497284|gb|ADR58650.1| Superoxide dismutase [Pseudomonas putida BIRD-1]
          Length = 198

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AFW-NLVNWAFVAEQFE 192


>gi|114765448|ref|ZP_01444558.1| Superoxide dismutase, Fe-Mn family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114542158|gb|EAU45189.1| Superoxide dismutase, Fe-Mn family protein [Roseovarius sp.
           HTCC2601]
          Length = 199

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 129/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MSKETLEYHHD+HH  Y     KL    E    SLEEI+  
Sbjct: 1   MAFELPDLPYAHDALASKGMSKETLEYHHDIHHNTYVTTLNKLIDGTEWADKSLEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    GLFNNASQ++NH  FW  M   D    +P  L  A+ ++FGS +KFK D 
Sbjct: 61  TYEAGAVAQSGLFNNASQHWNHTQFWEMMGSGDNA--MPSELEAALKESFGSVDKFKEDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDADGGLKITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLANFLDNLVNWENVASR 198


>gi|193212804|ref|YP_001998757.1| Superoxide dismutase [Chlorobaculum parvum NCIB 8327]
 gi|193086281|gb|ACF11557.1| Superoxide dismutase [Chlorobaculum parvum NCIB 8327]
          Length = 200

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 131/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+ + L P++S  T+ +H+  HH  Y  N   L        +SLEE+I+K+
Sbjct: 1   MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGLVEGTPFDSMSLEEVILKT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S  G+FNN +Q +NH+ +W C+  N G G+    ++  I ++FGS EKFK +L TA
Sbjct: 61  ADDASKVGVFNNGAQAWNHSFYWNCLSPNGG-GEPTGDVAAKIVEDFGSVEKFKEELKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L++ KT NA+NP+ +G  P+L IDVWEHAYYLD++ RR  ++
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVVKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NWE+V E Y+ A
Sbjct: 180 AAVIDNLLNWEFVNENYKAA 199


>gi|148240078|ref|YP_001225465.1| superoxide dismutase [Synechococcus sp. WH 7803]
 gi|147848617|emb|CAK24168.1| Superoxide dismutase [Fe] [Synechococcus sp. WH 7803]
          Length = 199

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I  +
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVISAV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA+Q +NH+ +W CMK   G G+   AL D I+ +FGS++ F      A
Sbjct: 61  SGDASKAGVFNNAAQVWNHSFYWQCMKPGGG-GQPSGALLDKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL V+NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLIVENGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|213963271|ref|ZP_03391528.1| superoxide dismutase [Mn] [Capnocytophaga sputigena Capno]
 gi|213954133|gb|EEB65458.1| superoxide dismutase [Mn] [Capnocytophaga sputigena Capno]
          Length = 201

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 125/200 (62%), Gaps = 7/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E HH  HH  Y  N     + A +   S+EEI+   + 
Sbjct: 2   FTLPALPYAYNALEPYIDARTMEIHHTKHHNAYTTNLNAALAPAGVEGKSIEEILTNLNM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AID+ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEIMSPNGG-GKPTGELAKAIDEAFGSFEGFKEAFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GK+EI  T N +NPL+     G  PILG+DVWEHAYYL+++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKVEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLNYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERYET 197
           IE+F + ++NW  V E Y T
Sbjct: 181 IEAFFS-VINWAKVAELYNT 199


>gi|260426804|ref|ZP_05780783.1| superoxide dismutase [Mn] [Citreicella sp. SE45]
 gi|260421296|gb|EEX14547.1| superoxide dismutase [Mn] [Citreicella sp. SE45]
          Length = 199

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 129/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MSKETLEYHHD+HH  Y     KL    E    SLEEI+  
Sbjct: 1   MAFELPDLPYAHDALASKGMSKETLEYHHDLHHNAYVTTLNKLIDGTEWADKSLEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    GLFNNASQ++NH  FW  M   D    +P  L  A+ ++FGS EKFK D 
Sbjct: 61  TYDAGAVAQSGLFNNASQHWNHAQFWEMMGAGDNA--MPSELEAALKESFGSVEKFKEDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGGLKITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLANFLDNLVNWENVASR 198


>gi|310815829|ref|YP_003963793.1| superoxide dismutase, Fe [Ketogulonicigenium vulgare Y25]
 gi|308754564|gb|ADO42493.1| superoxide dismutase, Fe [Ketogulonicigenium vulgare Y25]
          Length = 199

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 128/198 (64%), Gaps = 8/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP LPY++D L+   MS+ETLEYHHD+HHK Y DN  KL +  E    +LEEII  
Sbjct: 1   MAFTLPELPYAHDALAAKGMSRETLEYHHDLHHKAYVDNGNKLIAGTEWEGKTLEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNN SQ +NHN FW  +        +P  L  A+ ++FGS  KFK + 
Sbjct: 61  TYNATAVAQNGIFNNISQLWNHNQFWEWLSPE--TVAIPGELEKALTESFGSVAKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL   K+G L+++KT+N  NPL+ G   +LG+DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAAQFGSGWAWLVKDKDGSLKVTKTENGVNPLVFGQTALLGVDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVC 192
             Y+ +F+ NLVNWE V 
Sbjct: 179 PAYLTNFLDNLVNWEKVA 196


>gi|221136195|ref|XP_002170998.1| PREDICTED: similar to superoxide dismutase [Hydra magnipapillata]
          Length = 199

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 123/193 (63%), Gaps = 3/193 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LPNLPY    L P++S +TL +HH  HH+ Y  N   L  + E+ + +LEEII   
Sbjct: 1   MTHTLPNLPYDIAALEPHISAKTLTFHHGKHHQAYVTNLNNLIQNTELANKTLEEIIHAT 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +   AG+FNNA+Q +NH  FW CMK   G G+    L   ID  FGS+E F +D   A
Sbjct: 61  AKNPEKAGIFNNAAQVWNHTFFWNCMKPQGG-GQPTGDLKAMIDKTFGSYEAFAADFKQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL V+ G L I KT NA+ P+++GA  +L  DVWEHAYYLD++ RR  Y+
Sbjct: 120 AITQFGSGWAWLVVERGVLRIMKTPNADLPMVHGATALLTCDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYV 191
           ++F+++LVNW++ 
Sbjct: 180 DTFLSHLVNWDFA 192


>gi|259418889|ref|ZP_05742806.1| superoxide dismutase (Fe) [Silicibacter sp. TrichCH4B]
 gi|259345111|gb|EEW56965.1| superoxide dismutase (Fe) [Silicibacter sp. TrichCH4B]
          Length = 199

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 131/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HHK Y DN  KL +  E    SLE+II  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSLEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  +A    G+FNN SQ +NHN FW  M  N     +P  L  A+ ++FGS +KFK + 
Sbjct: 61  TYNKDAVAQNGIFNNISQLWNHNQFWEMMGPN--GSAMPTELEKALVESFGSVDKFKEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGGLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLSNFLDNLVNWENVASR 198


>gi|254430497|ref|ZP_05044200.1| superoxide dismutase [Fe] [Cyanobium sp. PCC 7001]
 gi|197624950|gb|EDY37509.1| superoxide dismutase [Fe] [Cyanobium sp. PCC 7001]
          Length = 199

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 125/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N  KL    ++   SLE+ I   
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNKLVEGTDLDGKSLEDTITAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G    AG+FNNA+Q +NH+ +W CMK   G G+   AL++ I+ +FGSFE F     TA
Sbjct: 61  AGDAGKAGVFNNAAQVWNHSFYWQCMKPGGG-GQPTGALAEKINADFGSFEAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +  G L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDGGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|332879152|ref|ZP_08446853.1| superoxide dismutase, Mn [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332682952|gb|EGJ55848.1| superoxide dismutase, Mn [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 202

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 122/200 (61%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y  L PY+   T+E HH  HH  Y  N     + A +   S+EEI+   
Sbjct: 1   MAFTLPKLPYAYQALEPYIDARTMEIHHTKHHNAYTTNLNAALAPAGVEGKSIEEILQNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +NA L NNA  YYNHNLFW  M  N G GK    L+ AID+ FGSFE FK     AA+
Sbjct: 61  DMNNAALRNNAGGYYNHNLFWEVMSSNGG-GKPTGELAKAIDEAFGSFEGFKEAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  T N +NPL+ G      PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGTGCSGQPILGLDVWEHAYYLHYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YIE+F  N++NWE V   Y
Sbjct: 180 DYIEAFF-NVINWEKVAALY 198


>gi|308275172|emb|CBX31769.1| Superoxide dismutase [Fe] [uncultured Desulfobacterium sp.]
          Length = 245

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 123/195 (63%), Gaps = 3/195 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           FKLP LPY  D LSPY+S  T+++H+  HH+ Y D       + E    SLEEII K+  
Sbjct: 49  FKLPPLPYGNDALSPYISANTIKFHYGKHHQGYIDKINSFIQNTEFAKYSLEEIIKKTAT 108

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  +FNNA+Q +NH  +W  MK  +G G    AL+  +D +FGS EKFK     AA+
Sbjct: 109 IKDHIAIFNNAAQAWNHGFYWKSMKP-EGGGAPTGALAKKLDADFGSLEKFKKAFGDAAA 167

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL    G L + KT NA+ PL +G +PIL IDVWEHAYYLD++ RR  YI +
Sbjct: 168 TQFGSGWAWLVADRGNLAVVKTSNADTPLAHGQVPILTIDVWEHAYYLDYQNRRTDYIAA 227

Query: 181 FITNLVNWEYVCERY 195
           F+ +LVNW++  + +
Sbjct: 228 FLDHLVNWDFAEKNF 242


>gi|318042181|ref|ZP_07974137.1| superoxide dismutase [Synechococcus sp. CB0101]
          Length = 199

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N   L +  ++   SLE+ I   
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNNLVAGTDLDGKSLEDTITAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W C+K   G G    AL D I+ +FGSFEKF  +   A
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCIKPG-GGGTPSGALLDKINADFGSFEKFVEEFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLDKLVNWDFVAANLAAA 199


>gi|144898732|emb|CAM75596.1| Superoxide dismutase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 198

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 125/196 (63%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F+LP LPY    L P++S +TL++HH  HH  Y  N   L  D ++   SLEEII   
Sbjct: 1   MAFELPPLPYDKTALEPHISAQTLDFHHGKHHNAYVTNLNNLVKDTDLAAKSLEEIIAIA 60

Query: 59  -KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
            K   +  G+FNNA+Q +NH  FW CMK+  G GK    +   I+  FGS+EKF  +   
Sbjct: 61  AKDLPAKQGVFNNAAQVWNHTFFWNCMKQGGG-GKPTGTVLAKIEAAFGSYEKFAEEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA TQFGSGW WL  +NG L+I+KT NA+ PL +G   +L +DVWEHAYYLDF+ RR  +
Sbjct: 120 AAVTQFGSGWAWLVEENGALKITKTANADLPLAHGQKALLTVDVWEHAYYLDFQNRRPDF 179

Query: 178 IESFITNLVNWEYVCE 193
           +++F+  LVNW++V +
Sbjct: 180 VQTFLDKLVNWDFVAK 195


>gi|149202243|ref|ZP_01879216.1| superoxide dismutase, Fe [Roseovarius sp. TM1035]
 gi|149144341|gb|EDM32372.1| superoxide dismutase, Fe [Roseovarius sp. TM1035]
          Length = 199

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 132/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII- 58
           M F+LP+LPY++D L+ + MS ETLEYHHD+HHK Y DN  KL +  E    SLE+III 
Sbjct: 1   MAFELPDLPYAHDALAGHGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSLEDIIIG 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
              KS  + +G+FNN SQ +NHN FW  M     K  +P  L  A+ ++FGS +KFK   
Sbjct: 61  TYDKSAVAQSGIFNNISQLWNHNQFWEMMSPT--KTGMPGELEKALTESFGSVDKFKEAF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKDADGALKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|255263494|ref|ZP_05342836.1| superoxide dismutase (Mn) [Thalassiobium sp. R2A62]
 gi|255105829|gb|EET48503.1| superoxide dismutase (Mn) [Thalassiobium sp. R2A62]
          Length = 199

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 129/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MSKETLEYHHD+HH  Y  N  K     E    +LEEII+ 
Sbjct: 1   MAFELPDLPYAHDALADNGMSKETLEYHHDLHHNAYVTNGNKAIEGTEWEGKTLEEIIVG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ ++A    G+FNN SQ +NHN FW  M    GK  +P  L  AI D+FGS + FKS  
Sbjct: 61  TYDADAVAQNGIFNNISQLWNHNQFWEMMGP--GKSAMPSELEAAIKDSFGSVDDFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+  
Sbjct: 119 SAAGAGQFGSGWAWL-VKDADGGLKITKTENGVNPLCFGQTTLLGCDVWEHSYYIDFRNA 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPKYLTNFLDNLVNWENVASR 198


>gi|227056|prf||1613421A superoxide dismutase
          Length = 202

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 125/193 (64%), Gaps = 4/193 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M ++LP LP+ Y  L+PY++KET E+HHD HH  Y +N      D ++    +E +I  I
Sbjct: 1   MSYELPALPFDYTALAPYITKETKEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAI 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AGLFNNA+Q +NH+ +W  +K N G G    AL+D I  +FGSFE F ++   A
Sbjct: 61  AGDASKAGLFNNAAQAWNHSFYWNSIKPN-GGGAPTGALADKIAADFGSFENFVTEFKQA 119

Query: 119 ASTQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           A+TQFGSGW WL  + NG L+I  T NA+ P+ +G  P+L IDVWEHAYYLD++ RR  Y
Sbjct: 120 AATQFGSGWAWLVLIDNGTLKIKTTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDY 179

Query: 178 IESFITNLVNWEY 190
           I +F+  L NW++
Sbjct: 180 ISTFVEKLANWDF 192


>gi|146277908|ref|YP_001168067.1| superoxide dismutase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556149|gb|ABP70762.1| Superoxide dismutase [Rhodobacter sphaeroides ATCC 17025]
          Length = 199

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 131/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MSKET+EYHHD+HHK Y DN  KL +  E    S+EEI+  
Sbjct: 1   MAFTLPDLPYAHDALAALGMSKETMEYHHDIHHKAYVDNGNKLIAGTEWEGKSVEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNNASQ++NH  FW  M     + K+P AL  A+ ++FGS EKF  + 
Sbjct: 61  TYQPGAVAQNGIFNNASQHWNHCQFWEMM--GPAETKMPGALEKALVESFGSVEKFMEEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+  LVNWE V  R
Sbjct: 178 RPAYLSNFLEKLVNWENVASR 198


>gi|326336596|ref|ZP_08202765.1| superoxide dismutase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691261|gb|EGD33231.1| superoxide dismutase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 201

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 126/200 (63%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PY+   T+E H+  HHK Y DN     +  E+   S+E+I++  
Sbjct: 1   MSFNLPELPYAYNALEPYIDARTMEIHYTKHHKAYTDNLNNAITGTELEGKSIEDILLNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVP-QALSDAIDDNFGSFEKFKSDLITAA 119
              N  + NN   YYNHNLFW  +  N  KG  P + LS+AID  FGSF+ FK     AA
Sbjct: 61  DPENKAVRNNGGGYYNHNLFWEILTPN--KGMTPSKELSEAIDKAFGSFKAFKEIFSKAA 118

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPL---INGAIPILGIDVWEHAYYLDFKYRRA 175
           +TQFGSGW WL+V K GK+E+  T N +NPL   I    PILGIDVWEHAYYL+++ RRA
Sbjct: 119 ATQFGSGWAWLTVHKGGKIEVCATANQDNPLMPHIQCGSPILGIDVWEHAYYLNYQNRRA 178

Query: 176 HYIESFITNLVNWEYVCERY 195
            YIE+F  N++NW  V E Y
Sbjct: 179 DYIEAFF-NVINWNKVSELY 197


>gi|78187086|ref|YP_375129.1| superoxide dismutase [Chlorobium luteolum DSM 273]
 gi|78166988|gb|ABB24086.1| Superoxide dismutase [Chlorobium luteolum DSM 273]
          Length = 200

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 129/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L P++S +TL +H+  HH  Y  N   L     +  + +E++I ++
Sbjct: 1   MAYQQPALPWAENALEPHISAKTLSFHYGKHHAAYVTNYNNLVGGTPLDEMPIEDVIAQT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNN +Q +NH+ +W C+  N G GK    L++AI+ +FG ++ F+ +L  A
Sbjct: 61  AGDSSKIGVFNNGAQAWNHSFYWNCLTPNGG-GKPSGELAEAIEKDFGGYDAFREELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL ++NG L+++KT NAE P+  G  PIL IDVWEHAYYLD++ RR  Y 
Sbjct: 120 AATQFGSGWAWLVLENGTLKVAKTANAETPMTKGMKPILTIDVWEHAYYLDYQNRRPDYT 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NWE+  E Y  A
Sbjct: 180 AAVIDNLINWEFAEENYTAA 199


>gi|62767033|gb|AAX99422.1| iron superoxide dismutase [Symbiodinium sp. PF-2005]
          Length = 201

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 128/202 (63%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L+P++S+ETL +HH  HH  Y  N  KL    ++   SLE I+  +
Sbjct: 1   MAFDLPELPYGRAGLAPHISEETLNFHHGKHHNAYVTNLNKLIDGTDLAGASLEAIVKAA 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLIT 117
            G  S AGLFNNA+Q +NH  +W  MK   G G  P   +++ ID +FGS+++F +    
Sbjct: 61  AGDASKAGLFNNAAQVWNHTFYWHSMKP--GGGGAPHGKIAEMIDRDFGSYDEFATQFKA 118

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAH 176
           A   QFGSGW WL +K+GKL I+KT NAE PL  +GA P+L +DVWEHAYYLD++  R +
Sbjct: 119 AGGGQFGSGWAWLILKDGKLAITKTPNAETPLTEDGATPLLTMDVWEHAYYLDYQNSRPN 178

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ SF+ NLVNW++  +    A
Sbjct: 179 YMASFLDNLVNWDFANQNLADA 200


>gi|88809143|ref|ZP_01124652.1| superoxide dismutase [Synechococcus sp. WH 7805]
 gi|88787085|gb|EAR18243.1| superoxide dismutase [Synechococcus sp. WH 7805]
          Length = 199

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 126/194 (64%), Gaps = 3/194 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I  +
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVIAAV 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            S  S AG+FNNA+Q +NH+ +W CMK   G G+   AL D I+ +FGS++ F      A
Sbjct: 61  SSDSSKAGVFNNAAQVWNHSFYWQCMKPG-GGGQPTGALLDKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +++G L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLIIEDGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVC 192
            +++  LVNW++V 
Sbjct: 180 STYLDKLVNWDFVA 193


>gi|126736019|ref|ZP_01751763.1| superoxide dismutase, Fe [Roseobacter sp. CCS2]
 gi|126714576|gb|EBA11443.1| superoxide dismutase, Fe [Roseobacter sp. CCS2]
          Length = 199

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 127/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII- 58
           M F LP+LPY++D L S  MS ETLEYHHD+HH  Y  N  K     E    SLEEII+ 
Sbjct: 1   MAFSLPDLPYAHDALASNGMSAETLEYHHDLHHNAYVTNGNKAIEGTEWEGKSLEEIIVG 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
              KS  +  G+FNN SQ +NHN FW  M   D    +P  L  A+ D+FGS ++FKS L
Sbjct: 61  TYDKSSVAQNGIFNNISQLWNHNQFWEMMGPGDSA--MPGELEKALVDSFGSVDEFKSQL 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G I +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKNADGSLAVTKTENGVNPLCFGQIALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|237799575|ref|ZP_04588036.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022431|gb|EGI02488.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 193

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 96/196 (48%), Positives = 126/196 (64%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSFEKFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALADAINTAFGSFEKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NP+ +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPITSGDKPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V ++Y
Sbjct: 177 AFW-NLVNWDFVAQQY 191


>gi|282900871|ref|ZP_06308808.1| Manganese and iron superoxide dismutase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281194237|gb|EFA69197.1| Manganese and iron superoxide dismutase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 198

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LPY ++ L  Y M  ET EYH+  HHK Y DN  KL    ++   SLEE+I  
Sbjct: 1   MAFTQLPLPYDFNALESYGMKAETFEYHYGKHHKAYVDNLNKLTEGTDLADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLI 116
           S    S AG+FNNA+Q +NH  FW  +K     G VP   L+D I  +FGSF+KFK +  
Sbjct: 61  SFKDASKAGVFNNAAQVWNHTFFWNSLKP--AGGGVPTGVLADRISQDFGSFDKFKEEFS 118

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TAA+TQFGSGW WL    G L++ KT NAENPL++G  P+L IDVWEHAYY+DF+  R  
Sbjct: 119 TAAATQFGSGWAWLVDDGGTLKVIKTPNAENPLVHGKKPLLTIDVWEHAYYIDFRNARPA 178

Query: 177 YIESFITNLVNWEYVC 192
           +I++F+ NL NWE+  
Sbjct: 179 FIKNFLDNLANWEFAA 194


>gi|189346617|ref|YP_001943146.1| superoxide dismutase [Chlorobium limicola DSM 245]
 gi|189340764|gb|ACD90167.1| Superoxide dismutase [Chlorobium limicola DSM 245]
          Length = 200

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+ + L P++S +T+ +H+  HH  Y +N   L +      +S+EE+I  +
Sbjct: 1   MAYQQPALPYAENALEPHISAKTIGFHYGKHHAAYVNNFNNLVTGTPFDSMSIEEVICTT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G     G+FNN +Q +NH+ +W C+  N G GK    L+  ID +FGSF+KF  +L  A
Sbjct: 61  AGDAQKIGVFNNGAQAWNHSFYWNCLSANGG-GKPSGELAAKIDGDFGSFDKFVEELKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L++ KT NA+ P+ +G  P+L +DVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVVKTGNAQTPITSGQTPLLCVDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NW++  E Y++A
Sbjct: 180 AATIENLLNWKFAEENYQSA 199


>gi|116073363|ref|ZP_01470625.1| superoxide dismutase [Synechococcus sp. RS9916]
 gi|116068668|gb|EAU74420.1| superoxide dismutase [Synechococcus sp. RS9916]
          Length = 199

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPYS D L P++S+ TLE+HH  HH  Y  N  K     E+   SLE++I   
Sbjct: 1   MAHTLPQLPYSLDALEPHISRSTLEFHHGKHHNAYVTNLNKAIEGTELDGKSLEDVIAAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G G+   AL + I+ +FGS++ F     TA
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGG-GQPSGALLEKINADFGSYDAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  Y+
Sbjct: 120 GATQFGSGWAWLVLDNGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|254707717|ref|ZP_05169545.1| superoxide dismutase (Fe) [Brucella pinnipedialis M163/99/10]
          Length = 146

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 84/145 (57%), Positives = 108/145 (74%)

Query: 54  EEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
           EEI+ +S G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++
Sbjct: 1   EEIVKESFGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRA 60

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
           D I A + QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  
Sbjct: 61  DFIAAGAGQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNA 120

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R  Y+E+F+ +LVNW+YV E YE A
Sbjct: 121 RPKYLEAFVDSLVNWDYVLEMYEKA 145


>gi|42523851|ref|NP_969231.1| hypothetical protein Bd2407 [Bdellovibrio bacteriovorus HD100]
 gi|39576058|emb|CAE80224.1| sodB [Bdellovibrio bacteriovorus HD100]
          Length = 193

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 126/198 (63%), Gaps = 8/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P+MS ETLEYHH  HHK Y DN  KL    E    +LE+II+ S
Sbjct: 1   MTFELPALPYAKDALAPHMSAETLEYHHGKHHKTYVDNLNKLVPGTEHEGKTLEQIIMSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW C+    G G+    L+ AI  +FGS EKFK     A+ 
Sbjct: 61  SG---GVFNNAAQIWNHTFFWNCLSPKGG-GEPTGELAQAIVRDFGSIEKFKELFADASI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            QFGSGWGWL VKN  GKLEI  T NAE P+  G   IL  DVWEHAYY+D++  R +++
Sbjct: 117 KQFGSGWGWL-VKNKEGKLEILSTSNAETPMTKGHTAILTCDVWEHAYYIDYRNSRPNFL 175

Query: 179 ESFITNLVNWEYVCERYE 196
            +F   LVNWE+  + ++
Sbjct: 176 AAFW-KLVNWEFAAKNFK 192


>gi|71735545|ref|YP_276190.1| superoxide dismutase, Fe [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298488575|ref|ZP_07006605.1| Superoxide dismutase [Fe] [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|71556098|gb|AAZ35309.1| superoxide dismutase, Fe [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298156916|gb|EFH98006.1| Superoxide dismutase [Fe] [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322410|gb|EFW78503.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330122|gb|EFW86109.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330874913|gb|EGH09062.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 193

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWECLAPNAG-GEPTGALAEAINTAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V +++E
Sbjct: 177 AFW-NLVNWDFVAKQFE 192


>gi|62638119|gb|AAX92665.1| chloroplast iron superoxide dismutase [Dunaliella salina]
          Length = 227

 Score =  187 bits (474), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 126/197 (63%), Gaps = 4/197 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS--HG 62
           L  LPY+ D L P+MSK T E+HH  HH+ YADN  K  +  E     L+ I++ S  +G
Sbjct: 30  LKPLPYAPDALEPHMSKATFEFHHGKHHRAYADNLNKQIAGKEWDQKDLDTIVMASWNNG 89

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +    FNNA+Q +NH  FW  MK N G G+   AL +AI  +FGSF++FK+    A  TQ
Sbjct: 90  NPTPEFNNAAQVWNHEFFWESMKPNGG-GEPTGALMEAIKRDFGSFDEFKNQFKAAGMTQ 148

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           FGSGW WL   K+GKL I+KT NA  P++ G  PIL +DVWEHAYYLD++ RR  +I++F
Sbjct: 149 FGSGWAWLVTDKSGKLSIAKTPNAVVPVVEGKSPILTVDVWEHAYYLDYQNRRPDFIQTF 208

Query: 182 ITNLVNWEYVCERYETA 198
           +  LV+W+ V  RY  A
Sbjct: 209 LDKLVSWDAVSNRYAKA 225


>gi|94309484|ref|YP_582694.1| manganese and iron superoxide dismutase [Cupriavidus metallidurans
           CH34]
 gi|93353336|gb|ABF07425.1| superoxide dismutase, Fe [Cupriavidus metallidurans CH34]
          Length = 192

 Score =  187 bits (474), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 128/196 (65%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP+LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E    SLEEI+ KS
Sbjct: 1   MEHKLPSLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFESASLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G G+   AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWESMKPNGG-GQPTGALADAINAKWGSFDKFKEEFTKVAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+V+W++  + +
Sbjct: 177 AFW-NVVSWDFASKNF 191


>gi|119383270|ref|YP_914326.1| superoxide dismutase [Paracoccus denitrificans PD1222]
 gi|119373037|gb|ABL68630.1| Superoxide dismutase [Paracoccus denitrificans PD1222]
          Length = 199

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 127/200 (63%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MSKETLEYHHD HHK Y D   +L +  E    SLE+I+  
Sbjct: 1   MAFTLPDLPYAHDALAAGGMSKETLEYHHDKHHKAYVDKLNELVAGTEWEGKSLEDIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ S A    G+FNNASQ++NH  FW  M  N   G +P  L  A+ + FGS ++FK   
Sbjct: 61  TYQSGAVAQNGIFNNASQHWNHAQFWEMMGPN--PGAIPGELEKALTEAFGSVDEFKKKF 118

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A   QFGSGW WL   K+G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+  R
Sbjct: 119 AEAGVGQFGSGWAWLVKDKDGSLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNAR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+E+F+ NLVNWE V  R
Sbjct: 179 PKYLENFLNNLVNWENVASR 198


>gi|289625675|ref|ZP_06458629.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647255|ref|ZP_06478598.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330870176|gb|EGH04885.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 193

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWECLAPNAG-GEPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V +++E
Sbjct: 177 AFW-NLVNWDFVAKQFE 192


>gi|84517356|ref|ZP_01004710.1| superoxide dismutase, Fe [Loktanella vestfoldensis SKA53]
 gi|84508836|gb|EAQ05299.1| superoxide dismutase, Fe [Loktanella vestfoldensis SKA53]
          Length = 199

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 127/200 (63%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MS ETLE+HHD+HH  Y  N  K     +    SLEEIII 
Sbjct: 1   MSFTLPDLPYAHDALAAKGMSAETLEFHHDIHHNAYVTNGNKAIEGTQWAGKSLEEIIIG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNN SQ +NHN FW  M   D K  +P AL  A+ ++FGS ++FK+  
Sbjct: 61  TYDAAAVAQNGIFNNISQLWNHNQFWEMMTPADSK--MPGALEKALVESFGSVDEFKTQF 118

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW WL  K +G L I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +R
Sbjct: 119 SAAGAGQFGSGWAWLVKKADGSLAITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNKR 178

Query: 175 AHYIESFITNLVNWEYVCER 194
             Y+ +F+ NLVNWE V  R
Sbjct: 179 PAYLTNFLDNLVNWENVAGR 198


>gi|51244168|ref|YP_064052.1| superoxide dismutase [Fe] [Desulfotalea psychrophila LSv54]
 gi|50875205|emb|CAG35045.1| probable superoxide dismutase [Fe] [Desulfotalea psychrophila
           LSv54]
          Length = 197

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 126/193 (65%), Gaps = 3/193 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  + L+PY+S ETL++HH  HH  Y  N  KL +  E+ + +LEEII K+
Sbjct: 1   MSITLPELPYLKNALAPYISSETLDFHHGKHHSTYVTNLNKLIAGTELENATLEEIIKKT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S +G+FNNA+Q +NH  +W  MK  +G G    A+++ ID +FGS++ F   L  A
Sbjct: 61  VNDASKSGVFNNAAQIWNHTFYWQSMKA-EGGGMPRGAIAEKIDADFGSYDNFVEQLKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + N KLEI KT NA+ P+ +G   +L +DVWEHAYYLD++  R  Y+
Sbjct: 120 GLTQFGSGWAWLVLNNNKLEIMKTANADTPIAHGLQALLTVDVWEHAYYLDYQNGRGTYL 179

Query: 179 ESFITNLVNWEYV 191
           ++F  NL+NW++V
Sbjct: 180 DAFFNNLINWDFV 192


>gi|256420107|ref|YP_003120760.1| superoxide dismutase [Chitinophaga pinensis DSM 2588]
 gi|256035015|gb|ACU58559.1| Superoxide dismutase [Chitinophaga pinensis DSM 2588]
          Length = 201

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 130/202 (64%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L P++ K T+E HH  HH+ Y DN  K  +  E  + SLEE++  +
Sbjct: 1   MAFTLPSLPYAHDALEPHIDKLTMEIHHGKHHQAYVDNLNKAIAGTENENKSLEELVASA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH+ FW  +  N G G+   AL+DAI   FGSFE+FK     A +
Sbjct: 61  GKISPAVRNNGGGHWNHSFFWKVIGPNAG-GEPTGALADAIKSTFGSFEEFKEKFANAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL VK+GKLEI+ T N +NPL++ A     P+LGIDVWEHAYYL ++ RR  
Sbjct: 120 TRFGSGWAWLIVKDGKLEITSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+++F + +VNW  V + YE A
Sbjct: 180 YLKAFWS-VVNWSEVAKNYEAA 200


>gi|73540303|ref|YP_294823.1| superoxide dismutase [Ralstonia eutropha JMP134]
 gi|72117716|gb|AAZ59979.1| Superoxide dismutase [Ralstonia eutropha JMP134]
          Length = 193

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 127/196 (64%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI  KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENATLEEITKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G G+   AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWESMKPNGG-GQPTGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLLSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NVVNWDFAAQNF 191


>gi|12084342|pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
 gi|12084343|pdb|1DT0|B Chain B, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
 gi|12084344|pdb|1DT0|C Chain C, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
          Length = 197

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 125/195 (64%), Gaps = 6/195 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S G
Sbjct: 2   FELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    +   
Sbjct: 62  ---GIFNNAAQVWNHTFYWNCLSPNAG-GQPTGALADAINAAFGSFDKFKEEFTKTSVGT 117

Query: 123 FGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           FGSGWGWL  K +G L ++ T  A  PL  G  P+L  DVWEHAYY+D++  R  Y+E+F
Sbjct: 118 FGSGWGWLVKKADGSLALASTIGAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEAF 177

Query: 182 ITNLVNWEYVCERYE 196
             NLVNW +V E++E
Sbjct: 178 W-NLVNWAFVAEQFE 191


>gi|28871499|ref|NP_794118.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970314|ref|ZP_03398444.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato T1]
 gi|301385466|ref|ZP_07233884.1| superoxide dismutase [Pseudomonas syringae pv. tomato Max13]
 gi|302063004|ref|ZP_07254545.1| superoxide dismutase [Pseudomonas syringae pv. tomato K40]
 gi|302135288|ref|ZP_07261278.1| superoxide dismutase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28854750|gb|AAO57813.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213924986|gb|EEB58551.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato T1]
 gi|330877882|gb|EGH12031.1| superoxide dismutase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330966142|gb|EGH66402.1| superoxide dismutase [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331017974|gb|EGH98030.1| superoxide dismutase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 193

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALAEAINTAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V ++Y
Sbjct: 177 AFW-NLVNWDFVAKQY 191


>gi|294677833|ref|YP_003578448.1| superoxide dismutase [Rhodobacter capsulatus SB 1003]
 gi|294476653|gb|ADE86041.1| superoxide dismutase (Fe) [Rhodobacter capsulatus SB 1003]
          Length = 200

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 131/201 (65%), Gaps = 9/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY++D L+   MSKETLEYHHD+HHK Y DN  KL +  E    S+EEI+  
Sbjct: 1   MAFELPALPYAHDALAALGMSKETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSVEEIVKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNNASQ++NH  FW  M   + K K+P  L  A+ + FGS  KFK D 
Sbjct: 61  TYCAGAVAQSGIFNNASQHWNHAQFWEMMGPGEDK-KMPGELEKALVEAFGSVAKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+I+KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 120 AAAGAAQFGSGWAWL-VKDTDGALKITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 178

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+  LVNWE V  R
Sbjct: 179 RPVYLTNFLDKLVNWENVASR 199


>gi|315224726|ref|ZP_07866549.1| superoxide dismutase [Capnocytophaga ochracea F0287]
 gi|314945354|gb|EFS97380.1| superoxide dismutase [Capnocytophaga ochracea F0287]
          Length = 201

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E H+  HH  Y  N     + A +   ++EEI+     
Sbjct: 2   FTLPKLPYAYNALEPYIDARTMEIHYTKHHNAYTTNLNTALAPAGVEGKTIEEILTSLDM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AI++ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEVMSPNGG-GKPTGELAKAIEEAFGSFEAFKEVFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GKLEI  T N +NPL+     G  PILG+DVWEHAYYL ++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKLEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLHYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERYET 197
           IE+F  N++NW  V E Y T
Sbjct: 181 IEAFF-NVINWAKVAELYST 199


>gi|190571001|ref|YP_001975359.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019521|ref|ZP_03335327.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357273|emb|CAQ54700.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994943|gb|EEB55585.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|222825030|dbj|BAH22188.1| superoxide dismutase [Wolbachia endosymbiont of Cadra cautella]
          Length = 202

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/196 (45%), Positives = 126/196 (64%), Gaps = 3/196 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L PY+S  TL +H+D HHK Y +   +L  + +  H+ +EE++ K 
Sbjct: 1   MSFTLPELPYDKAALEPYISANTLNFHYDKHHKGYLNKLNELVENTDYQHMEIEELVTKV 60

Query: 61  HGSN--AGLFNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG+N    +FNN +Q +NH  +W  MKKN G K K    L+  I D+ G F+KF  +   
Sbjct: 61  HGNNNTVPIFNNVAQVWNHTFYWNSMKKNGGGKPKDDGLLAKKIQDDIGGFDKFCEEFSN 120

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
              +QFGSGW WL ++ GKL+I+KT NA+ PLI G +P+L +DVWEHAYYLD + RR  Y
Sbjct: 121 YGVSQFGSGWVWLVLEKGKLKITKTPNADLPLIYGQVPLLTMDVWEHAYYLDCQNRRIDY 180

Query: 178 IESFITNLVNWEYVCE 193
           I+ F+ +L+NW++V E
Sbjct: 181 IKVFLDHLINWDFVEE 196


>gi|146298890|ref|YP_001193481.1| superoxide dismutase [Flavobacterium johnsoniae UW101]
 gi|146153308|gb|ABQ04162.1| Superoxide dismutase [Flavobacterium johnsoniae UW101]
          Length = 203

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 125/201 (62%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     +  ++   ++E I+I  
Sbjct: 1   MAFELPQLPYAYDALEPHIDARTMEIHHTKHHNAYTTNLNAAIAGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA + NN   +YNHNLFW  M  N G G     L  AI+ +FGSFE+FK+    A +
Sbjct: 61  DKSNAAVRNNGGGFYNHNLFWTVMSPNGG-GLPTGDLLAAIESSFGSFEEFKAKFAKAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLI-----NGAIPILGIDVWEHAYYLDFKYRR 174
           TQFGSGW WL+V K GKLE+  T N +NPL+     +G  PILG+DVWEHAYYL+++ RR
Sbjct: 120 TQFGSGWAWLTVQKGGKLEVVGTPNQDNPLMPEVAGHGGTPILGMDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERY 195
             YIE+F + ++NW  V  R+
Sbjct: 180 PDYIEAFFS-VINWTEVARRF 199


>gi|262341068|ref|YP_003283923.1| superoxide dismutase (Mn/Fe) [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272405|gb|ACY40313.1| superoxide dismutase (Mn/Fe) [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 207

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 129/203 (63%), Gaps = 5/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP L YSY D  PY+ ++T++ H++ HH  Y +N  K  S  +M++LS+EEI+ +S
Sbjct: 1   MSFKLPKLSYSYKDFEPYIDRKTMDIHYNKHHGTYTENLNKAISGTDMMNLSIEEILRRS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +     + NN+  +YNHNLFW  +  +    ++   L++ I  +F SF+ FK    TAAS
Sbjct: 61  YMETPAIRNNSGGFYNHNLFWDILIPSSEYTEISSFLNEKIQKDFDSFDSFKKKFTTAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAH 176
            +FGSGW WL VK  KL I  T N +NP+++G     +PILG+DVWEHAYYL ++ RR  
Sbjct: 121 NRFGSGWAWLCVKEKKLTICSTANQDNPIMSGIGCEGVPILGLDVWEHAYYLQYQNRRLD 180

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI SF  N++NW+ V E Y+  +
Sbjct: 181 YISSF-WNIINWKKVEENYKKII 202


>gi|87301162|ref|ZP_01084003.1| superoxide dismutase [Synechococcus sp. WH 5701]
 gi|87284130|gb|EAQ76083.1| superoxide dismutase [Synechococcus sp. WH 5701]
          Length = 199

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  + L P++S+ TLE+HH  HH  Y  N  KL    ++   SLE++I   
Sbjct: 1   MAHTLPALPYDINALEPHISQTTLEFHHGKHHAAYVANLNKLLDGTDLDGKSLEDVITSV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G G+   AL++ I+ +FGSFE F     TA
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGG-GQPSGALAEKINADFGSFEAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +  G L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ +R  Y+
Sbjct: 120 GATQFGSGWAWLILDGGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNKRPDYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F+  LVNW++V      A
Sbjct: 180 TTFLEKLVNWDFVAANLAAA 199


>gi|21674036|ref|NP_662101.1| superoxide dismutase [Chlorobium tepidum TLS]
 gi|21647185|gb|AAM72443.1| superoxide dismutase [Chlorobium tepidum TLS]
          Length = 200

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 128/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++ P LPY+ + L P++S  T+ +H+  HH  Y  N            +SLEE+II+ 
Sbjct: 1   MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGFVEGTPYDAMSLEEVIIQT 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            S  S  G+FNN +Q +NH+ +W C+  N G G+    ++  I ++FGS +KFK +L  A
Sbjct: 61  ASDASKTGIFNNGAQAWNHSFYWNCLTPNGG-GEPTGEIATKITEDFGSVDKFKEELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +  GKL+++KT NA+NP+ +G  P+L IDVWEHAYYLD++ RR  ++
Sbjct: 120 AATQFGSGWAWLVLDGGKLKVTKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NWE++   Y  A
Sbjct: 180 AAVIENLINWEFINANYAAA 199


>gi|87125508|ref|ZP_01081353.1| superoxide dismutase [Synechococcus sp. RS9917]
 gi|86166808|gb|EAQ68070.1| superoxide dismutase [Synechococcus sp. RS9917]
          Length = 199

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 125/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I   
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNAYVANLNKAIEGTDLDGKSLEEVITAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G G+   AL + I+ +FGS++ F      A
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGG-GQPSGALLEKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGSLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 STYLDKLVNWDFVAANLAAA 199


>gi|294463734|gb|ADE77392.1| unknown [Picea sitchensis]
          Length = 253

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 126/198 (63%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F L   PY  D L P+MS+ TLE+H   HH+ Y DN  K     E+   +LEE+I  ++ 
Sbjct: 43  FGLKEPPYKLDALEPFMSRRTLEFHWGKHHRGYVDNLNKQIEGNELEGFTLEELIKVTYN 102

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH+LFW CM+  +G G     + + I+ +FGS+  F  +   AA+
Sbjct: 103 NGNPMPAFNNAAQVWNHDLFWECMEP-EGGGDCTGMIQEFIERDFGSYNNFVEEFKQAAT 161

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL VK+ KL + K+ NA NPLI G IP+L IDVWEH YY+D++ RRA Y+ +
Sbjct: 162 TQFGSGWVWLVVKDSKLAVEKSTNALNPLIWGHIPLLTIDVWEHGYYIDYQNRRADYVSA 221

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLV+W+ V  R+  A
Sbjct: 222 FMDNLVSWDAVNARFGRA 239


>gi|89099168|ref|ZP_01172046.1| manganese superoxide dismutase [Bacillus sp. NRRL B-14911]
 gi|89086014|gb|EAR65137.1| manganese superoxide dismutase [Bacillus sp. NRRL B-14911]
          Length = 202

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P + KET+  HH  HH  Y  N    L  + E+L  ++EE++  
Sbjct: 1   MAFELPQLPYAYDALEPNIDKETMNIHHTKHHNTYVTNLNNALEGNEELLSKTVEEVVSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L DAI   FG+FE FK + 
Sbjct: 61  LDAVPESVRTAVRNNGGGHANHSLFWQILSPNGG-GEPTGELQDAISSKFGNFESFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AKAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N VNWE V +RY +A
Sbjct: 180 EYINNFF-NAVNWEEVSKRYSSA 201


>gi|330957923|gb|EGH58183.1| superoxide dismutase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 193

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/198 (47%), Positives = 127/198 (64%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALAEAINAAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDKPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V ++Y +
Sbjct: 177 AFW-NLVNWDFVAQQYAS 193


>gi|330973342|gb|EGH73408.1| superoxide dismutase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 193

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 127/198 (64%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++ +
Sbjct: 177 AFW-NLVNWDFVAKQFAS 193


>gi|194288712|ref|YP_002004619.1| superoxide dismutase [Cupriavidus taiwanensis LMG 19424]
 gi|193222547|emb|CAQ68550.1| superoxide dismutase [Cupriavidus taiwanensis LMG 19424]
          Length = 193

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 128/196 (65%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI+ KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENATLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K N G G+   AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWDSLKPNGG-GQPTGALADAINAKWGSFDKFKEEFTKVAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NVVNWDFAGKNF 191


>gi|15599562|ref|NP_253056.1| superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|107100050|ref|ZP_01363968.1| hypothetical protein PaerPA_01001071 [Pseudomonas aeruginosa PACS2]
 gi|116052400|ref|YP_792711.1| superoxide dismutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893457|ref|YP_002442326.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
 gi|254238971|ref|ZP_04932294.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|254244824|ref|ZP_04938146.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|296391073|ref|ZP_06880548.1| superoxide dismutase [Pseudomonas aeruginosa PAb1]
 gi|313106895|ref|ZP_07793099.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
 gi|12230961|sp|P53641|SODF_PSEAE RecName: Full=Superoxide dismutase [Fe]
 gi|9950594|gb|AAG07754.1|AE004852_7 superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|115587621|gb|ABJ13636.1| iron superoxide dismutase' [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170902|gb|EAZ56413.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|126198202|gb|EAZ62265.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|218773685|emb|CAW29499.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
 gi|310879601|gb|EFQ38195.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
          Length = 193

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 177 AFW-NLVNWDFVAKNF 191


>gi|152986717|ref|YP_001350273.1| superoxide dismutase [Pseudomonas aeruginosa PA7]
 gi|150961875|gb|ABR83900.1| superoxide dismutase [Pseudomonas aeruginosa PA7]
          Length = 193

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 177 AFW-NLVNWDFVAKNF 191


>gi|156332920|ref|XP_001619321.1| hypothetical protein NEMVEDRAFT_v1g231554 [Nematostella vectensis]
 gi|156202291|gb|EDO27221.1| predicted protein [Nematostella vectensis]
          Length = 202

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 123/202 (60%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     S  ++   S+E I+I  
Sbjct: 1   MAFELPKLPYAYDALEPHIDARTMEIHHSKHHNGYTTNLNNAISGTDLEGKSIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   YYNHNLFW  M  N G G     L+ AID  FGSFE FK++   AA+
Sbjct: 61  DLNNGAVRNNGGGYYNHNLFWTVMSPNGG-GNPTGELAAAIDAAFGSFEAFKTEFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GKLE+  + N +NPL+     G  PIL +DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKLEVCSSANQDNPLMPGIGCGGTPILALDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+E+F  N+++W  V  R+ T
Sbjct: 180 DYVEAFF-NVIDWTEVTRRFAT 200


>gi|257486400|ref|ZP_05640441.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289677768|ref|ZP_06498658.1| superoxide dismutase [Pseudomonas syringae pv. syringae FF5]
 gi|302189753|ref|ZP_07266426.1| superoxide dismutase [Pseudomonas syringae pv. syringae 642]
 gi|330895178|gb|EGH27516.1| superoxide dismutase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330945379|gb|EGH46986.1| superoxide dismutase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330950173|gb|EGH50433.1| superoxide dismutase [Pseudomonas syringae Cit 7]
 gi|330981173|gb|EGH79276.1| superoxide dismutase [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330989425|gb|EGH87528.1| superoxide dismutase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 193

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 126/196 (64%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V +++
Sbjct: 177 AFW-NLVNWDFVAKQF 191


>gi|78188935|ref|YP_379273.1| superoxide dismutase [Chlorobium chlorochromatii CaD3]
 gi|78171134|gb|ABB28230.1| superoxide dismutase [Chlorobium chlorochromatii CaD3]
          Length = 198

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 124/197 (62%), Gaps = 3/197 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+   L P++S  TL +H+  HH  Y  N   L +      +SLEE+I+++
Sbjct: 1   MAYQQPPLPYADTALEPHISANTLSFHYGKHHVTYITNYNNLVAGTPFESMSLEEVIMQT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               +   +FNNA+Q +NH  +W C+  N G GK   AL+D I+ +FGSF+KFK +L  A
Sbjct: 61  ANDAAKVAIFNNAAQAWNHTFYWNCLSPNGG-GKPTGALADKIEADFGSFDKFKEELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL ++   L+I KT NA+ PL +   P+L IDVWEHAYYLDF+ RR  Y+
Sbjct: 120 AVTQFGSGWAWLVLEGETLKIVKTGNAQTPLTSAQKPLLTIDVWEHAYYLDFQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERY 195
            + I NL+NWE+    +
Sbjct: 180 SAVIENLLNWEFAAANF 196


>gi|114331202|ref|YP_747424.1| superoxide dismutase [Nitrosomonas eutropha C91]
 gi|114308216|gb|ABI59459.1| Superoxide dismutase [Nitrosomonas eutropha C91]
          Length = 212

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/192 (46%), Positives = 118/192 (61%), Gaps = 3/192 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS-- 60
           + LP LPY+ + L P +S  TL +H+  HHK Y DN  KL         SLE+II+ +  
Sbjct: 18  YVLPPLPYADNALEPVISAHTLSFHYGKHHKGYVDNLNKLVMGTPFAGQSLEQIIMATAG 77

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           H    G+FNNA+Q +NH  +W  +  N G G+ P AL   I++ FGS E FK +  TAA 
Sbjct: 78  HADKIGIFNNAAQVWNHMFYWNSLSPNGG-GEPPAALKQKIEEAFGSVEAFKQEFATAAI 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+ +  KL I KT NA++PL     P+L IDVWEHAYYLDF+ RR  Y+ +
Sbjct: 137 TQFGSGWAWLAQEGTKLTIIKTSNADSPLTRSIRPLLTIDVWEHAYYLDFQNRRPDYVNT 196

Query: 181 FITNLVNWEYVC 192
            I  L+NWE+  
Sbjct: 197 VIDKLINWEFAA 208


>gi|256827891|ref|YP_003156619.1| Superoxide dismutase [Desulfomicrobium baculatum DSM 4028]
 gi|256577067|gb|ACU88203.1| Superoxide dismutase [Desulfomicrobium baculatum DSM 4028]
          Length = 198

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 130/196 (66%), Gaps = 3/196 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPYS D LSP +S +TL++HH  HH+ Y DN  KL +  ++   +L EI++ +
Sbjct: 1   MIFVLPDLPYSKDALSPCISAKTLDFHHGKHHQLYIDNTNKLIAGTDLEGQTLREIVMAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               + AG+FNNA+Q +NH+ +W CMK   G      A+++ I+  FG++E F      A
Sbjct: 61  ANDPAKAGIFNNAAQVWNHSFYWRCMKAGGGG-APTGAVAEGINKAFGNYENFAKAFKEA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL  KNGKLEI KT NA+ P+ +GA  +L  DVWEHAYYLD++ RRA Y+
Sbjct: 120 GMTQFGSGWAWLVEKNGKLEIMKTGNADTPMAHGAKALLTADVWEHAYYLDYQNRRADYL 179

Query: 179 ESFITNLVNWEYVCER 194
           + F+  L+NWE+V ++
Sbjct: 180 QDFLGKLINWEFVNQQ 195


>gi|77380104|gb|ABA71697.1| iron-superoxide dismutase [Chlorella pyrenoidosa]
          Length = 203

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 132/202 (65%), Gaps = 5/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P+MS+++LE+H+  HH+ Y DN  K  + + +   +LEE+I +S
Sbjct: 1   MPFQLPPLPYAINALEPHMSQKSLEFHYGKHHQTYLDNMNKRIAGSNLESKTLEEVIKES 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +GS   +FNNA+Q +NH  FW  MK N G G     L++AI+   GS + FK+    A
Sbjct: 61  WNNGSPTAVFNNAAQVWNHTFFWESMKPNGG-GAPSGKLAEAINAASGSLDDFKAQFKNA 119

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAH 176
            +TQFGSGW WL   K+GKL I KT NA  PL+  +  PIL +DVWEHAYYLD + RR  
Sbjct: 120 GATQFGSGWAWLVTDKSGKLSIEKTPNAVTPLVEESKTPILTMDVWEHAYYLDVQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ +F+ +L++W+ V +RYE A
Sbjct: 180 YMTTFVDSLIDWDNVGKRYEAA 201


>gi|148652121|ref|YP_001279214.1| superoxide dismutase [Psychrobacter sp. PRwf-1]
 gi|148571205|gb|ABQ93264.1| Superoxide dismutase [Psychrobacter sp. PRwf-1]
          Length = 209

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 129/199 (64%), Gaps = 4/199 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS- 60
           +  LP+LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +   +L+EII  + 
Sbjct: 3   NITLPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKALDEIITATA 62

Query: 61  -HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA
Sbjct: 63  KDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAA 122

Query: 120 STQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           ++QFGSGW WL   +  GKL I KT NA+ PL +G + +L  DVWEHAYY+D++ RR  Y
Sbjct: 123 TSQFGSGWAWLVADSVGGKLSIMKTANADTPLAHGKVAVLTCDVWEHAYYIDYRNRRPDY 182

Query: 178 IESFITNLVNWEYVCERYE 196
           +++F+  LVNW+Y   +Y+
Sbjct: 183 VDTFLEKLVNWDYANAKYK 201


>gi|256819283|ref|YP_003140562.1| Superoxide dismutase [Capnocytophaga ochracea DSM 7271]
 gi|256580866|gb|ACU92001.1| Superoxide dismutase [Capnocytophaga ochracea DSM 7271]
          Length = 201

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 122/198 (61%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E H+  HH  Y  N     + A +   ++EEI+     
Sbjct: 2   FTLPKLPYAYNALEPYIDARTMEIHYTKHHNAYTTNLNTALAPAGVEGKTIEEILTSLDM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AI++ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEVMSPNGG-GKPTGELAKAIEEAFGSFEAFKEAFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GKLEI  T N +NPL+     G  PILG+DVWEHAYYL ++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKLEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLHYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERY 195
           IE+F  N++NW  V E Y
Sbjct: 181 IEAFF-NVINWAKVAELY 197


>gi|42520581|ref|NP_966496.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99034312|ref|ZP_01314352.1| hypothetical protein Wendoof_01000847 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410320|gb|AAS14430.1| superoxide dismutase, Fe [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 206

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 131/205 (63%), Gaps = 6/205 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L PY+S +TL++H+D HHK Y +   +L  + +  H+ +EE+I K 
Sbjct: 1   MSFTLPELPYDKTALEPYISAKTLDFHYDKHHKGYLNKLNELVENTDYQHVKIEELITKV 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG++  L  FNNA+Q +NH  +W  MKKN G K K    L+  I D+ G F+KF  +  +
Sbjct: 61  HGNSGNLPIFNNAAQVWNHTFYWNSMKKNGGGKPKDGSLLAKKIQDDIGGFDKFYEEFSS 120

Query: 118 AASTQFGSGWGWLSVKNG---KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              +QFGSGW WL ++ G   KL+I+KT NA+ P+I G +P+L +DVWEHAYYLD + RR
Sbjct: 121 HGVSQFGSGWVWLVLEKGRLGKLKITKTPNADLPIIYGQVPLLTMDVWEHAYYLDCQNRR 180

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI+ F+ +L+NW++  E  E  M
Sbjct: 181 IDYIKVFLDHLINWDFAEENLEEYM 205


>gi|115372548|ref|ZP_01459856.1| superoxide dismutase (Fe) [Stigmatella aurantiaca DW4/3-1]
 gi|310819120|ref|YP_003951478.1| superoxide dismutase, fe [Stigmatella aurantiaca DW4/3-1]
 gi|115370510|gb|EAU69437.1| superoxide dismutase (Fe) [Stigmatella aurantiaca DW4/3-1]
 gi|309392192|gb|ADO69651.1| Superoxide dismutase, Fe [Stigmatella aurantiaca DW4/3-1]
          Length = 194

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 123/192 (64%), Gaps = 4/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY  D L+P+MS ETL+YHH  HH  Y +   +L +       SL +II+ S
Sbjct: 1   MPFMLPELPYPKDALAPHMSAETLDYHHGKHHATYVNKLNELLAGKPEADKSLVDIILSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  FW CMK + G G     L+DAI+ +FGS++ FK     AA+
Sbjct: 61  DGP---VFNNAAQVWNHTFFWHCMKPSGG-GAPAGELADAINRDFGSYDNFKKAFSEAAT 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL     KL + KT NA+ P+ +G   +L IDVWEHAYY+D++  R  +IE+
Sbjct: 117 TQFGSGWAWLVQDGSKLAVMKTANADLPMKHGKKALLTIDVWEHAYYIDYRNARPKFIET 176

Query: 181 FITNLVNWEYVC 192
           F+T+LVNW++V 
Sbjct: 177 FLTSLVNWDFVA 188


>gi|331009889|gb|EGH89945.1| superoxide dismutase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 193

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 125/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G    AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GDPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V +++
Sbjct: 177 AFW-NLVNWDFVAKQF 191


>gi|295399183|ref|ZP_06809165.1| Superoxide dismutase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110215|ref|YP_003988531.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y4.1MC1]
 gi|294978649|gb|EFG54245.1| Superoxide dismutase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215316|gb|ADP73920.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y4.1MC1]
          Length = 204

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L PY+ KET+  HH  HH  Y  N    L   A++ + SLEE++  
Sbjct: 1   MAFELPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELAEAINKKFGSFAAFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TKAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 EYIAAFW-NIVNWDEVAKRYSEA 201


>gi|319651564|ref|ZP_08005691.1| superoxide dismutase [Bacillus sp. 2_A_57_CT2]
 gi|317396631|gb|EFV77342.1| superoxide dismutase [Bacillus sp. 2_A_57_CT2]
          Length = 202

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P + KET+  HH  HH  Y  N    L  + E+L  ++EE++  
Sbjct: 1   MAFELPQLPYAYDALEPNIDKETMNIHHTKHHNTYVTNLNNALEGNEELLSKTVEEVVSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L+DAI   FGS++ FK + 
Sbjct: 61  LDAVPEAVRTAVRNNGGGHANHSLFWQIISPNGG-GEPTGELADAISSKFGSYDSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL+V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AKAATTRFGSGWAWLAVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI SF  N+VNW+ V +RY  A
Sbjct: 180 EYINSFW-NVVNWDEVSKRYSAA 201


>gi|294084989|ref|YP_003551749.1| superoxide dismutase (Fe) [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664564|gb|ADE39665.1| superoxide dismutase (Fe) [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 199

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 131/201 (65%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPYS+D L+   MS ETLEYHHD+HH  Y  N  KL +  E  + SLE+II  
Sbjct: 1   MAFTLPDLPYSHDALAGLGMSAETLEYHHDLHHNAYVVNGNKLVAGTEWENKSLEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ ++A    G+FNNASQ++NH  FW  M    GK  +P  L  A+ ++FGS + F    
Sbjct: 61  TYQADAVAQNGIFNNASQHWNHMQFWEMMGP--GKTAMPSELEKALVESFGSVDAFNDAF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A ++QFGSGW WL VKN  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 KAAGASQFGSGWCWL-VKNADGGLQVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE+V  +
Sbjct: 178 RPDYLSNFLDNLVNWEFVAAQ 198


>gi|254452594|ref|ZP_05066031.1| superoxide dismutase (Fe) [Octadecabacter antarcticus 238]
 gi|198267000|gb|EDY91270.1| superoxide dismutase (Fe) [Octadecabacter antarcticus 238]
          Length = 199

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 128/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD HH  Y +N  K  +  E    SLE+II  
Sbjct: 1   MAFELPDLPYAHDALATKGMSAETLEYHHDKHHNAYVENGNKAIAGTEWDGKSLEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ ++A    G+FNN SQ +NHN FW  M  N   G +P  L  AI D+FGS + FKS  
Sbjct: 61  TYDASAVAQSGIFNNISQLWNHNQFWEMMGPN--GGAMPSELEAAIKDSFGSVDDFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NP+  G   +LG DVWEH+YY+DF+  
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGSLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNA 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPKYLNNFLDNLVNWENVASR 198


>gi|110679070|ref|YP_682077.1| superoxide dismutase (Fe) [Roseobacter denitrificans OCh 114]
 gi|109455186|gb|ABG31391.1| superoxide dismutase (Fe) [Roseobacter denitrificans OCh 114]
          Length = 199

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 127/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HH  Y  N  K     E    S+E+II  
Sbjct: 1   MAFELPDLPYAHDALAGKGMSAETLEYHHDLHHNAYVTNGNKAIEGTEWAGKSMEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ ++A    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ +NFGS + FK   
Sbjct: 61  TYDASAVAQNGIFNNISQLWNHNQFWEMMGP--GESKMPGELEKALTENFGSVDAFKEQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKNPDGSLAVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|119484749|ref|ZP_01619231.1| superoxide dismutase [Lyngbya sp. PCC 8106]
 gi|119457567|gb|EAW38691.1| superoxide dismutase [Lyngbya sp. PCC 8106]
          Length = 201

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 128/201 (63%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII-- 57
           M F+LP LPY  D L S  MSK+T  +HH  HH  Y +    +    ++ + SLEEI+  
Sbjct: 1   MAFELPELPYPADALESSGMSKQTFSFHHGKHHAAYVNKLNGMIEGTDLANKSLEEIVKA 60

Query: 58  IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
             +  S +G+FNNA+Q +NH+ FW CMK   G      AL++ I+ +FGS+EKF  +   
Sbjct: 61  TANDPSKSGIFNNAAQVWNHSFFWKCMKPGGGGKPS-GALAEKINADFGSYEKFAEEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           A +TQFGSGW WL ++NG L++ KT NA NP+I G  P+L +DVWEHAYYLDF+  R  Y
Sbjct: 120 AGATQFGSGWAWLVLENGSLKVKKTLNAINPIIEGVTPLLTMDVWEHAYYLDFQNARPGY 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+  LVNW++V E    A
Sbjct: 180 IDNFLGKLVNWDFVAENLAAA 200


>gi|254436686|ref|ZP_05050180.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Octadecabacter antarcticus 307]
 gi|198252132|gb|EDY76446.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Octadecabacter antarcticus 307]
          Length = 199

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 127/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLE+HHD HH  Y +N  K  +  E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEFHHDKHHNAYVENGNKAIAGTEWDGKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +H ++A    G+FNN SQ +NHN FW  M  N     +P  L  AI D+FGS + FKS  
Sbjct: 61  THDASAVAQSGIFNNISQLWNHNQFWEMMGPN--GAMMPSELESAIKDSFGSVDDFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NP+  G   +LG DVWEH+YY+DF+  
Sbjct: 119 SAAGAGQFGSGWAWL-VKDTDGSLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNA 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPKYLTNFLDNLVNWENVASR 198


>gi|239787519|emb|CAX83989.1| Superoxide dismutase [uncultured bacterium]
          Length = 198

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 123/196 (62%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P+MS  T E+HH  HH  Y  N   L       +  LEE+ ++ 
Sbjct: 1   MAFELPALPYASNALEPHMSARTFEFHHGKHHAAYVTNLNNLVKGTPYENRPLEEVFMEV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLIT 117
            G  S A +FNNA+Q +NH  FW CMK   G G  P   L   ID  FGSF+KFK +   
Sbjct: 61  GGDVSKAAIFNNAAQVWNHTFFWNCMKP--GGGGAPTGDLKAKIDAAFGSFDKFKEEFKA 118

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA   FGSGW WL + NG+++ISKT NA+ P+ +G   +L +DVWEHAYY+D++ RR  +
Sbjct: 119 AAVGNFGSGWTWLVIDNGEMKISKTSNADTPMRHGQKALLTVDVWEHAYYIDYQNRRPDF 178

Query: 178 IESFITNLVNWEYVCE 193
           +++F+ +LVNW++V +
Sbjct: 179 VQAFLDHLVNWDFVAK 194


>gi|71066493|ref|YP_265220.1| superoxide dismutase [Psychrobacter arcticus 273-4]
 gi|71039478|gb|AAZ19786.1| probable superoxide dismutase [Psychrobacter arcticus 273-4]
          Length = 209

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 125/196 (63%), Gaps = 4/196 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS--HG 62
           LP LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +   +L EII+ +    
Sbjct: 6   LPELPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEDKTLSEIIVATAKDD 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA TQ
Sbjct: 66  SKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAALTQ 125

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL      GKL I+KT NA+ PL +  I +L  DVWEHAYY+D++ RR  Y+++
Sbjct: 126 FGSGWAWLVADKVGGKLSIAKTANADTPLAHDQIAVLTCDVWEHAYYVDYRNRRPEYVDT 185

Query: 181 FITNLVNWEYVCERYE 196
           F+  LVNW+Y   +Y+
Sbjct: 186 FLDKLVNWDYANAKYK 201


>gi|6693856|gb|AAF25009.1|AF177945_1 superoxide dismutase [Nostoc commune]
          Length = 200

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+  + L PY M  ET EYH+  HHK Y DN  KL    E+ + SLEE+I  
Sbjct: 1   MAFVQDPLPFDINALDPYGMKAETFEYHYGKHHKAYVDNLNKLTEGTELANKSLEEVIKT 60

Query: 60  S--HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K   G G     L+  ID +FGSF+KFK +   
Sbjct: 61  SFNDSSKAGIFNNAAQVWNHTFFWNSLKPA-GGGAPTGDLAARIDKDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+DF+  R  +
Sbjct: 120 AAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDFRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NLVNW++  E    A
Sbjct: 180 IKNFLDNLVNWDFAAENLAKA 200


>gi|307823562|ref|ZP_07653791.1| Manganese/iron superoxide dismutase-like protein [Methylobacter
           tundripaludum SV96]
 gi|307735547|gb|EFO06395.1| Manganese/iron superoxide dismutase-like protein [Methylobacter
           tundripaludum SV96]
          Length = 193

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L    E   LSLEEII+KS
Sbjct: 1   MAFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLVPGTEFEGLSLEEIIMKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL+DAI+  FGSF KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNSLAPNAG-GEPSGALADAINTTFGSFAKFKEEFTKCAV 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL V+N  G L +  T NA  PL  G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 117 TTFGSGWAWL-VQNADGSLALVSTSNAGCPLTTGQKPLLTCDVWEHAYYIDYRNARPAYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           E+F   LVNW++  + +
Sbjct: 176 EAFWA-LVNWDFAAKNF 191


>gi|93007055|ref|YP_581492.1| superoxide dismutase [Psychrobacter cryohalolentis K5]
 gi|92394733|gb|ABE76008.1| Superoxide dismutase [Psychrobacter cryohalolentis K5]
          Length = 209

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 4/196 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS--HG 62
           LP+LPY+ D L P++S ETLE+HHD HH  Y     +L   + +   +L EIII +    
Sbjct: 6   LPDLPYAKDALEPHISAETLEFHHDKHHNAYVTKLNELLPGSGLEDKTLSEIIIATAKDD 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S  G+FN A+Q +NH  +W CM   +G G+    L   I+++FGS++KF+ +   AA TQ
Sbjct: 66  SKQGMFNQAAQVWNHTFYWNCMTPTNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAALTQ 125

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL      GKL I+KT NA+ PL +  I +L  DVWEHAYY+D++ RR  Y+++
Sbjct: 126 FGSGWAWLVADKVGGKLSIAKTANADTPLAHDQIAVLTCDVWEHAYYIDYRNRRPDYVDT 185

Query: 181 FITNLVNWEYVCERYE 196
           F+  LVNW+Y   +Y+
Sbjct: 186 FLDKLVNWDYANAKYK 201


>gi|145219785|ref|YP_001130494.1| superoxide dismutase [Prosthecochloris vibrioformis DSM 265]
 gi|145205949|gb|ABP36992.1| Superoxide dismutase [Chlorobium phaeovibrioides DSM 265]
          Length = 201

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 126/201 (62%), Gaps = 5/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L P++S +TL +H+  HH  Y  N   L     M  +SLEE+I ++
Sbjct: 1   MAYQQPALPWAENALEPHISAKTLGFHYGKHHAAYVTNFNNLVGGTPMDLMSLEEVIAQT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLIT 117
            G  S AG+FNN +Q +NH+ +W  +      G VP   L +AI  +FGSF+KF+ +L  
Sbjct: 61  AGDSSKAGIFNNGAQAWNHSFYWNSLAP--AGGGVPTGELGEAITRDFGSFDKFRDELKN 118

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL +    L++ KT NAE P+ NG  PIL IDVWEHAYYLD++ RR  Y
Sbjct: 119 AAATQFGSGWAWLVLDGETLKVVKTGNAETPMTNGLKPILTIDVWEHAYYLDYQNRRPDY 178

Query: 178 IESFITNLVNWEYVCERYETA 198
             + I NL+NWE+    Y +A
Sbjct: 179 TAAVIENLLNWEFAAANYASA 199


>gi|268679019|ref|YP_003303450.1| superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
 gi|268617050|gb|ACZ11415.1| Superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
          Length = 198

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 122/194 (62%), Gaps = 5/194 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY    L PY+S  TL YHH  HH+ Y +N   L     +   +LE II  S
Sbjct: 1   MAITLPPLPYEASALEPYISANTLGYHHGKHHQTYVNNLNNLIQSTPLADEALEAIIFAS 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLIT 117
                  G+FNNA+Q +NH  +W+CMKK  G G VP  A++  I ++FGSFE F      
Sbjct: 61  ANVPEKVGIFNNAAQVWNHTFYWSCMKK--GGGGVPSGAVAAKIIEDFGSFEAFIEAFKN 118

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           A  TQFGSGW WL + NGKL+I+KT NA+ P+++    +L +DVWEHAYYLD++ +RA Y
Sbjct: 119 AGLTQFGSGWAWLVLDNGKLKITKTSNADTPMVHQQKALLTVDVWEHAYYLDYQNKRADY 178

Query: 178 IESFITNLVNWEYV 191
           I+ F+ +LVNW++V
Sbjct: 179 IDIFLKHLVNWDFV 192


>gi|237808969|ref|YP_002893409.1| Superoxide dismutase [Tolumonas auensis DSM 9187]
 gi|237501230|gb|ACQ93823.1| Superoxide dismutase [Tolumonas auensis DSM 9187]
          Length = 193

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L+P++S+ETLEYH+  HH  Y  N   L    E  + SLEEI+   
Sbjct: 1   MAFELPALPYEKNALAPHISQETLEYHYGKHHNTYVVNLNNLIPGTEFENKSLEEIV--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            GS+ G+FNNA+Q +NH  +W C+  N G G+   AL+DAI   FGSFEKFK +   +A 
Sbjct: 58  KGSSGGIFNNAAQVWNHTFYWHCLSPNGG-GEPTGALADAIVATFGSFEKFKEEFTKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL  K +G L +  T NA  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TNFGSGWTWLVKKADGSLALQNTSNAGCPLTDGVTPVLTADVWEHAYYIDYRNLRPKYME 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNWE+  + +
Sbjct: 177 AFWA-LVNWEFAAKNF 191


>gi|228473750|ref|ZP_04058495.1| superoxide dismutase [Capnocytophaga gingivalis ATCC 33624]
 gi|228274771|gb|EEK13594.1| superoxide dismutase [Capnocytophaga gingivalis ATCC 33624]
          Length = 201

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 124/200 (62%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L P +   T+E H+  HHK Y DN     +   +   S+E+I++  
Sbjct: 1   MSFTLPQLPYAYEALEPSIDARTMEIHYTKHHKAYTDNLNNAIAGTPLEGKSIEDILLHL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVP-QALSDAIDDNFGSFEKFKSDLITAA 119
              N  + NN   YYNHNLFW  +     KG  P + L+ AID+ FGSFE FK+    AA
Sbjct: 61  DTENKAVRNNGGGYYNHNLFWEILTPK--KGTAPSEELAKAIDEAFGSFEAFKTAFSKAA 118

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPL---INGAIPILGIDVWEHAYYLDFKYRRA 175
           +TQFGSGW WL+V K GK+ +  T N +NPL   + G  PILG+DVWEHAYYL+++ RRA
Sbjct: 119 ATQFGSGWAWLTVQKGGKVAVLSTANQDNPLMPHVGGGTPILGLDVWEHAYYLNYQNRRA 178

Query: 176 HYIESFITNLVNWEYVCERY 195
            YIE+F   ++NWE V + Y
Sbjct: 179 DYIEAFFA-IINWEKVSQLY 197


>gi|237746705|ref|ZP_04577185.1| superoxide dismutase [Oxalobacter formigenes HOxBLS]
 gi|229378056|gb|EEO28147.1| superoxide dismutase [Oxalobacter formigenes HOxBLS]
          Length = 192

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ +LP LPY  D L PY+S+ETLEYH+  HHK Y DN  KL  + E  +++LE+II KS
Sbjct: 1   MEHQLPPLPYPMDALQPYISQETLEYHYGKHHKAYVDNLNKLIKNTEFENMALEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W CMK N G GK   AL DAI   +G+F  F+   + A S
Sbjct: 61  SG---GIFNNAAQTWNHTFYWNCMKPNGG-GKPAGALRDAIQAKWGTFADFQKAFVAACS 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           + FGSGW WL  K +G ++I  T NA  PL     P+L  DVWEHAYY+D++  R  Y +
Sbjct: 117 SNFGSGWTWLVKKPDGSVDIVNTSNAGTPLTGQDKPLLTCDVWEHAYYIDYRNARVKYAD 176

Query: 180 SFITNLVNWEYVCERY 195
            F  N+VNW++V   +
Sbjct: 177 EFW-NVVNWDFVTANF 191


>gi|146308342|ref|YP_001188807.1| superoxide dismutase [Pseudomonas mendocina ymp]
 gi|145576543|gb|ABP86075.1| Superoxide dismutase [Pseudomonas mendocina ymp]
          Length = 193

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFSKVSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + Y
Sbjct: 177 AFW-NLVNWDFVAQNY 191


>gi|89054680|ref|YP_510131.1| superoxide dismutase [Jannaschia sp. CCS1]
 gi|88864229|gb|ABD55106.1| Superoxide dismutase [Jannaschia sp. CCS1]
          Length = 199

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 127/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+ + MS ETLEYHHD+HH  Y  N  K     E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALAAHGMSAETLEYHHDLHHNAYVTNGNKAIEGTEWEGKSLEEIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + A    G+FNN SQ +NHN FW  M    G   +P  L  A+ ++FGS ++FKS  
Sbjct: 61  TYDAGAVAQNGIFNNISQLWNHNQFWEMMGP--GASSMPSELESALTESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL      +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKNADGSLAVTKTENGVNPLCFNQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+++F+ NLVNWE V  R
Sbjct: 178 RPDYLKNFLDNLVNWENVASR 198


>gi|312838461|gb|ADR01298.1| iron-superoxide dismutase [Ceratopteris thalictroides]
          Length = 266

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 126/211 (59%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+F L  LP+  D L PYMSK+TLE+H   HH+ Y DN  K     E+  + L+E++   
Sbjct: 40  MEFHLRPLPFEMDALEPYMSKQTLEFHWGKHHRTYVDNLNKQIKGTELEGMQLDELL--K 97

Query: 61  HGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           HG N G     FNNA Q +NH+ FW  +K   GK    + L   I+ +FGSFE F  +  
Sbjct: 98  HGYNNGNPTAYFNNAGQAWNHDFFWESIKPGGGKKPTGEVLH-LIERDFGSFEAFVDEFK 156

Query: 117 TAASTQFGSGWGWLS-------VKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYY 167
            AA+TQFGSGW WL        V+N  GKL I KT NA NPLI G +P+L IDVWEHAYY
Sbjct: 157 QAAATQFGSGWAWLVGMPTDPLVENKFGKLAIEKTPNALNPLILGHVPLLTIDVWEHAYY 216

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           LD++ RR  YI + I  L++WE V  R E A
Sbjct: 217 LDYQNRRPDYISTVINELISWEAVTARLERA 247


>gi|149275667|gb|ABR23159.1| iron-superoxide dismutase 1 [Ulva fasciata]
          Length = 231

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 122/201 (60%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           ++ K P  PY  D L P+MSK T+E+H   HH+ Y +N  K     E+   SLEEII+ S
Sbjct: 32  LELKAP--PYELDALEPHMSKNTMEFHWGKHHRTYVNNMNKQIEGTELQDKSLEEIIMAS 89

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
              GS   +FNNA+Q +NH  FW  M  N G G    AL  AID  FGSF++FK+    A
Sbjct: 90  WNCGSPTPVFNNAAQIWNHTFFWEGMAPNGG-GTPSGALGAAIDAAFGSFDEFKTQFAAA 148

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WL    +G +E+ KT NA  P++ G   IL +DVWEHAYYLDF+  R  Y
Sbjct: 149 GATQFGSGWAWLVANSDGTVEVLKTPNAVCPMVEGKTAILTMDVWEHAYYLDFQNARPAY 208

Query: 178 IESFITNLVNWEYVCERYETA 198
           I +++  LV+W+ V ERY  A
Sbjct: 209 INTYMDKLVSWDAVAERYAAA 229


>gi|56182538|gb|AAV84021.1| iron superoxide dismutase [Nostoc commune CHEN]
          Length = 200

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 123/198 (62%), Gaps = 5/198 (2%)

Query: 4   KLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           +LP LP+  D L PY M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  S  
Sbjct: 5   QLP-LPFEKDALEPYGMKAETFEYHYGKHHKAYVDNLNKLTEGTELADKSLEEVIKISFQ 63

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S  G+FNNA+Q +NH  FW  +K   G G     L+  ID +FGSF+KFK +   AA+
Sbjct: 64  DSSKVGIFNNAAQVWNHTFFWNSLKPQGG-GTPTGELAAKIDKDFGSFDKFKEEFSNAAA 122

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+D+K  R  +I++
Sbjct: 123 TQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYKNARPAFIKN 182

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW++  E    A
Sbjct: 183 FLENLVNWDFAAENLAKA 200


>gi|330888528|gb|EGH21189.1| superoxide dismutase [Pseudomonas syringae pv. mori str. 301020]
          Length = 193

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 125/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+    G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPKAG-GEPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V +++
Sbjct: 177 AFW-NLVNWDFVAKQF 191


>gi|298492594|ref|YP_003722771.1| superoxide dismutase ['Nostoc azollae' 0708]
 gi|298234512|gb|ADI65648.1| Superoxide dismutase ['Nostoc azollae' 0708]
          Length = 199

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 123/195 (63%), Gaps = 4/195 (2%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+ ++ L PY M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  
Sbjct: 1   MAFTQLPLPFDFNALEPYGMKGETFEYHYGKHHKAYVDNLNKLTDATELADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K   G G     L+  ID +FGSF+KFK +  T
Sbjct: 61  SFKDSSKAGIFNNAAQVWNHTFFWNSLKPAGG-GTPTGELAARIDKDFGSFDKFKEEFST 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL   +G L++ KT NAENPL +G   +L +DVWEHAYY+D++  R  +
Sbjct: 120 AATTQFGSGWAWLIDDSGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAF 179

Query: 178 IESFITNLVNWEYVC 192
           I++F+  LVNWE+  
Sbjct: 180 IKNFLDQLVNWEFAA 194


>gi|113866637|ref|YP_725126.1| superoxide dismutase [Ralstonia eutropha H16]
 gi|113525413|emb|CAJ91758.1| superoxide dismutase [Ralstonia eutropha H16]
          Length = 193

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 127/196 (64%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI+ KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENSTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G G+   AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWDSMKPNGG-GQPTGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NVVNWDFAGKNF 191


>gi|66047286|ref|YP_237127.1| superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
 gi|4581924|gb|AAD24797.1|AF121079_1 iron-superoxide dismutase [Pseudomonas syringae pv. syringae]
 gi|63257993|gb|AAY39089.1| Superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
          Length = 193

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (63%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY    L+P++S ETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYEKTALAPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++ +
Sbjct: 177 AFW-NLVNWDFVAKQFAS 193


>gi|212638719|ref|YP_002315239.1| Superoxide dismutase [Anoxybacillus flavithermus WK1]
 gi|212560199|gb|ACJ33254.1| Superoxide dismutase [Anoxybacillus flavithermus WK1]
          Length = 202

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N    L    E+   ++EE++  
Sbjct: 1   MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNAYVTNLNAALEGHPELQSKTIEELMAH 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L++AI++ FGSFEKFK + 
Sbjct: 61  LNEVPENIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELAEAINNTFGSFEKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N + PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAATRFGSGWAWLVVHNGQLEVTSTPNQDTPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 DYISAFW-NVVNWDEVAKRYAAA 201


>gi|329917205|ref|ZP_08276440.1| Superoxide dismutase (Fe) [Oxalobacteraceae bacterium IMCC9480]
 gi|327544617|gb|EGF30090.1| Superoxide dismutase (Fe) [Oxalobacteraceae bacterium IMCC9480]
          Length = 192

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 125/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLEYH+  HH+ Y  N   L    E    +LE+II KS
Sbjct: 1   MEHTLPALPYAMDALAPHISKETLEYHYGKHHQTYVTNLNNLVKGTEFESATLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  +W C+  N G G    AL+DAI+  FGSFEKFK D   +A 
Sbjct: 61  TG---GVFNNSAQVWNHTFYWNCLTPNGG-GAPTGALADAINAKFGSFEKFKEDFTKSAL 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++++ T NA  PL     P++  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGSVDLANTSNAGCPLTGADTPLMTCDVWEHAYYVDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 177 AFW-NLVNWDFVAKNF 191


>gi|239827731|ref|YP_002950355.1| superoxide dismutase [Geobacillus sp. WCH70]
 gi|239808024|gb|ACS25089.1| Superoxide dismutase [Geobacillus sp. WCH70]
          Length = 204

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N    L   A++ + S+EE++  
Sbjct: 1   MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSIEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELADAINKKFGSFAAFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TKAAATRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V  RY  A
Sbjct: 180 EYIAAFW-NIVNWDEVARRYSEA 201


>gi|44662786|gb|AAS47494.1| iron superoxide dismutase [Pinus pinaster]
          Length = 249

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 125/193 (64%), Gaps = 5/193 (2%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAG 66
           PY +D L P+MSK+TL +H   HH+ Y DN      D E+   +LE+II K++  G    
Sbjct: 54  PYDFDALEPHMSKQTLSFHWGKHHRAYVDNCNNQIKDTELEECTLEDIIKKTYNNGDPRP 113

Query: 67  LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAASTQFGS 125
           +FNNA+Q +NH  FW CMK   G GK P+  + + I  +FG++++F  +   A++TQFGS
Sbjct: 114 VFNNAAQAWNHEFFWECMKP--GGGKEPKGEILELIKRDFGAYDEFLKEFKQASATQFGS 171

Query: 126 GWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNL 185
           GW WL +K+ KL I KT NA NPLI G  P+L IDVWEHAYYLD++ RR  YI +F+  L
Sbjct: 172 GWAWLVLKDNKLVIEKTPNALNPLIWGHKPLLTIDVWEHAYYLDYQNRRPDYISTFMNEL 231

Query: 186 VNWEYVCERYETA 198
           V+W+ V  R + A
Sbjct: 232 VSWDAVNARLDRA 244


>gi|86138489|ref|ZP_01057063.1| superoxide dismutase, Fe [Roseobacter sp. MED193]
 gi|85825014|gb|EAQ45215.1| superoxide dismutase, Fe [Roseobacter sp. MED193]
          Length = 200

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 129/201 (64%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HHK Y DN  KL +  E    S+EEII  
Sbjct: 1   MAFELPDLPYAHDALAAKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSMEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + +    G+FNN SQ +NHN FW  M   D    +P  L  A+ ++FGS ++FKS  
Sbjct: 61  TYDAASVAQNGIFNNISQLWNHNQFWEMMGPGDYA--MPGELEKALVESFGSVDEFKSQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL      +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKNADGSLAVTKTENGVNPLCFDQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLSNFLDNLVNWENVASR 198


>gi|330504562|ref|YP_004381431.1| superoxide dismutase [Pseudomonas mendocina NK-01]
 gi|328918848|gb|AEB59679.1| superoxide dismutase [Pseudomonas mendocina NK-01]
          Length = 193

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLE+HHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEFHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GQPTGALADAINAAFGSFDKFKEEFSKVSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + Y
Sbjct: 177 AFW-NLVNWDFVAQNY 191


>gi|297569223|ref|YP_003690567.1| Superoxide dismutase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925138|gb|ADH85948.1| Superoxide dismutase [Desulfurivibrio alkaliphilus AHT2]
          Length = 199

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 123/195 (63%), Gaps = 5/195 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ + L P++S  TLE+HH  HH+ Y DN  KL + +++  L +EEII K+
Sbjct: 1   MTLVLPQLPYAQNALEPHISARTLEFHHGKHHQAYVDNGNKLLASSDLKGLPMEEIIKKT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               + AG+FNN +Q +NH+ +W  MK   G G     ++  ID +FG    F     TA
Sbjct: 61  AADPAAAGIFNNVAQVWNHSFYWQSMKPGGG-GAPTGRIAAMIDADFGGLAGFAEAFKTA 119

Query: 119 ASTQFGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            +TQFGSGW WL +   +G+L++ KT NAE PL  G  P+L +DVWEHAYYLD++ RR  
Sbjct: 120 GATQFGSGWAWLVLDEASGRLKVVKTPNAETPLTMGMKPLLTMDVWEHAYYLDYQNRRPD 179

Query: 177 YIESFITNLVNWEYV 191
           Y+ +F+  L+NW++V
Sbjct: 180 YMTTFVEKLINWDFV 194


>gi|83943011|ref|ZP_00955471.1| superoxide dismutase, Fe [Sulfitobacter sp. EE-36]
 gi|83954186|ref|ZP_00962906.1| superoxide dismutase, Fe [Sulfitobacter sp. NAS-14.1]
 gi|83841223|gb|EAP80393.1| superoxide dismutase, Fe [Sulfitobacter sp. NAS-14.1]
 gi|83846019|gb|EAP83896.1| superoxide dismutase, Fe [Sulfitobacter sp. EE-36]
          Length = 199

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 125/201 (62%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L S  MSKETLEYHHD HH  Y  N  K     E    +LEEII  
Sbjct: 1   MAFTLPDLPYAHDALASKGMSKETLEYHHDKHHNAYVTNGNKAIEGTEWEGKTLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++  +A    G+FNN SQ +NHN FW  M   D K  +P  L  AI ++FGS +KFK + 
Sbjct: 61  TYNPDAVAQSGIFNNISQLWNHNQFWEMMSPEDSK--MPSELEKAITESFGSVDKFKDEF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A   QFGSGW WL VK+  G L+++KT+N  NP+  G   +LG DVWEH+YY+DF+  
Sbjct: 119 KAAGGGQFGSGWAWL-VKDTDGGLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNA 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNW+ V  R
Sbjct: 178 RPDYLSNFLDNLVNWDNVASR 198


>gi|290465503|gb|ADD25155.1| iron superoxide dismutase [Wolbachia pipientis]
          Length = 206

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 130/205 (63%), Gaps = 6/205 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L PY+  +TL++H+D HHK Y +   +L  + +  H+ +EE+I K 
Sbjct: 1   MSFTLPELPYDKTALEPYIFAKTLDFHYDKHHKGYLNKLNELVENTDYQHVKIEELITKV 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG+  N  +FNNA+Q +NH  +W  MKKN G K K    L+  I D+ G F+KF  +  +
Sbjct: 61  HGNSGNLPIFNNAAQVWNHTFYWNSMKKNGGGKPKDGSFLAKKIQDDIGGFDKFYEEFSS 120

Query: 118 AASTQFGSGWGWLSVKNG---KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              +QFGSGW WL ++ G   KL+I+KT NA+ P+I G +P+L +DVWEHAYYLD + RR
Sbjct: 121 HGVSQFGSGWVWLVLEKGRLGKLKITKTPNADLPIIYGQVPLLTMDVWEHAYYLDCQNRR 180

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI+ F+ +L+NW++  E  E  M
Sbjct: 181 IDYIKVFLDHLINWDFTEENLEEYM 205


>gi|153876311|ref|ZP_02003701.1| Superoxide dismutase [Beggiatoa sp. PS]
 gi|152067225|gb|EDN66299.1| Superoxide dismutase [Beggiatoa sp. PS]
          Length = 192

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 126/197 (63%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY  + L P++SKETLE+H+  HH+ Y  N   L    E   +SLE+I+ KS
Sbjct: 1   MEHTLPALPYEKNALEPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFADMSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+    L+DAI+  FGSF+ FK++    A 
Sbjct: 61  SG---GIFNNAAQIWNHTFYWNSLSPNGG-GQPSGKLADAINSTFGSFDNFKAEFTKTAV 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGWGWL VKN  G L +  T NA NP+ +G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 117 TTFGSGWGWL-VKNTDGSLALVSTSNAGNPMTSGQTPLLTCDVWEHAYYIDYRNARPKYV 175

Query: 179 ESFITNLVNWEYVCERY 195
           E+F + LVNW++V + +
Sbjct: 176 EAFWS-LVNWDFVAKNF 191


>gi|148710409|gb|ABR01632.1| superoxide dismutase [Nostoc flagelliforme]
 gi|148710411|gb|ABR01633.1| superoxide dismutase [Nostoc sphaeroides]
          Length = 200

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+  + L P+ M  ET EYH+  HHK Y DN  KL    E+ + SLEE+I  
Sbjct: 1   MAFVQDPLPFDINALEPHGMKAETFEYHYGKHHKAYVDNLNKLTEGTELANKSLEEVIKT 60

Query: 60  S--HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K   G G     L+  ID +FGSF+KFK +   
Sbjct: 61  SFNDSSKAGIFNNAAQVWNHTFFWNSLKPAGG-GAPTGDLAAKIDKDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+DF+  R  +
Sbjct: 120 AAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDFRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NLVNW++  E    A
Sbjct: 180 IKNFLDNLVNWDFAAENLAKA 200


>gi|225630487|ref|YP_002727278.1| superoxide dismutase [Wolbachia sp. wRi]
 gi|225592468|gb|ACN95487.1| superoxide dismutase [Wolbachia sp. wRi]
          Length = 205

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 128/199 (64%), Gaps = 6/199 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L PY+S +TL++H+D HHK Y +   +L  + +  H+ +EE+I + 
Sbjct: 1   MSFTLPELPYDKTALEPYISAKTLDFHYDKHHKGYLNKLNELVENTDYQHVKIEELITEV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG  SN  +FNNA+Q +NH  +W  MKKN G K K    L+  I D+ G F+KF  +   
Sbjct: 61  HGNSSNLPIFNNAAQVWNHTFYWNSMKKNGGGKPKDSSLLAKKIQDDIGGFDKFYEEFSN 120

Query: 118 AASTQFGSGWGWLSVKNG---KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              +QFGSGW WL ++ G   KL+I+KT NA+ P+I G +P+L +DVWEHAYYLD + RR
Sbjct: 121 HGVSQFGSGWVWLVLEKGRLGKLKITKTPNADLPIIYGQVPLLTMDVWEHAYYLDCQNRR 180

Query: 175 AHYIESFITNLVNWEYVCE 193
             YI+ F+ +L+NW++  E
Sbjct: 181 IDYIKVFLDHLINWDFAEE 199


>gi|254517155|ref|ZP_05129213.1| superoxide dismutase (Fe) [gamma proteobacterium NOR5-3]
 gi|219674660|gb|EED31028.1| superoxide dismutase (Fe) [gamma proteobacterium NOR5-3]
          Length = 199

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYH+  HHK Y D    + +  E+   SLEE+I +S
Sbjct: 8   MAFELPALPYDQNALEPHISAETLEYHYGKHHKTYVDKLNGMLAGTELESASLEEVIRQS 67

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH+ +W C+  N G G+   AL+DAI+  FGSF  FK +   AA+
Sbjct: 68  EG---GVFNNAAQIWNHSFYWECLSPN-GGGEPTGALADAINAAFGSFAAFKEEFSAAAA 123

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL V+N  G + IS T NA  PL     P+L +DVWEHAYY+D++  R  Y+
Sbjct: 124 GNFGSGWTWL-VQNADGSVAISNTSNAGCPLTENVTPLLTVDVWEHAYYIDYRNARPKYL 182

Query: 179 ESFITNLVNWEYV 191
           E+F  NLVNW++V
Sbjct: 183 EAFW-NLVNWDFV 194


>gi|13182789|gb|AAK14938.1| superoxide dismutase [Pseudomonas putida]
          Length = 198

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C++ N G G+   AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLEPNSG-GQPTGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGS WG L  K +G L ++ T  A  PL  G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSDWGCLVKKADGSLALASTIGAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AFW-NLVNWAFVAEQFE 192


>gi|254492459|ref|ZP_05105631.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Methylophaga thiooxidans DMS010]
 gi|224462351|gb|EEF78628.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Methylophaga thiooxydans DMS010]
          Length = 195

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 123/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P +S ETLEYH+  HH+ Y +N   L    E    SLE+II  +
Sbjct: 3   MAFELPPLPYAQNALEPTISAETLEYHYGKHHQTYVNNLNNLVPGTEFDGKSLEDIITSA 62

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W CM   D KG     L+ AID  FGSF+ FK +   +A+
Sbjct: 63  SG---GIFNNAAQVWNHTFYWNCMTP-DAKGAPSGELAAAIDSTFGSFDAFKEEFSKSAA 118

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G + I+ T NA  PL +G  P+L +DVWEHAYY+DF+  R  Y+
Sbjct: 119 TNFGSGWTWL-VKNADGSIAIANTSNAGCPLTDGQTPLLTVDVWEHAYYIDFRNARPKYL 177

Query: 179 ESFITNLVNWEYVCERY 195
           E+F   LVNW++V   +
Sbjct: 178 EAFW-GLVNWDFVAANF 193


>gi|54295807|ref|YP_128222.1| superoxide dismutase, iron [Legionella pneumophila str. Lens]
 gi|53755639|emb|CAH17141.1| superoxide dismutase, iron [Legionella pneumophila str. Lens]
          Length = 192

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 122/193 (63%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G G+    L++AI+ NFGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGG-GEPKGRLAEAINKNFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   ++G L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVC 192
           +F + LVNW++  
Sbjct: 177 AFWS-LVNWDFAS 188


>gi|288941636|ref|YP_003443876.1| Superoxide dismutase [Allochromatium vinosum DSM 180]
 gi|288897008|gb|ADC62844.1| Superoxide dismutase [Allochromatium vinosum DSM 180]
          Length = 193

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY  + L P +S ET+EYH+  HH+ Y  N   L  D E   +SLE+I++KS
Sbjct: 1   MTHELPALPYEKNALEPVISAETIEYHYGKHHQTYVTNLNNLIQDTEFADMSLEDIVLKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G    AL+ AID  FGSF++FK     +A+
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGG-GAPSGALAAAIDAKFGSFDEFKKQFAQSAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G +EI  T NA  P+ +G   +L +DVWEHAYY+D++  R  Y+
Sbjct: 117 TNFGSGWTWL-VKNADGSIEIFNTSNAGTPMTSGKTALLTVDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           ES I + VNWE+V   Y
Sbjct: 176 ES-IWDKVNWEFVAANY 191


>gi|315645143|ref|ZP_07898269.1| Superoxide dismutase [Paenibacillus vortex V453]
 gi|315279564|gb|EFU42869.1| Superoxide dismutase [Paenibacillus vortex V453]
          Length = 202

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+ + L P++  +T+E HHD HH  Y  N    L +  E+   SLEE+I  
Sbjct: 1   MAFQLPALPYANNALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQDKSLEELIAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+   AL+DAI++  G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPN-GGGQPTGALADAINNELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL+++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTPNQDSPIMEGQTPVLGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V +RY+ A
Sbjct: 180 DYISAFW-NVVNWEEVGKRYDNA 201


>gi|186686501|ref|YP_001869697.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
 gi|186468953|gb|ACC84754.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
          Length = 200

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+  + L P  M  ET EYH+  HHK Y DN  KL    E+    LEE+I  
Sbjct: 1   MVFVQPPLPFDKNALEPNGMKAETFEYHYGKHHKAYVDNLNKLTEGTELADKPLEEVIKI 60

Query: 60  S--HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K N G G     L+  ID +FGSF+KFK +   
Sbjct: 61  SFQDSSKAGIFNNAAQVWNHTFFWNSLKPNGG-GAPTGDLAARIDKDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+D++  R  +
Sbjct: 120 AAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NLVNW++  E    A
Sbjct: 180 IKNFLDNLVNWDFAAENLAKA 200


>gi|307111243|gb|EFN59478.1| hypothetical protein CHLNCDRAFT_33910 [Chlorella variabilis]
          Length = 236

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 124/200 (62%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
           F LP LPY  D L    MSK T E+H+  HH+ Y  N     +  ++  LS+EE+++K+ 
Sbjct: 36  FTLPPLPYPIDALEKKGMSKTTFEFHYGKHHQAYVTNLNNQIAGKDLESLSIEEVMLKTF 95

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
             G     FNNA+Q  NH  FW  M  N G GK    +++AI+ + G ++KF      A 
Sbjct: 96  NGGKPTPEFNNAAQVVNHTFFWESMSPNGG-GKPSGKVAEAIEKDLGGYDKFVEAFKAAG 154

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +TQFGSGW WLSV K GKLE++KT NAENP   GA PIL +DVWEHAYYLD + RR  +I
Sbjct: 155 ATQFGSGWAWLSVNKEGKLEVTKTPNAENPWCYGATPILTMDVWEHAYYLDVQNRRPDFI 214

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F+ NL++W+ V +RY  A
Sbjct: 215 TNFVDNLIDWDRVEQRYLAA 234


>gi|163734006|ref|ZP_02141447.1| superoxide dismutase (Fe) [Roseobacter litoralis Och 149]
 gi|161392542|gb|EDQ16870.1| superoxide dismutase (Fe) [Roseobacter litoralis Och 149]
          Length = 199

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 126/201 (62%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L+   MS ETLEYHHD+HH  Y  N  K     E    S+E+II  
Sbjct: 1   MAFELPDLPYAHDALAGKGMSAETLEYHHDLHHNAYVTNGNKAIEGTEWAGKSMEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ + +    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ ++FGS + FK   
Sbjct: 61  TYDATSVAQSGIFNNISQLWNHNQFWEMMGP--GESKMPGELEKALTESFGSVDAFKEQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VKN  G L ++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKNADGSLSVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPAYLTNFLDNLVNWENVASR 198


>gi|193216075|ref|YP_001997274.1| superoxide dismutase [Chloroherpeton thalassium ATCC 35110]
 gi|193089552|gb|ACF14827.1| Superoxide dismutase [Chloroherpeton thalassium ATCC 35110]
          Length = 200

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 125/201 (62%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY  + L P++S  TLE+H+  HH  Y         D     + LE++I  +
Sbjct: 1   MAYEQPKLPYELNALEPHISANTLEFHYGKHHAAYVTKYNGFVKDTPYDKMPLEDVIKAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH+ +W C+  N G G     ++D I+++ GS+E F +    A
Sbjct: 61  AGDASKAGIFNNGAQAWNHSFYWNCLSPNGG-GAPTGKIADKINEDCGSYENFVAAFKDA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +  GKL+I+KT NA NP+  G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 AATQFGSGWAWLVLDGGKLKITKTLNAANPMTEGQTTLLTLDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
           ++F+  LVNW++V +  E AM
Sbjct: 180 QTFLEKLVNWDFVNQNLEAAM 200


>gi|61679581|pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679582|pdb|1Y67|B Chain B, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679583|pdb|1Y67|C Chain C, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679584|pdb|1Y67|D Chain D, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|114793454|pdb|2AW9|A Chain A, Superoxide Dismutase With Manganese From Deinococcus
           Radiodurans
 gi|114793455|pdb|2AW9|B Chain B, Superoxide Dismutase With Manganese From Deinococcus
           Radiodurans
          Length = 229

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 126/214 (58%), Gaps = 14/214 (6%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I +   
Sbjct: 4   YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDR 63

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA---LSDAIDDNFGSFEKFKSDL 115
                   L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK   
Sbjct: 64  VPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQKF 123

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLD 169
             AA T+FGSGW WL VK+GKL++  T N +NPL+  AI      PILG+DVWEHAYYL+
Sbjct: 124 EDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYYLN 183

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLAQK 203
           ++ RR  Y+ +F  N+VNW+ V +RY  A L  +
Sbjct: 184 YQNRRPDYLAAFW-NVVNWDEVSKRYAAAKLVPR 216


>gi|30248874|ref|NP_840944.1| manganese and iron superoxide dismutase [Nitrosomonas europaea ATCC
           19718]
 gi|30138491|emb|CAD84781.1| Manganese and iron superoxide dismutase (SODM) [Nitrosomonas
           europaea ATCC 19718]
          Length = 212

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 3/192 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + L  LPY+ + L P +S  TL +H+  HHK Y DN  KL +       SLE+II  + G
Sbjct: 18  YVLAPLPYADNALEPVISAHTLSFHYGKHHKAYVDNLNKLVAGTPFSGQSLEQIITATAG 77

Query: 63  S--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               AG+FNNA+Q +NH  +W  +    G G+ P AL   I+++FGS E FK +   AA 
Sbjct: 78  QADKAGIFNNAAQIWNHMFYWYSLSPKGG-GEPPAALKQKIEESFGSVEAFKQEFANAAI 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+ +  KL I KT NA++PL  G  P+L IDVWEHAYYLDF+ RR  Y+ +
Sbjct: 137 TQFGSGWAWLAQEGSKLAIIKTSNADSPLTRGIRPLLTIDVWEHAYYLDFQNRRPDYVNT 196

Query: 181 FITNLVNWEYVC 192
            I  L+NWE+  
Sbjct: 197 VIDKLINWEFAA 208


>gi|220907079|ref|YP_002482390.1| Superoxide dismutase [Cyanothece sp. PCC 7425]
 gi|219863690|gb|ACL44029.1| Superoxide dismutase [Cyanothece sp. PCC 7425]
          Length = 199

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 121/198 (61%), Gaps = 8/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII-- 57
           M F+ P LPY    L PY MS  T E+H+  HH  Y  N   L  D E+   SLEE+I  
Sbjct: 1   MAFEQPPLPYDPGALEPYGMSARTFEFHYGKHHAAYVTNLNNLTKDTELADKSLEEVIKV 60

Query: 58  -IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDL 115
             K  G   G+FNNA+Q +NH  FW  +K   G G  P   L+  ID  FGSF+KFK + 
Sbjct: 61  TFKDPGK-VGVFNNAAQVWNHTFFWNSLKP--GGGGTPSGDLAAKIDSAFGSFDKFKEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+TQFGSGW WL    G L++ KT NAENPL  G   +L +DVWEHAYY+D++ RR 
Sbjct: 118 KTAAATQFGSGWAWLVEDGGSLKVIKTPNAENPLAYGQKSLLTLDVWEHAYYIDYQNRRP 177

Query: 176 HYIESFITNLVNWEYVCE 193
            +I++F+  LVNW++V +
Sbjct: 178 DFIQNFLDQLVNWDFVAQ 195


>gi|75907186|ref|YP_321482.1| manganese and iron superoxide dismutase [Anabaena variabilis ATCC
           29413]
 gi|75700911|gb|ABA20587.1| Manganese and iron superoxide dismutase [Anabaena variabilis ATCC
           29413]
          Length = 200

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LPY ++ L  Y M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  
Sbjct: 1   MAFVQEPLPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +    S AG+FNNA+Q +NH  FW  +K   G G      +  I+ +FGSF+KFK +   
Sbjct: 61  AFKDPSKAGIFNNAAQVWNHTFFWNSLKPAGG-GAPTGEFAAKINQDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL   NG L+++KT NAENPL +G   +L +DVWEHAYY+DF+  R  +
Sbjct: 120 AAATQFGSGWAWLIDDNGTLKVTKTPNAENPLAHGQKALLTLDVWEHAYYIDFRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++++ NLVNW++    Y  A
Sbjct: 180 IKNYLDNLVNWDFAAANYAKA 200


>gi|332977270|gb|EGK14061.1| superoxide dismutase [Psychrobacter sp. 1501(2011)]
          Length = 209

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 125/196 (63%), Gaps = 4/196 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKSHG 62
           LP+LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +    L+EII       
Sbjct: 6   LPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKELDEIIQATAKDD 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA++Q
Sbjct: 66  SKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAATSQ 125

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL   +  GKL I KT NA+ PL +  + +L  DVWEHAYY+D++ RR  Y+++
Sbjct: 126 FGSGWAWLVADSVGGKLSIMKTANADTPLAHDKVAVLTCDVWEHAYYIDYRNRRPDYVDT 185

Query: 181 FITNLVNWEYVCERYE 196
           F+  LVNW+Y   +Y+
Sbjct: 186 FLDKLVNWDYANAKYK 201


>gi|254496709|ref|ZP_05109572.1| superoxide dismutase, iron [Legionella drancourtii LLAP12]
 gi|254354137|gb|EET12809.1| superoxide dismutase, iron [Legionella drancourtii LLAP12]
          Length = 211

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 123/193 (63%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKET+EYH+  HH+ Y +N  KL    E   +SLEEII ++
Sbjct: 20  MTFTLPALPYAMDALAPHISKETIEYHYGKHHQAYVNNLNKLIPGTEFASMSLEEIIKQA 79

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI+ +FGSF +FK     AA+
Sbjct: 80  KG---GIFNNAAQIWNHTFYWHCLSPNGG-GEPTGKLADAINSHFGSFNEFKEQFTQAAA 135

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL     G L+I  T NA  P+  G   +L  DVWEHAYY+D++  R  YI 
Sbjct: 136 TTFGSGWAWLVQDSTGALKIISTSNAGTPMTEGLTALLTCDVWEHAYYIDYRNARPDYIS 195

Query: 180 SFITNLVNWEYVC 192
           +F + LV+W++V 
Sbjct: 196 AFWS-LVHWDFVA 207


>gi|320333611|ref|YP_004170322.1| Manganese/iron superoxide dismutase [Deinococcus maricopensis DSM
           21211]
 gi|319754900|gb|ADV66657.1| Manganese/iron superoxide dismutase [Deinococcus maricopensis DSM
           21211]
          Length = 207

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 128/209 (61%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +EE+I K 
Sbjct: 1   MPYQLPALPYAYDALEPHVDTRTMEIHHTKHHQAYIDNANKALEGTEFADLPVEELITKL 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
               S   N  L NNA  + NH+LFW  M  N G G+    L+DAI   FGSF+ FK   
Sbjct: 61  DQVPSDKKNV-LRNNAGGHANHSLFWTVMGPN-GSGQPSGELADAITAAFGSFDAFKEKF 118

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLD 169
             AA T+FGSGW WL VK+G+L +  T N ++PL+  A+      PILG+DVWEHAYYL+
Sbjct: 119 EDAAKTRFGSGWAWLVVKDGQLAVVSTANQDSPLMGEAVAGVSGTPILGVDVWEHAYYLN 178

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETA 198
           ++ +R  Y+++F  N+VNW+ V +RY  A
Sbjct: 179 YQNKRPDYLKAFW-NVVNWDAVAQRYAQA 206


>gi|349942|pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide
           Dismutase From Pseudomonas Ovalis
 gi|349943|pdb|3SDP|B Chain B, The 2.1 Angstroms Resolution Structure Of Iron Superoxide
           Dismutase From Pseudomonas Ovalis
          Length = 195

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDA-EMLHLSLEEIIIKSH 61
           F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L     E    +LEEI+  S 
Sbjct: 2   FELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTPEFEGKTLEEIVKSSS 61

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA+Q +NH  +W C+  + G G+   AL+DAI+  FGSF+KFK +    +  
Sbjct: 62  G---GIFNNAAQVWNHTFYWNCLSPDAG-GQPTGALADAINAAFGSFDKFKEEFTKTSVG 117

Query: 122 QFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
            FGSGW WL   +G L +  T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E+F
Sbjct: 118 TFGSGWAWLVKADGSLALCSTIGAGAPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAF 177

Query: 182 ITNLVNWEYVCERYET 197
             NLVNW +V E  +T
Sbjct: 178 W-NLVNWAFVAEEGKT 192


>gi|15806297|ref|NP_295003.1| Mn family superoxide dismutase [Deinococcus radiodurans R1]
 gi|32363428|sp|Q9RUV2|SODM_DEIRA RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|310942702|pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans In The Orthorhombic Space Group
           P212121: A Case Study Of Mistaken Identity
 gi|310942703|pdb|3KKY|B Chain B, Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans In The Orthorhombic Space Group
           P212121: A Case Study Of Mistaken Identity
 gi|6459027|gb|AAF10851.1|AE001975_5 superoxide dismutase (sodA), Mn family [Deinococcus radiodurans R1]
          Length = 211

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 125/211 (59%), Gaps = 14/211 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I + 
Sbjct: 1   MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA---LSDAIDDNFGSFEKFKS 113
                     L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK 
Sbjct: 61  DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ 120

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYY 167
               AA T+FGSGW WL VK+GKL++  T N +NPL+  AI      PILG+DVWEHAYY
Sbjct: 121 KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY 180

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           L+++ RR  Y+ +F  N+VNW+ V +RY  A
Sbjct: 181 LNYQNRRPDYLAAFW-NVVNWDEVSKRYAAA 210


>gi|83952347|ref|ZP_00961078.1| superoxide dismutase, Fe [Roseovarius nubinhibens ISM]
 gi|83836020|gb|EAP75318.1| superoxide dismutase, Fe [Roseovarius nubinhibens ISM]
          Length = 199

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 125/201 (62%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LPY++D L S  MS ETLEYHHD+HH  Y  N        E    SLEEII  
Sbjct: 1   MAFELPDLPYAHDALASKGMSAETLEYHHDLHHNAYVTNGNAAIKGTEWEGKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNN SQ +NHN FW  M    G+ K+P  L  A+ D+FGS ++FK   
Sbjct: 61  TYDPKAVAQNGIFNNISQLWNHNQFWEMM--GPGESKMPSELEKALTDSFGSVDEFKKQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL      +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWAWL-VKDSDGSLKVTKTENGVNPLCFNQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+E+F+  LVNWE V  R
Sbjct: 178 RPAYLENFLEKLVNWENVASR 198


>gi|330721184|gb|EGG99297.1| Superoxide dismutase [gamma proteobacterium IMCC2047]
          Length = 193

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 125/194 (64%), Gaps = 9/194 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYAD---NALKLASDAEMLHLSLEEII 57
           M+FKLP LPY    L P++   TL+YH+  HH+ Y +   +AL+  +DAE    SLEEII
Sbjct: 1   MEFKLPPLPYDDSALEPHIGASTLQYHYGKHHQGYMNKLKDALEGTADAEK---SLEEII 57

Query: 58  IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                 +AG+FN A+Q +NH+ +W CM  N G G+    L  A++ +FGS EKF  +   
Sbjct: 58  KAP--PSAGVFNLAAQVWNHSFYWDCMCPNGG-GEPSATLKSALEKSFGSLEKFYEEFSN 114

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL     KL + KT NAE PL +G  P+L IDVWEHAYYLD++  R  Y
Sbjct: 115 AAATQFGSGWAWLVKDGDKLCVVKTGNAETPLTDGVTPLLTIDVWEHAYYLDYQNDRPKY 174

Query: 178 IESFITNLVNWEYV 191
           I++F+ +LVNW +V
Sbjct: 175 IDTFLKHLVNWSFV 188


>gi|29466958|dbj|BAC66946.1| chloroplastic iron superoxide dismutase [Barbula unguiculata]
 gi|182441010|dbj|BAG24134.1| chloroplastic iron superoxide dismutase [Barbula unguiculata]
          Length = 211

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 126/201 (62%), Gaps = 5/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           +D + P  PY+ D L P+MSKETLEYH   HH+ Y DN  K     E+   +LE+I+  +
Sbjct: 11  VDLRPP--PYALDALEPHMSKETLEYHWGKHHRAYVDNLKKQIEGTELASQTLEDIVRAT 68

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +  G     FNNA+Q +NH  FW  M  + GK    + +S  +  +FGS++ F  +   A
Sbjct: 69  YNNGEPTAPFNNAAQAWNHEFFWLSMSPHGGKQPDGELMS-LLKRDFGSYDNFVKEFKQA 127

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL+V +GKL + K+ NA NPL+ G +PIL  DVWEHAYYLD++ RR  Y+
Sbjct: 128 GATQFGSGWAWLTVADGKLMVEKSPNAINPLVFGHVPILVADVWEHAYYLDYQNRRPDYL 187

Query: 179 ESFITNLVNWEYVCERYETAM 199
            +F+  LV+W+ V +R + A+
Sbjct: 188 TTFMNELVSWDAVAKRLQLAL 208


>gi|54298972|ref|YP_125341.1| superoxide dismutase, iron [Legionella pneumophila str. Paris]
 gi|148361308|ref|YP_001252515.1| superoxide dismutase [Legionella pneumophila str. Corby]
 gi|296108648|ref|YP_003620349.1| Superoxide dismutase [Legionella pneumophila 2300/99 Alcoy]
 gi|53752757|emb|CAH14192.1| superoxide dismutase, iron [Legionella pneumophila str. Paris]
 gi|148283081|gb|ABQ57169.1| superoxide dismutase [Legionella pneumophila str. Corby]
 gi|295650550|gb|ADG26397.1| Superoxide dismutase [Legionella pneumophila 2300/99 Alcoy]
          Length = 192

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G G+    L++AI+ +FGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGG-GEPKGRLAEAINKSFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   ++G L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVC 192
           +F + LVNW++  
Sbjct: 177 AFWS-LVNWDFAS 188


>gi|261339584|ref|ZP_05967442.1| superoxide dismutase [Enterobacter cancerogenus ATCC 35316]
 gi|288318405|gb|EFC57343.1| superoxide dismutase [Enterobacter cancerogenus ATCC 35316]
          Length = 193

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L    E    +LEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTEFEGKTLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G   V + L++AI+  FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWHCLAPNAGGEPVGE-LAEAINAAFGSFADFKAKFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  + NGKL I  T NA  PL   A P++ +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKEANGKLAIVSTSNAGTPLTTSATPLMTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   LVNWE+V + +
Sbjct: 177 HFWA-LVNWEFVAKNF 191


>gi|225631116|ref|ZP_03787838.1| superoxide dismutase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591188|gb|EEH12348.1| superoxide dismutase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 128/199 (64%), Gaps = 6/199 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY    L PY+S +TL++H+D HHK Y +   +L  + +  H+ +EE+I K 
Sbjct: 1   MSFTLPELPYDKTALEPYISAKTLDFHYDKHHKGYLNKLNELVENTDYQHVKIEELITKV 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG++  L  FNNA+Q +NH  +W  MKKN G K K    L+  I D+ G F+KF  +  +
Sbjct: 61  HGNSGNLPIFNNAAQVWNHTFYWNSMKKNGGGKPKDGSLLAKKIQDDIGGFDKFYEEFSS 120

Query: 118 AASTQFGSGWGWLSVKNG---KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              + FGSGW WL ++ G   KL+I+KT NA+ P+I G +P+L +DVWEHAYYLD + RR
Sbjct: 121 HGVSHFGSGWVWLVLEKGRLGKLKITKTPNADLPIIYGQVPLLTMDVWEHAYYLDCQNRR 180

Query: 175 AHYIESFITNLVNWEYVCE 193
             YI+ F+ +L+NW++  E
Sbjct: 181 IDYIKVFLDHLINWDFAEE 199


>gi|261404715|ref|YP_003240956.1| Superoxide dismutase [Paenibacillus sp. Y412MC10]
 gi|261281178|gb|ACX63149.1| Superoxide dismutase [Paenibacillus sp. Y412MC10]
          Length = 202

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M F+LP LPY+ D L P++  +T+E HHD HH  Y  N    L +  E+   SLE++I  
Sbjct: 1   MAFQLPALPYANDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQGKSLEDLIGN 60

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+   AL+DAI+   G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPN-GGGQPTGALADAINSELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTANQDSPIMEGQTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V +RY+ A
Sbjct: 180 DYISAFW-NVVNWEEVGKRYDNA 201


>gi|294501259|ref|YP_003564959.1| superoxide dismutase (Mn) [Bacillus megaterium QM B1551]
 gi|294351196|gb|ADE71525.1| superoxide dismutase (Mn) [Bacillus megaterium QM B1551]
          Length = 202

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N    +   A++   S+EE+I  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAAVEGKADLESKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G     L+DAI   FGSF++FK + 
Sbjct: 61  LDAVPEDIRTAVRNNGGGHANHSLFWTILCPNGG-GAPTGELADAIASKFGSFDQFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ANAAKTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+V W+ V +RY+ A
Sbjct: 180 DYISAFF-NVVKWDEVAKRYDAA 201


>gi|401109|sp|P31108|SODF_LEGPH RecName: Full=Superoxide dismutase [Fe]
 gi|216769|dbj|BAA02306.1| iron superoxide dismutase (Fe-SOD) [Legionella pneumophila]
 gi|19880970|gb|AAM00603.1| superoxide dismutase [Legionella pneumophila]
 gi|744306|prf||2014300A Fe superoxide dismutase
          Length = 192

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G G+    L++AI+ +FGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGG-GEPKGRLAEAINKSFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   ++G L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIINTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVC 192
           +F + LVNW++  
Sbjct: 177 AFWS-LVNWDFAS 188


>gi|329929520|ref|ZP_08283254.1| superoxide dismutase, Mn [Paenibacillus sp. HGF5]
 gi|328936408|gb|EGG32855.1| superoxide dismutase, Mn [Paenibacillus sp. HGF5]
          Length = 202

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M F+LP LPY+ D L P++  +T+E HHD HH  Y  N    L +  E+   SLE++I  
Sbjct: 1   MAFQLPALPYANDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQGKSLEDLIGN 60

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+   AL+DAI+   G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPN-GGGQPTGALADAINSELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTPNQDSPIMEGQTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V +RY+ A
Sbjct: 180 DYISAFW-NVVNWEEVGKRYDNA 201


>gi|52843161|ref|YP_096960.1| superoxide dismutase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52630272|gb|AAU29013.1| superoxide dismutase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 196

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 5   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 64

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G G+    L++AI+ +FGSF  FK      A+
Sbjct: 65  KG---GIFNNAAQVWNHTFYWHSMSPNGG-GEPKGRLAEAINKSFGSFAAFKEQFSQTAA 120

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   ++G L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 121 TTFGSGWAWLVQDQSGALKIINTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 180

Query: 180 SFITNLVNWEYVC 192
           +F + LVNW++  
Sbjct: 181 AFWS-LVNWDFAS 192


>gi|167551599|ref|ZP_02345353.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|194444247|ref|YP_002040680.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194402910|gb|ACF63132.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|205323543|gb|EDZ11382.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 193

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 121/194 (62%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A+P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDAMPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|56413600|ref|YP_150675.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362524|ref|YP_002142161.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127857|gb|AAV77363.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094001|emb|CAR59497.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 193

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 121/194 (62%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A+P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDAMPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|295706606|ref|YP_003599681.1| superoxide dismutase (Mn) [Bacillus megaterium DSM 319]
 gi|294804265|gb|ADF41331.1| superoxide dismutase (Mn) [Bacillus megaterium DSM 319]
          Length = 202

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N    +   A++   S+EE+I  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAAVEGKADLESKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G     L+DAI   FGSF++FK + 
Sbjct: 61  LDAVPEDIRTAVRNNGGGHANHSLFWTILCPNGG-GAPTGELADAIASKFGSFDQFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V NG LE++ T N ++PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ANAAKTRFGSGWAWLVVNNGALEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+V W+ V +RY+ A
Sbjct: 180 DYISAFF-NVVKWDEVAKRYDAA 201


>gi|94984937|ref|YP_604301.1| superoxide dismutase [Deinococcus geothermalis DSM 11300]
 gi|94555218|gb|ABF45132.1| Superoxide dismutase [Deinococcus geothermalis DSM 11300]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 126/209 (60%), Gaps = 13/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +EE+I K 
Sbjct: 1   MAYQLPQLPYAYDALEPHIDARTMEIHHTKHHQTYIDNANKALEGTEFADLPVEELIQKL 60

Query: 61  HGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
               A     L NNA  + NH+LFW  M    G+G+    L+ AI++ FGSFE FK    
Sbjct: 61  DQVPADKKTVLRNNAGGHANHSLFWQVMTPQ-GQGQPTGELAQAINETFGSFEAFKQQFE 119

Query: 117 TAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLD 169
            AA  +FGSGW WL VK  G+L +  T N +NPL+  AI      PILG+DVWEHAYYL+
Sbjct: 120 DAAKGRFGSGWAWLVVKPGGQLAVVSTANQDNPLMGEAIAGASGTPILGVDVWEHAYYLN 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETA 198
           ++ RR  Y+++F  N+VNW+ V  RY+ A
Sbjct: 180 YQNRRPDYLKAFW-NVVNWDEVARRYQQA 207


>gi|300690603|ref|YP_003751598.1| superoxide dismutase [Ralstonia solanacearum PSI07]
 gi|299077663|emb|CBJ50299.1| superoxide dismutase [Ralstonia solanacearum PSI07]
          Length = 192

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K N G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNGLKPNGG-GAPTGALADAINAKWGSFDKFKEEFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V   +
Sbjct: 177 AFW-NLVNWDFVANHF 191


>gi|82701635|ref|YP_411201.1| superoxide dismutase [Nitrosospira multiformis ATCC 25196]
 gi|82409700|gb|ABB73809.1| Superoxide dismutase [Nitrosospira multiformis ATCC 25196]
          Length = 205

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 120/193 (62%), Gaps = 3/193 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + LP LPY+ + L P +S  TL +H+  HHK Y DN  KL +  ++  +SLEEII  + G
Sbjct: 11  YVLPPLPYADNALDPVISANTLGFHYGKHHKTYVDNLNKLVAGTDLADMSLEEIITSTAG 70

Query: 63  S--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               AG+FNNA+Q +NH  +W  +    G G+ P +L   I+  FGS E  K +L TAA+
Sbjct: 71  KADKAGIFNNAAQVWNHTFYWNSLSPK-GGGEPPASLKQKIETAFGSVEVCKKELATAAT 129

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL     +L++ KT NA+ PL  G  P+L IDVWEHAYYLD++ RR  Y+ +
Sbjct: 130 TQFGSGWAWLVNDGDRLQVIKTGNADLPLTKGMKPLLTIDVWEHAYYLDYQNRRPDYVNA 189

Query: 181 FITNLVNWEYVCE 193
            +  L+NW +  +
Sbjct: 190 VLDKLINWGFAAD 202


>gi|29654997|ref|NP_820689.1| superoxide dismutase [Coxiella burnetii RSA 493]
 gi|153207515|ref|ZP_01946198.1| superoxide dismutase (fe) [Coxiella burnetii 'MSU Goat Q177']
 gi|154707307|ref|YP_001423721.1| superoxide dismutase [Coxiella burnetii Dugway 5J108-111]
 gi|161830141|ref|YP_001597529.1| superoxide dismutase (Fe) [Coxiella burnetii RSA 331]
 gi|165918357|ref|ZP_02218443.1| superoxide dismutase (fe) [Coxiella burnetii RSA 334]
 gi|212211735|ref|YP_002302671.1| superoxide dismutase [Coxiella burnetii CbuG_Q212]
 gi|212217970|ref|YP_002304757.1| superoxide dismutase [Coxiella burnetii CbuK_Q154]
 gi|134638|sp|P19685|SODF_COXBU RecName: Full=Superoxide dismutase [Fe]
 gi|40406|emb|CAA38444.1| unnamed protein product [Coxiella burnetii]
 gi|145002|gb|AAA23311.1| superoxide dismutase [Coxiella burnetii]
 gi|29542266|gb|AAO91203.1| superoxide dismutase [Coxiella burnetii RSA 493]
 gi|120576483|gb|EAX33107.1| superoxide dismutase (fe) [Coxiella burnetii 'MSU Goat Q177']
 gi|126215958|gb|ABN81055.1| superoxide dismutase [Coxiella cheraxi]
 gi|154356593|gb|ABS78055.1| superoxide dismutase [Coxiella burnetii Dugway 5J108-111]
 gi|161762008|gb|ABX77650.1| superoxide dismutase (fe) [Coxiella burnetii RSA 331]
 gi|165918007|gb|EDR36611.1| superoxide dismutase (fe) [Coxiella burnetii RSA 334]
 gi|212010145|gb|ACJ17526.1| superoxide dismutase [Coxiella burnetii CbuG_Q212]
 gi|212012232|gb|ACJ19612.1| superoxide dismutase [Coxiella burnetii CbuK_Q154]
          Length = 193

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 123/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY  + L P++S+ETLEYHH  HH+ Y +   KL          LEEII KS
Sbjct: 1   MAFELPDLPYKLNALEPHISQETLEYHHGKHHRAYVNKLNKLIEGTPFEKEPLEEIIRKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q++NH  +W CM   DG G     L+ AID  FGS EKFK+    +A+
Sbjct: 61  DG---GIFNNAAQHWNHTFYWHCMSP-DGGGDPSGELASAIDKTFGSLEKFKALFTDSAN 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    NGKLE+  T NA NP+  G  P++  DVWEHAYY+D +  R  Y+ 
Sbjct: 117 NHFGSGWAWLVKDNNGKLEVLSTVNARNPMTEGKKPLMTCDVWEHAYYIDTRNDRPKYVN 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F   +VNW++V + +++
Sbjct: 177 NFW-QVVNWDFVMKNFKS 193


>gi|58584480|ref|YP_198053.1| superoxide dismutase, SodA [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418796|gb|AAW70811.1| Superoxide dismutase, SodA [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 202

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 128/196 (65%), Gaps = 3/196 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+F LP LPY    L PY+S +TL++H+D HHK Y +   +L  + +  ++ +EE+I+K 
Sbjct: 1   MNFTLPELPYDKTALEPYISAKTLDFHYDKHHKGYLNKLNELIENTDYQNVKIEELIMKV 60

Query: 61  HGSN--AGLFNNASQYYNHNLFWACMKKNDG-KGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           HG++    +FNNA+Q +NH  +W  MKK+ G K K    L+  I D+ G F+KF  +   
Sbjct: 61  HGNSDEVPVFNNAAQVWNHTFYWNSMKKSGGDKPKEDGLLAKKIQDDIGGFDKFHEEFFN 120

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
               QFGSGW WL ++ GKL+I+KT NA+ PLI   +P+L +DVWEHAYYLD + RR  Y
Sbjct: 121 HGIGQFGSGWVWLVLERGKLKITKTPNADLPLIYDQVPLLTMDVWEHAYYLDCQNRRIDY 180

Query: 178 IESFITNLVNWEYVCE 193
           I+ F+ +L+NW++  E
Sbjct: 181 IKIFLDHLINWDFAEE 196


>gi|254448612|ref|ZP_05062071.1| superoxide dismutase [gamma proteobacterium HTCC5015]
 gi|198261801|gb|EDY86087.1| superoxide dismutase [gamma proteobacterium HTCC5015]
          Length = 193

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P +S ETLE+HH  HH  Y +    +    E  +LSLEEII KS
Sbjct: 1   MSFELPTLPYEKNALEPTISAETLEFHHGKHHAAYVNKLNDMIQGTEFENLSLEEIIQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FN A+Q +NH  ++  +  N G G+   AL+DAI+  FGSF++FK+    A +
Sbjct: 61  SG---GMFNQAAQIWNHTFYFTGLSPNGG-GEPTGALADAINAEFGSFDEFKAKFNAAGA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T +AE PL NG  P++ +DVWEHAYY+D++  R  Y+
Sbjct: 117 GNFGSGWTWL-VKNAEGKLEIVNTDDAETPLTNGQTPVITVDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           E  I N+++W    ER+
Sbjct: 176 EE-IWNIIDWSVAAERF 191


>gi|187929872|ref|YP_001900359.1| Superoxide dismutase [Ralstonia pickettii 12J]
 gi|187726762|gb|ACD27927.1| Superoxide dismutase [Ralstonia pickettii 12J]
          Length = 233

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 125/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 42  MEHTLPPLPYAQDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEDIVKKS 101

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 102 SG---GVFNNAAQVWNHTFYWNGLKPQGG-GAPTGALADAINAKWGSFDKFKEEFTKTAI 157

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 158 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 217

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 218 AFW-NLVNWDFVAKNF 232


>gi|29466962|dbj|BAC66948.1| chloroplastic iron superoxide dismutase [Marchantia paleacea var.
           diptera]
          Length = 254

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 127/198 (64%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F L + PY  D L P+MSKETLE+H   HH+ Y +N      ++++   +LEEI+  S+ 
Sbjct: 44  FDLKDPPYPLDALEPHMSKETLEFHWGKHHRAYVNNLNGQIENSDLERNTLEEIVQSSYN 103

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA Q +NH+ FW  MK   G     + +++ I+ +FGS++ F  +   A +
Sbjct: 104 NGNPTPAFNNAGQIWNHDFFWQSMKPGGGGPPTGE-VAELINRDFGSYDNFVKEFKAAGA 162

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL +KNGKL I KT NA  P++ G+IP+L +DVWEHAYYLDF+ RR  Y+ +
Sbjct: 163 TQFGSGWAWLVLKNGKLAIEKTPNAVTPILWGSIPLLVVDVWEHAYYLDFQNRRPDYLST 222

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L++W+ V ER   A
Sbjct: 223 FVNDLISWDAVNERLARA 240


>gi|146283459|ref|YP_001173612.1| superoxide dismutase [Pseudomonas stutzeri A1501]
 gi|145571664|gb|ABP80770.1| superoxide dismutase [Pseudomonas stutzeri A1501]
 gi|327481856|gb|AEA85166.1| superoxide dismutase [Pseudomonas stutzeri DSM 4166]
          Length = 193

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P+MS ETL+YHHD HH  Y  N   L    E     LE II  S
Sbjct: 1   MAFELPPLPYEKNALEPHMSAETLDYHHDKHHAAYVTNLNNLIPGTEFEGKDLESIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW C+  N G G+   AL+DAI+ +FGSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFFWNCLAPNAG-GQPTGALADAINASFGSFDKFKEEFTKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L ++ T  A NP+  G  P+L  DVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKSDGSLGLASTIGAGNPMTAGDKPLLTCDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 177 AFW-NLVNWDFVAKNF 191


>gi|90109118|pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109119|pdb|2CDY|B Chain B, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109120|pdb|2CDY|C Chain C, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109121|pdb|2CDY|D Chain D, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109137|pdb|2CE4|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109138|pdb|2CE4|B Chain B, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
          Length = 231

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 125/211 (59%), Gaps = 14/211 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           + + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I + 
Sbjct: 21  LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL 80

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA---LSDAIDDNFGSFEKFKS 113
                     L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK 
Sbjct: 81  DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ 140

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYY 167
               AA T+FGSGW WL VK+GKL++  T N +NPL+  AI      PILG+DVWEHAYY
Sbjct: 141 KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY 200

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           L+++ RR  Y+ +F  N+VNW+ V +RY  A
Sbjct: 201 LNYQNRRPDYLAAFW-NVVNWDEVSKRYAAA 230


>gi|83749054|ref|ZP_00946060.1| Superoxide dismutase [Ralstonia solanacearum UW551]
 gi|207725156|ref|YP_002255553.1| superoxide dismutase [fe] protein [Ralstonia solanacearum MolK2]
 gi|207742512|ref|YP_002258904.1| superoxide dismutase [fe] protein [Ralstonia solanacearum IPO1609]
 gi|300703207|ref|YP_003744809.1| superoxide dismutase [Ralstonia solanacearum CFBP2957]
 gi|83724244|gb|EAP71416.1| Superoxide dismutase [Ralstonia solanacearum UW551]
 gi|206590388|emb|CAQ37349.1| superoxide dismutase [fe] protein [Ralstonia solanacearum MolK2]
 gi|206593904|emb|CAQ60831.1| superoxide dismutase [fe] protein [Ralstonia solanacearum IPO1609]
 gi|299070870|emb|CBJ42172.1| superoxide dismutase [Ralstonia solanacearum CFBP2957]
          Length = 192

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 124/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W  +K N G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GLFNNAAQVWNHTFYWNGLKPNGG-GAPTGALADAINAKWGSFDKFKEEFTKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGTLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F + LVNW++V   +
Sbjct: 177 AFWS-LVNWDFVANNF 191


>gi|16760482|ref|NP_456099.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16764779|ref|NP_460394.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29141758|ref|NP_805100.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161614151|ref|YP_001588116.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|168229804|ref|ZP_02654862.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168240945|ref|ZP_02665877.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168264724|ref|ZP_02686697.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463158|ref|ZP_02697089.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194451443|ref|YP_002045469.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194468757|ref|ZP_03074741.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197262201|ref|ZP_03162275.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205352855|ref|YP_002226656.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207857065|ref|YP_002243716.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213162001|ref|ZP_03347711.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213426007|ref|ZP_03358757.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213584895|ref|ZP_03366721.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213649695|ref|ZP_03379748.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213855192|ref|ZP_03383432.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289824916|ref|ZP_06544337.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|61246038|sp|P0A2F4|SODF_SALTY RecName: Full=Superoxide dismutase [Fe]
 gi|61246042|sp|P0A2F5|SODF_SALTI RecName: Full=Superoxide dismutase [Fe]
 gi|25285815|pir||AG0695 superoxide dismutase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16419951|gb|AAL20353.1| iron superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502778|emb|CAD01936.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137386|gb|AAO68949.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161363515|gb|ABX67283.1| hypothetical protein SPAB_01891 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409747|gb|ACF69966.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455121|gb|EDX43960.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|195634334|gb|EDX52686.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197240456|gb|EDY23076.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205272636|emb|CAR37546.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205335495|gb|EDZ22259.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205339356|gb|EDZ26120.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205346863|gb|EDZ33494.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206708868|emb|CAR33198.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|312912414|dbj|BAJ36388.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224049|gb|EFX49112.1| Fe-superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|326627927|gb|EGE34270.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 193

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|227538658|ref|ZP_03968707.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241577|gb|EEI91592.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 203

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY+ D L P++ KET+E HHD HH+ Y DN  K  +  +  +LSLEEI+   
Sbjct: 1   MAFQLEALPYASDALEPHIDKETMEIHHDRHHQAYVDNLNKAIAGTDAENLSLEEIVKNV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH LFW+ +  N G G+    L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYSPAVRNNGGGHFNHGLFWSVLGANAG-GQPTGELAAAIDETFGSFDELKKKLQEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V  +GKL ++ T N +NPL++ A     P+LGIDVWEHAYYL ++ +R 
Sbjct: 120 GRFGSGWSWLIVGADGKLAVTSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+E+ I N++NW+ V ERY  A
Sbjct: 180 AYLEA-IFNVINWDAVAERYAAA 201


>gi|62180020|ref|YP_216437.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|168235502|ref|ZP_02660560.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736173|ref|YP_002114442.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250776|ref|YP_002146614.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|200390888|ref|ZP_03217499.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204927914|ref|ZP_03219115.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|224584060|ref|YP_002637858.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238913168|ref|ZP_04657005.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|62127653|gb|AAX65356.1| superoxide dismutase, iron [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|194711675|gb|ACF90896.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197214479|gb|ACH51876.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197291060|gb|EDY30413.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199603333|gb|EDZ01879.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204323256|gb|EDZ08452.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|224468587|gb|ACN46417.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322615089|gb|EFY12012.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619928|gb|EFY16801.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622240|gb|EFY19085.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322627762|gb|EFY24552.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632893|gb|EFY29637.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636616|gb|EFY33319.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641191|gb|EFY37833.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644874|gb|EFY41407.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650290|gb|EFY46704.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655862|gb|EFY52164.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660190|gb|EFY56429.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322665245|gb|EFY61433.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669502|gb|EFY65650.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673428|gb|EFY69530.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677356|gb|EFY73420.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322679981|gb|EFY76020.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322687453|gb|EFY83425.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322714487|gb|EFZ06058.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323194094|gb|EFZ79293.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198575|gb|EFZ83676.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202902|gb|EFZ87937.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208621|gb|EFZ93559.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323217598|gb|EGA02313.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323218947|gb|EGA03457.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227075|gb|EGA11255.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229400|gb|EGA13523.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236899|gb|EGA20971.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240339|gb|EGA24383.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242672|gb|EGA26693.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323250238|gb|EGA34129.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323252448|gb|EGA36295.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323256466|gb|EGA40199.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323261429|gb|EGA45012.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267206|gb|EGA50691.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323272725|gb|EGA56130.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 193

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|161503477|ref|YP_001570589.1| superoxide dismutase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864824|gb|ABX21447.1| hypothetical protein SARI_01551 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 193

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWHCLAPNAG-GEPTGKLADAIAASFGSFTEFKTQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKGADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|194336611|ref|YP_002018405.1| Superoxide dismutase [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309088|gb|ACF43788.1| Superoxide dismutase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 200

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P L Y+ + L P++S +TL +H+  HH  Y  N   L +   +  +SLEE+I  S
Sbjct: 1   MAYQQPALLYAENALEPFISAKTLGFHYGKHHVAYITNYNNLVAGTPLDTMSLEEVIAHS 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                  G+FNN +Q +NH+ +W C+  N G G+    L   I ++FGSF+KFK +L +A
Sbjct: 61  AADPQKVGIFNNGAQAWNHSFYWNCLTPNGG-GEPSGELGAKITEDFGSFDKFKEELKSA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +    L++ KT NA+ P  +G  PIL IDVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDGTTLKVVKTANAQTPSTSGQKPILTIDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NWE+  E +  A
Sbjct: 180 ATVIDNLLNWEFAAENFRAA 199


>gi|241663981|ref|YP_002982341.1| superoxide dismutase [Ralstonia pickettii 12D]
 gi|309781427|ref|ZP_07676163.1| superoxide dismutase [Fe] [Ralstonia sp. 5_7_47FAA]
 gi|240866008|gb|ACS63669.1| Superoxide dismutase [Ralstonia pickettii 12D]
 gi|308919840|gb|EFP65501.1| superoxide dismutase [Fe] [Ralstonia sp. 5_7_47FAA]
          Length = 233

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 125/196 (63%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 42  MEHTLPPLPYAQDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEDIVKKS 101

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 102 SG---GVFNNAAQVWNHTFYWNGLKPQGG-GAPTGALADAINAKWGSFDKFKEEFTKTAI 157

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 158 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 217

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V + +
Sbjct: 218 AFW-NLVNWDFVAKNF 232


>gi|323211157|gb|EFZ96004.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
          Length = 205

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|194476623|ref|YP_002048802.1| superoxide dismutase [Paulinella chromatophora]
 gi|171191630|gb|ACB42592.1| superoxide dismutase [Paulinella chromatophora]
          Length = 202

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 120/194 (61%), Gaps = 3/194 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPYS D L PY+S +TL +HH  HH  Y     +L  D+E+ + SLEEI++ +
Sbjct: 1   MTHTLPALPYSLDALEPYISSQTLSFHHGKHHNTYIQKLNELIQDSELDNKSLEEILVST 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLIT 117
               +   LFNNA+Q +NH+ +W CM         P   L + I+ +FGSF  F      
Sbjct: 61  FNKPNEVTLFNNAAQVWNHSFYWQCMTPESSDHPNPSGRLMEKINTDFGSFASFLDKFKQ 120

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           A  TQFGSGW WL + NG L+++KT NA+ PL++G   +L +DVWEHAYYLD++ RR  Y
Sbjct: 121 AGLTQFGSGWAWLVLDNGVLKVTKTSNADLPLVHGQQALLTMDVWEHAYYLDYQNRRGDY 180

Query: 178 IESFITNLVNWEYV 191
           I +++  LVNW++V
Sbjct: 181 INTYLEKLVNWDFV 194


>gi|313677069|ref|YP_004055065.1| manganese/iron superoxide dismutase [Marivirga tractuosa DSM 4126]
 gi|312943767|gb|ADR22957.1| Manganese/iron superoxide dismutase [Marivirga tractuosa DSM 4126]
          Length = 201

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 127/203 (62%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++  +T+E HH  HH  Y           +M   SLEE++ K+
Sbjct: 1   MAFELPALPYAKDALEPHIDAKTMEIHHGKHHNGYVTKLNGAVEGTDMEGKSLEELL-KN 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +  N  + NN   +YNH+LFW  M   DG G+   AL+DAI+  +GSF+KFK +   AA+
Sbjct: 60  NSDNKAVRNNGGGHYNHSLFWTVMSP-DGGGEPSGALADAINAAYGSFDKFKEEFSNAAA 118

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V   GK+E+  + N +NP++     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCVHSGGKVEVCSSPNQDNPIMPNVGCGGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +RYE  
Sbjct: 179 DYISAFF-NVINWDEVSKRYEAG 200


>gi|34496322|ref|NP_900537.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
 gi|34102175|gb|AAQ58542.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
          Length = 234

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 120/189 (63%), Gaps = 3/189 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY+ + L P +S  T+ +H+  HHK Y DN  KL +  +   L LE+I+ +S G  
Sbjct: 41  LPPLPYADNALEPVISARTIGFHYGKHHKAYLDNLNKLIAGRDYADLPLEDILTRSFGPA 100

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S+A +FNNA+Q +NH  +W  M+   G G  PQ L + I+ +FGS +  K  L  AA +Q
Sbjct: 101 SDAAVFNNAAQLWNHTFYWRSMRPK-GGGIPPQGLREKIEASFGSVDACKRQLAGAAISQ 159

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL     KL + KT NA+NPL +G  P+L +DVWEHAYYLD++ RRA Y+ + +
Sbjct: 160 FGSGWAWLVQDGDKLRVVKTGNADNPLTSGLTPLLNVDVWEHAYYLDYQNRRADYVNAVL 219

Query: 183 TNLVNWEYV 191
             L++WE+ 
Sbjct: 220 DKLIDWEFA 228


>gi|261749421|ref|YP_003257107.1| superoxide dismutase, iron/manganese-dependent [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497514|gb|ACX83964.1| superoxide dismutase, iron/manganese-dependent [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 204

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 125/203 (61%), Gaps = 5/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP L YSY DL PY+ ++T+E H+  HH  Y +N  K     ++ HLS+EEI+ +S
Sbjct: 1   MSFKLPKLSYSYKDLEPYIDQKTMEIHYTKHHAGYTNNLNKAIEGTDLTHLSIEEILRRS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +     + NN   +YNHNLFW  +  +       + L +AI+ NF SF+ FK    + A 
Sbjct: 61  NIEKPIIRNNGGGFYNHNLFWEILIPHLDYTHPSKYLKNAIEKNFKSFDAFKEKFTSIAM 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAH 176
            +FGSGW WL VK  +L I  T N +NP++ G     +PILG+DVWEHAYYL ++ RRA 
Sbjct: 121 NRFGSGWTWLCVKEKRLTICSTANQDNPVMLGIGCEGVPILGLDVWEHAYYLQYQNRRAD 180

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI SF  N++NW+ V E Y+ ++
Sbjct: 181 YISSF-WNIINWKKVEENYKKSI 202


>gi|253989408|ref|YP_003040764.1| superoxide dismutase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253780858|emb|CAQ84020.1| superoxide dismutase [fe] [Photorhabdus asymbiotica]
          Length = 192

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y  N   L  D E    SLEEII  S
Sbjct: 1   MSFELPTLPYAKDALEPHISAETLEYHYGKHHNAYVVNLNNLIKDTEFAEKSLEEIIRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF +FK     AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKIAEAISKSFGSFTEFKQQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  PL +   PIL +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKKTDGSLAIVNTSNAAPPLASSDKPILTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           SF   LVNW++V E
Sbjct: 177 SFWA-LVNWKFVEE 189


>gi|134642|sp|P22302|SODF_NICPL RecName: Full=Superoxide dismutase [Fe], chloroplastic
 gi|170235|gb|AAA34074.1| Fe-superoxide dismutase [Nicotiana plumbaginifolia]
          Length = 202

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 122/200 (61%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 2   FELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 61

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             A L  FNNA+Q +NH  FW  MK N G G+    L + I+ +FGS++ F  +   AA+
Sbjct: 62  KGAPLPAFNNAAQAWNHQFFWESMKPNGG-GEPSGELLELINRDFGSYDAFVKEFKAAAA 120

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K    KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 121 TQFGSGWAWLAYKPEEKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 180

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 181 SIFMEKLVSWEAVSSRLKAA 200


>gi|100284|pir||A39267 superoxide dismutase (EC 1.15.1.1) (Fe) - curled-leaved tobacco
          Length = 227

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 122/200 (61%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 27  FELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 86

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             A L  FNNA+Q +NH  FW  MK N G G+    L + I+ +FGS++ F  +   AA+
Sbjct: 87  KGAPLPAFNNAAQAWNHQFFWESMKPNGG-GEPSGELLELINRDFGSYDAFVKEFKAAAA 145

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K    KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 146 TQFGSGWAWLAYKPEEKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 205

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 206 SIFMEKLVSWEAVSSRLKAA 225


>gi|300918025|ref|ZP_07134647.1| superoxide dismutase [Escherichia coli MS 115-1]
 gi|300414767|gb|EFJ98077.1| superoxide dismutase [Escherichia coli MS 115-1]
          Length = 193

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGELADAITASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|91206010|ref|YP_538365.1| superoxide dismutase [Rickettsia bellii RML369-C]
 gi|157826626|ref|YP_001495690.1| superoxide dismutase [Rickettsia bellii OSU 85-389]
 gi|123266177|sp|Q1RH88|SODF_RICBR RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|91069554|gb|ABE05276.1| Superoxide dismutase [Rickettsia bellii RML369-C]
 gi|157801930|gb|ABV78653.1| Superoxide dismutase [Rickettsia bellii OSU 85-389]
          Length = 209

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 116/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHL-SLEEII-IKS 60
           F LPNLPY  +   P+ + ET EYHH  HH  Y  N   L  D E L   +LEEII   S
Sbjct: 14  FVLPNLPYEKESFKPHFTAETFEYHHGKHHNAYVQNLNNLLKDKEELQKKNLEEIIDWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  +FNNA+Q +NH  FW  +K N G GK    +   I+++FGSFE+F       A+
Sbjct: 74  QNQNIAIFNNAAQVWNHTFFWHSIKPNGG-GKPSGKILKQINEDFGSFEEFCEQFKAEAT 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   N +L+I KT NA  P+ NG  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLVYHNNRLQIVKTANAGTPIANGMQPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NWE+V
Sbjct: 193 FIKHMINWEFV 203


>gi|77165889|ref|YP_344414.1| superoxide dismutase [Nitrosococcus oceani ATCC 19707]
 gi|254433723|ref|ZP_05047231.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Nitrosococcus oceani AFC27]
 gi|76884203|gb|ABA58884.1| Superoxide dismutase [Nitrosococcus oceani ATCC 19707]
 gi|207090056|gb|EDZ67327.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Nitrosococcus oceani AFC27]
          Length = 193

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 122/195 (62%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L P++S+ETLEYH+  HH+ Y D    L    E  + SLEEII K+
Sbjct: 1   MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+   LFNN +Q +NH  +W C+    G G+   AL +AI+ NFGSF  FK     +A+
Sbjct: 61  SGT---LFNNGAQVWNHTFYWNCLTPQGG-GEPSGALLEAIEKNFGSFSDFKEKFSQSAT 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G L+I  T NA NPL  G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 117 TLFGSGWAWL-VKNSDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E+F   L NW++V +
Sbjct: 176 EAFW-KLANWDFVAK 189


>gi|300770194|ref|ZP_07080073.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300762670|gb|EFK59487.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 203

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY+ D L P++ KET+E HHD HH+ Y DN  K  +  +  +LSLEEI+   
Sbjct: 1   MAFQLEALPYASDALEPHIDKETMEIHHDRHHQAYVDNLNKAIAGTDAENLSLEEIVKNV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH LFW+ +  N G G+    L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYSPAVRNNGGGHFNHGLFWSVLGANAG-GQPTGELAAAIDEAFGSFDELKKKLQEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V  +GKL ++ T N +NPL++ A     P+LGIDVWEHAYYL ++ +R 
Sbjct: 120 GRFGSGWSWLIVGADGKLAVTSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+E+ I N++NW+ V ERY  A
Sbjct: 180 AYLEA-IFNVINWDAVAERYAAA 201


>gi|254420417|ref|ZP_05034141.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Brevundimonas sp. BAL3]
 gi|196186594|gb|EDX81570.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Brevundimonas sp. BAL3]
          Length = 203

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 126/205 (61%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F LP LPY+YD L P + KET+ +HHD HH+ Y DN  K + + A++   SLEEI   
Sbjct: 1   MAFTLPPLPYAYDALEPAIDKETMTFHHDKHHQTYVDNLNKAIDAAADLQGKSLEEIFTS 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              +   + NN   ++NH+LFW  +   D  G+    L  AID + G  +KFK D   A 
Sbjct: 61  ISTAPKAVRNNGGGHWNHSLFWELLAPADQTGEPSAELKAAIDSDLGGMDKFKEDFNAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLIN-----GAIPILGIDVWEHAYYLDFKYRR 174
           + QFGSGW WL V+NGKL+I+ T N +NPL++     G + +LG DVWEHAYYL ++ RR
Sbjct: 121 AAQFGSGWAWLIVQNGKLKITSTPNQDNPLMDVVEERGEV-VLGADVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
           A Y++SF + +VNW  V E Y  A+
Sbjct: 180 ADYLKSFWS-VVNWNKVNELYAAAV 203


>gi|162452443|ref|YP_001614810.1| hypothetical protein sce4167 [Sorangium cellulosum 'So ce 56']
 gi|161163025|emb|CAN94330.1| sodB [Sorangium cellulosum 'So ce 56']
          Length = 192

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/197 (47%), Positives = 124/197 (62%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKL-ASDAEMLHLSLEEIIIK 59
           M F LP LPYS D L P++S ETL++HH  HH  Y     +L A+DA +   SLE+++  
Sbjct: 1   MTFTLPELPYSRDALVPHISAETLDFHHGKHHNAYVTKLNELVAADAALAGKSLEDLVRT 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           + G+   +FN A+Q +NH  +W  MK   G G+ P AL  AID+ FGS   FK     AA
Sbjct: 61  TSGA---VFNQAAQVWNHTFYWHSMKPQGG-GEPPAALRAAIDEAFGSVSSFKEKFTAAA 116

Query: 120 STQFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
             QFGSGW WL VKNG  KLEI +T NA +PL  G  P+L  DVWEHAYY+D++  RA Y
Sbjct: 117 IGQFGSGWAWL-VKNGSGKLEIVQTGNAGSPLTEGKTPLLTCDVWEHAYYIDYRNARAKY 175

Query: 178 IESFITNLVNWEYVCER 194
           +E++  NLVNW++   +
Sbjct: 176 VEAWW-NLVNWDHAASK 191


>gi|254488536|ref|ZP_05101741.1| superoxide dismutase (Fe) [Roseobacter sp. GAI101]
 gi|214045405|gb|EEB86043.1| superoxide dismutase (Fe) [Roseobacter sp. GAI101]
          Length = 199

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 123/201 (61%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L S  MS ETLEYHHD HH  Y  N  K     E    SLEEII  
Sbjct: 1   MAFSLPDLPYAHDALASKGMSAETLEYHHDKHHNAYVVNGNKAIEGTEWADKSLEEIIKG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++   A    G+FNN SQ +NHN FW  M  N     +P  L  AI ++FGS +KFK D 
Sbjct: 61  TYDPKAVAQSGIFNNISQLWNHNQFWEMMGPN--GNAMPGDLEKAITESFGSVDKFKDDF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NP+  G   +LG DVWEH+YY+DF+  
Sbjct: 119 KAAGAGQFGSGWAWL-VKDTDGGLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNA 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLV+WE V  R
Sbjct: 178 RPDYLTNFLDNLVDWENVASR 198


>gi|194017668|ref|ZP_03056278.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Bacillus pumilus ATCC 7061]
 gi|194010568|gb|EDW20140.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Bacillus pumilus ATCC 7061]
          Length = 202

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLH-LSLEEIIIK 59
           M FKLP LPY+YD L P++ KET+  HH  HH  Y  N  K       L   S+EE++  
Sbjct: 1   MAFKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGVSALEDQSIEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G     L+DAI+   G FEKFKSD 
Sbjct: 61  LNSVPENVRTAVRNNGGGHANHSLFWTLLSPNGG-GAPTGELADAIEKELGGFEKFKSDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|138896037|ref|YP_001126490.1| manganese superoxide dismutase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248930|ref|ZP_03147630.1| Superoxide dismutase [Geobacillus sp. G11MC16]
 gi|134267550|gb|ABO67745.1| Manganese superoxide dismutase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196211806|gb|EDY06565.1| Superoxide dismutase [Geobacillus sp. G11MC16]
          Length = 204

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N    L   A++ + SLEE++  
Sbjct: 1   MPFELPALPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELAEAINKKFGSFAAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 EYIAAFW-NVVNWDEVAKRYSEA 201


>gi|88707070|ref|ZP_01104766.1| Superoxide dismutase (Fe) [Congregibacter litoralis KT71]
 gi|88698720|gb|EAQ95843.1| Superoxide dismutase (Fe) [Congregibacter litoralis KT71]
          Length = 192

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 124/193 (64%), Gaps = 8/193 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYH+  HHK Y D    + +   M   SLE++I +S
Sbjct: 1   MAFELPALPYEQNALEPHISAETLEYHYGKHHKTYVDKLNGMVAGTAMESASLEDVIRQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L++AI+  FGSF+KFK +   AA+
Sbjct: 61  EG---GMFNNAAQVWNHTFYWNCLSPNGG-GEPTGKLAEAINAAFGSFDKFKEEFSAAAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL V+N  G + IS T NA  P+     P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 GNFGSGWTWL-VQNTDGSVAISNTSNAGCPVTEDVTPLLTVDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYV 191
           E+F  NLVNW++V
Sbjct: 176 EAFW-NLVNWDFV 187


>gi|261246635|emb|CBG24445.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267993320|gb|ACY88205.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157964|emb|CBW17459.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|323129701|gb|ADX17131.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332988316|gb|AEF07299.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 193

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALVPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|16648535|gb|AAL25194.1| superoxide dismutase [Nostoc linckia]
          Length = 200

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+  + L PY M  ET EYH+  HHK Y DN  KL    ++   SLE++I  
Sbjct: 1   MAFVQPALPFEINALEPYGMKAETFEYHYGKHHKAYVDNLNKLTEGTDLADKSLEDVIKS 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           ++   S AG+FNNA+Q +NH  FW  +K   G GK    L   I+ +F SF+KFK +  +
Sbjct: 61  TYKDSSKAGIFNNAAQVWNHTFFWNSLKPAGG-GKPTGELGAKIEKDFDSFDKFKEEFSS 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
            A+TQFGSGW W+    G L++ KT NAENPL  G   +L +DVWEHAYY+D++  R  +
Sbjct: 120 VAATQFGSGWAWVIDDGGTLKVIKTPNAENPLAYGQKALLTLDVWEHAYYIDYRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NL NW++  E +  A
Sbjct: 180 IKNFLDNLANWDFAAENFAKA 200


>gi|296136140|ref|YP_003643382.1| Superoxide dismutase [Thiomonas intermedia K12]
 gi|295796262|gb|ADG31052.1| Superoxide dismutase [Thiomonas intermedia K12]
          Length = 193

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LP++ D L+P+MS+ETLEYHH  HH+ Y +N   L    E  ++SLE+II KS
Sbjct: 1   MQHELPPLPFAPDALAPHMSRETLEYHHGKHHQAYVNNTNNLIKGTEFENMSLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNN++Q +NH  FW C+K   G G+   AL+ AI+  +GS+  FK     +A 
Sbjct: 61  SG---GLFNNSAQVWNHTFFWNCLKAGGG-GEPKGALAAAINAKWGSYAAFKEAFHKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T N + PL     P+L IDVWEHAYY+DF+ RR  ++ 
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTANGQTPLTTADKPLLTIDVWEHAYYIDFRNRRPDFVT 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+ +L NW++  + +
Sbjct: 177 TFLDHLANWDFAEKNF 192


>gi|33413303|emb|CAE22480.1| superoxide dismutase [Fe] [Solanum lycopersicum]
          Length = 249

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 123/200 (61%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 49  FDLIPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 108

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + A L  FNNA+Q +NH  FW  MK N G G+    L + I+ +FGS++ F  +   AA+
Sbjct: 109 NGAPLPAFNNAAQAWNHQFFWESMKPNGG-GEPSGELLELINRDFGSYDTFVKEFKAAAA 167

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K  + KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 168 TQFGSGWAWLAYKPEDKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 227

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 228 SIFMEKLVSWEAVSIRLKAA 247


>gi|157692997|ref|YP_001487459.1| manganese (Mn) superoxide dismutase SodA [Bacillus pumilus
           SAFR-032]
 gi|157681755|gb|ABV62899.1| manganese (Mn) superoxide dismutase SodA [Bacillus pumilus
           SAFR-032]
          Length = 202

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLH-LSLEEII-- 57
           M FKLP LPY+YD L P++ KET+  HH  HH  Y  N  K       L   S+EE++  
Sbjct: 1   MAFKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGVSALEDQSIEELVAN 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH+LFW  +  N G G     L+DAI+   G FEKFKSD 
Sbjct: 61  LNSVPENIRTAVRNNGGGHANHSLFWTLLSPNGG-GAPTGELADAIEKELGGFEKFKSDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|198242517|ref|YP_002215703.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197937033|gb|ACH74366.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326623450|gb|EGE29795.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 193

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L++AI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLAEAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|83311610|ref|YP_421874.1| superoxide dismutase [Magnetospirillum magneticum AMB-1]
 gi|82946451|dbj|BAE51315.1| Superoxide dismutase [Magnetospirillum magneticum AMB-1]
          Length = 198

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 123/194 (63%), Gaps = 4/194 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LP++ D L P++S  T E+HH  HH  Y  N   L  D ++   SLEE+I  +
Sbjct: 1   MAFELPPLPFAIDALEPHISARTFEFHHGKHHAAYVTNLNNLTKDTDLASKSLEEVIKVA 60

Query: 61  HG---SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                +  G+FNNA+Q +NH  FW C+KK  G     + L+  I+ + G F+KFK D   
Sbjct: 61  AADLPAKQGIFNNAAQVWNHTFFWNCLKKGGGGKPGAKLLAK-IEADLGGFDKFKEDFKA 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA  QFGSGW WL +  GKL+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  +
Sbjct: 120 AAVGQFGSGWAWLVLDGGKLKITKTANADLPLAHGQKALLTVDVWEHAYYLDWQNRRPDF 179

Query: 178 IESFITNLVNWEYV 191
           ++ F+ NLVNW++V
Sbjct: 180 VQCFLDNLVNWDFV 193


>gi|168819180|ref|ZP_02831180.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205343852|gb|EDZ30616.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086092|emb|CBY95866.1| Superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 193

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L++AI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGRLAEAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|126662608|ref|ZP_01733607.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
 gi|126625987|gb|EAZ96676.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
          Length = 201

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 124/202 (61%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y  N     +  E+   S+E+I+   
Sbjct: 1   MAFELPQLSYAFDALEPHIDAKTMEIHHSKHHNAYVTNLNAAIAGTELEGKSIEDIMKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   ++NH LFW  M  N G G     L+ AID  FGSF+ FK++   A +
Sbjct: 61  DMNNMAVRNNGGGHFNHTLFWEIMSPNGG-GLPTGELATAIDAAFGSFDAFKAEFSKAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL VK+GKLE+  T N +NPL+ G      PILG+DVWEHAYYL+++ RR  
Sbjct: 120 TRFGSGWAWLCVKDGKLEVCSTPNQDNPLMPGVACGGQPILGMDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+E+F  N++NW  V +R+  +
Sbjct: 180 YMEAFF-NVINWTEVAKRFSAS 200


>gi|17230430|ref|NP_486978.1| iron superoxide dismutase [Nostoc sp. PCC 7120]
 gi|81771173|sp|Q8YSZ1|SODF_ANASP RecName: Full=Superoxide dismutase [Fe]
 gi|17132032|dbj|BAB74637.1| iron superoxide dismutase [Nostoc sp. PCC 7120]
          Length = 200

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 122/201 (60%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LPY ++ L  Y M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  
Sbjct: 1   MAFVQEPLPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +    S AG+FNNA+Q +NH  FW  +K   G G      +  I+ +FGSF+K K +   
Sbjct: 61  AFKDASKAGIFNNAAQVWNHTFFWNSLKPAGG-GAPTGEFAAKINQDFGSFDKLKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L+++KT NAENPL +G   +L +DVWEHAYY+DF+  R  +
Sbjct: 120 AAATQFGSGWAWLIDDGGTLKVTKTPNAENPLAHGQKALLTLDVWEHAYYIDFRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++++ NLVNW++    Y  A
Sbjct: 180 IKNYLDNLVNWDFAAANYAKA 200


>gi|218699776|ref|YP_002407405.1| superoxide dismutase [Escherichia coli IAI39]
 gi|218369762|emb|CAR17533.1| superoxide dismutase, Fe [Escherichia coli IAI39]
          Length = 193

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFKLPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|116750838|ref|YP_847525.1| manganese and iron superoxide dismutase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699902|gb|ABK19090.1| manganese and iron superoxide dismutase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 241

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 117/190 (61%), Gaps = 3/190 (1%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGS 63
           +LP LPY+ + L P +S  TL +H+  HHK Y DN  KL +  E   + +E++I  + G 
Sbjct: 46  ELPPLPYAENALEPVLSSATLGFHYGKHHKAYLDNVNKLIAGTEFAQMPIEQVISSTAGK 105

Query: 64  N--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           +  A +FNNA+Q +NH  +W C+    G    P AL   I+ +FGS +  + +L +AA T
Sbjct: 106 SDKAAIFNNAAQTWNHTFYWKCLSPKGGGDPQP-ALKQRIETSFGSLDACRKELASAAVT 164

Query: 122 QFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
            FGSGW WL +   KL++  T NA+NP+     P+L IDVWEHAYYLD++ RRA Y+   
Sbjct: 165 CFGSGWAWLVLDGDKLKVVATSNADNPMTRNMKPLLTIDVWEHAYYLDYQNRRADYVNGV 224

Query: 182 ITNLVNWEYV 191
           I  L+NWE+V
Sbjct: 225 IEKLINWEFV 234


>gi|237731381|ref|ZP_04561862.1| superoxide dismutase [Citrobacter sp. 30_2]
 gi|226906920|gb|EEH92838.1| superoxide dismutase [Citrobacter sp. 30_2]
          Length = 193

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   LVNWE+V + +
Sbjct: 177 HFWA-LVNWEFVAKNF 191


>gi|134650|sp|P00449|SODM_BACST RecName: Full=Superoxide dismutase [Mn]
 gi|143203|gb|AAA22600.1| manganese superoxide dismutase (EC 1.15.1.1) [Geobacillus
           stearothermophilus]
 gi|143552|gb|AAA22765.1| Mn-superoxide dismutase [Geobacillus stearothermophilus]
 gi|143555|gb|AAA22767.1| Mn-superoxide dismutase [Geobacillus stearothermophilus]
          Length = 204

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N    L    ++ + SLEE++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELADAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 EYIAAFW-NVVNWDEVAKRYSEA 201


>gi|220935629|ref|YP_002514528.1| Superoxide dismutase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996939|gb|ACL73541.1| Superoxide dismutase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 193

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 7/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ D L+P++S ETLE+HHD HH  Y  N  KL    E  ++SLE+I+ K+
Sbjct: 1   MAHELPALPYAKDALAPHISAETLEFHHDKHHATYVTNLNKLIVGTEFENMSLEDIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G+FNNA+Q +NH  ++ CM  N G G+   AL+DAI+  FGSF +FK     + +
Sbjct: 61  PAG--GIFNNAAQVWNHTFYFNCMGPNGG-GEPTGALADAINKAFGSFAEFKEKFAASGA 117

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  G +EI  T NA  PL     P++  DVWEHAYY+D++  R  Y+
Sbjct: 118 GNFGSGWTWL-VKNADGSVEIVNTSNAATPLTTDKKPLMTADVWEHAYYIDYRNARPKYL 176

Query: 179 ESFITNLVNWEYVCERY 195
           E+F  N+VNW++V + Y
Sbjct: 177 EAFW-NVVNWDFVAKNY 192


>gi|33320069|gb|AAQ05797.1|AF478456_1 Fe-superoxide dismutase [Thalassiosira weissflogii]
          Length = 201

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 124/200 (62%), Gaps = 8/200 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY++D L P +   T+E HHD HH  Y        +  ++   S+E  ++  
Sbjct: 1   MAFELPDLPYAFDALEPNIDARTMEIHHDKHHAGYTSKLNGAVAGTDLEGKSIE-ALLAD 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +  N  + NN   YYNHNLFW  M   DG G+    L+DAI++  GSF++FK+    AA+
Sbjct: 60  NSDNGAIRNNGGGYYNHNLFWTVMSP-DGGGEPTGELADAINEACGSFDEFKTAFSNAAA 118

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V+  GK+E+  + N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCVQAGGKVEVCSSANQDNPLMPGIGCGGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N++NW+ V  RY
Sbjct: 179 DYINAFF-NVINWDEVARRY 197


>gi|329575058|gb|EGG56610.1| superoxide dismutase, Mn [Enterococcus faecalis TX1467]
          Length = 202

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE++ TN+VNW+ V E +  A
Sbjct: 180 DYIEAW-TNVVNWDKVNELFAAA 201


>gi|283833272|ref|ZP_06353013.1| superoxide dismutase [Citrobacter youngae ATCC 29220]
 gi|291070909|gb|EFE09018.1| superoxide dismutase [Citrobacter youngae ATCC 29220]
          Length = 193

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGADGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   LVNWE+V + +
Sbjct: 177 HFWA-LVNWEFVAKNF 191


>gi|166700|gb|AAA32791.1| Fe-superoxide dismutase [Arabidopsis thaliana]
          Length = 226

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 123/195 (63%), Gaps = 3/195 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAG 66
           P++ D L P+MSK+TLE+H   HH+ Y DN  K     E+    LE II  ++  G    
Sbjct: 31  PFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLP 90

Query: 67  LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 91  AFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYEEFNAAAATQFGAG 149

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  N KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+TNLV
Sbjct: 150 WAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLV 209

Query: 187 NWEYVCERYETAMLA 201
           +WE V  R E A  A
Sbjct: 210 SWEAVSARLEAAKAA 224


>gi|119510542|ref|ZP_01629673.1| iron superoxide dismutase [Nodularia spumigena CCY9414]
 gi|119464809|gb|EAW45715.1| iron superoxide dismutase [Nodularia spumigena CCY9414]
          Length = 200

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 121/201 (60%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+ ++ L  Y M  ET EYH+  HH  Y  N  KL    E+   SLEE+I  
Sbjct: 1   MAFTQPPLPFDFNALEAYGMKGETFEYHYGKHHAAYVTNLNKLTDGTELADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +    S  G+FNN +Q +NH+ FW C+K   G G     L+  I+ +FGSF+KFK +   
Sbjct: 61  AFKDSSKVGIFNNGAQVWNHSFFWNCLKPAGG-GAPTGDLAAKINQDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+D +  R  +
Sbjct: 120 AAATQFGSGWAWLIDDGGTLKVMKTPNAENPLAHGKKALLTLDVWEHAYYIDHRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+  LVNW++  E Y  A
Sbjct: 180 IKNFLDQLVNWDFAAENYAKA 200


>gi|298527707|ref|ZP_07015111.1| Superoxide dismutase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511359|gb|EFI35261.1| Superoxide dismutase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 205

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 122/194 (62%), Gaps = 3/194 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--G 62
           LP LP++ D L P +S  TLE+H+  HH+ Y  N  K  S  ++   SLEEI+  +H   
Sbjct: 13  LPPLPFAQDALEPVISARTLEFHYGKHHQTYVTNLNKFISGTDLEGKSLEEIVQATHNKA 72

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q +NH  +W  +    GK + P AL   +++ FGS +  K +L +AA TQ
Sbjct: 73  DKVGIFNNAAQVWNHTFYWNSLSPQGGK-EPPAALKQKMEEAFGSVDDCKKELHSAAVTQ 131

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL ++ G+L+++KT NA+ PL++   P+L IDVWEHAYYLD++ RR  Y+++ +
Sbjct: 132 FGSGWAWLVLEGGRLKVTKTLNADMPLVHNMKPLLTIDVWEHAYYLDYQNRRPDYVQAVL 191

Query: 183 TNLVNWEYVCERYE 196
             L NW++     E
Sbjct: 192 DKLANWDFAASNME 205


>gi|6653273|gb|AAF22652.1|AF201090_1 iron superoxide dismutase [magnetite-containing magnetic vibrio]
          Length = 168

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 110/169 (65%), Gaps = 3/169 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+ D L+P++S  T ++HH  HHK Y  N   L +D  M  +SLE+I+  +
Sbjct: 1   MAFTLPDLPYAKDALAPHISANTFDFHHGKHHKAYVVNLNGLVADTPMAAMSLEDIMKAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH  FW+ MK N G G    A++ AID+ FGS++ FK    TA
Sbjct: 61  AGDASKAGIFNNAAQVWNHTFFWSSMKPNGG-GAPTGAIAAAIDEAFGSYDAFKEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYY 167
             TQFGSGW WL  K  KLEI KT NAE PL  GA PIL  DVW+HAYY
Sbjct: 120 GMTQFGSGWAWLVKKGDKLEIVKTPNAECPLTRGATPILTCDVWDHAYY 168


>gi|83593095|ref|YP_426847.1| superoxide dismutase [Rhodospirillum rubrum ATCC 11170]
 gi|83576009|gb|ABC22560.1| Superoxide dismutase [Rhodospirillum rubrum ATCC 11170]
          Length = 227

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 117/200 (58%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LP++ + L P++S +T E+HH  HH  Y      L  D  +   SLE+II   
Sbjct: 29  MAFELPPLPFAKEALEPHISAKTFEFHHGKHHNAYVTTLNSLIKDTPLADKSLEDIITTV 88

Query: 61  HGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  A   +FNNA+Q +NH  FW  +    G G+   A  +AID  FGS + FK     A
Sbjct: 89  AGDAAKTPVFNNAAQVWNHTFFWNSLSPT-GGGQPTGAAKEAIDGAFGSLDAFKEQFKQA 147

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL V  GKL I+KT NAE PL  G   +L  DVWEHAYYLD++ RR  ++
Sbjct: 148 GVTQFGSGWAWLVVDGGKLSIAKTPNAELPLTKGQTAVLTCDVWEHAYYLDYQNRRPDFL 207

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+ +LVNW+++      A
Sbjct: 208 QTFLDHLVNWDFLAANLAKA 227


>gi|163790995|ref|ZP_02185417.1| superoxide dismutase, Mn [Carnobacterium sp. AT7]
 gi|159873734|gb|EDP67816.1| superoxide dismutase, Mn [Carnobacterium sp. AT7]
          Length = 202

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P++ + T+E+HHD HH  Y +     L    E+   ++EE++  
Sbjct: 1   MTYELPKLPYAYDALEPHIDQATMEFHHDKHHATYVEKTNAALEKYPELAEKTIEELVTD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH+ FW  +  N G G+   AL + ID  FGSF+K K  +
Sbjct: 61  LNSVPEEIRTAIRNNGGGHANHSFFWEILSPNGG-GEPTGALKEDIDATFGSFDKVKEAI 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TA + QFGSGW WL + NGKLE++ T N ++PL +G  P+ G+DVWEHAYYL+++ +R 
Sbjct: 120 ETAGAGQFGSGWAWLVLNNGKLEVTATANQDSPLTDGKTPLFGVDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+++ + N+VNWE V +RYE A
Sbjct: 180 AYLKA-VWNVVNWEEVAKRYEAA 201


>gi|299065875|emb|CBJ37054.1| superoxide dismutase [Ralstonia solanacearum CMR15]
          Length = 192

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPQLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W  +K N G G    AL+DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GLFNNAAQVWNHTFYWNGLKPNGG-GAPTGALADAINAKWGSFDAFKEAFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F + LVNW++V   +
Sbjct: 177 AFWS-LVNWDFVASNF 191


>gi|325286155|ref|YP_004261945.1| Superoxide dismutase [Cellulophaga lytica DSM 7489]
 gi|324321609|gb|ADY29074.1| Superoxide dismutase [Cellulophaga lytica DSM 7489]
          Length = 225

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 121/202 (59%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y           ++    +E+I+   
Sbjct: 24  MAFELPKLPYAYDALEPHIDARTMEIHHTKHHNGYTTKLNGAIEGTDLAGKPIEDILTNL 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH+LFW  M  N G G+    L+ AI+D +GSF+ FK    TAA+
Sbjct: 84  DMSNGAVRNNGGGFYNHSLFWEVMSPNGG-GEPTGELATAINDAYGSFDAFKEAFSTAAA 142

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  + N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 143 TRFGSGWAWLCVHKGGKVEVCSSPNQDNPLMPGVGCGGFPILGLDVWEHAYYLNYQNRRP 202

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI  F  N++NWE V E Y +
Sbjct: 203 DYIGGFF-NVINWEKVSELYAS 223


>gi|300113411|ref|YP_003759986.1| superoxide dismutase [Nitrosococcus watsonii C-113]
 gi|299539348|gb|ADJ27665.1| Superoxide dismutase [Nitrosococcus watsonii C-113]
          Length = 193

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 121/195 (62%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L P++S+ETLEYH+  HH+ Y D    L    E  + SLEEII K+
Sbjct: 1   MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+   LFNN +Q +NH  +W C+    G G+    L +AI+ NFGSF  FK     +A+
Sbjct: 61  SGT---LFNNGAQVWNHTFYWNCLAPQGG-GEPSGTLLEAIEKNFGSFSDFKEKFSQSAT 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G L+I  T NA NPL  G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 117 TLFGSGWAWL-VKNSDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E+F   L NW++V +
Sbjct: 176 EAFW-KLANWDFVAK 189


>gi|229916297|ref|YP_002884943.1| Superoxide dismutase [Exiguobacterium sp. AT1b]
 gi|229467726|gb|ACQ69498.1| Superoxide dismutase [Exiguobacterium sp. AT1b]
          Length = 202

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 126/200 (63%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP L Y+YD L P++   T+E HH  HH  Y  N        ++ + SLE+++ K   
Sbjct: 4   FELPQLDYAYDALEPHIDARTMEIHHTKHHNTYVTNVNNALEGKDVEYSSLEDLLQKIDS 63

Query: 63  SNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             A     + NN   ++NH+ FW  +KKN+  G     L+ AID++FGSF+ FK +   A
Sbjct: 64  LPADIQTAVRNNGGGHWNHSFFWKLLKKNE-NGTPSGDLAAAIDESFGSFDGFKDEFTKA 122

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+T+FGSGW WL VKNGKLE++ T N ++P++ G  PILG+DVWEHAYYL+++ RR  YI
Sbjct: 123 ATTRFGSGWAWLVVKNGKLEVTSTPNQDSPIMEGVTPILGLDVWEHAYYLNYQNRRPDYI 182

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  ++++W+YV   Y  A
Sbjct: 183 NAFF-HVIDWDYVATLYADA 201


>gi|152981017|ref|YP_001354279.1| superoxide dismutase [Janthinobacterium sp. Marseille]
 gi|151281094|gb|ABR89504.1| superoxide dismutase [Janthinobacterium sp. Marseille]
          Length = 192

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 124/194 (63%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  + SLEEII KS
Sbjct: 1   MEHTLPALPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENASLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K N G G    A++DAI+  +GSF+KFK +   +  
Sbjct: 61  SG---GVFNNAAQVWNHTFYWNGLKPNGG-GAPTGAVADAINAKWGSFDKFKEEFTKSCV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL  K +G L+++ T NA  PL     P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TNFGSGWTWLVKKADGSLDLANTSNAGCPLTGADKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCE 193
           SF   LVNW++V +
Sbjct: 177 SFWA-LVNWDFVAK 189


>gi|292492308|ref|YP_003527747.1| superoxide dismutase [Nitrosococcus halophilus Nc4]
 gi|291580903|gb|ADE15360.1| Superoxide dismutase [Nitrosococcus halophilus Nc4]
          Length = 193

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 122/195 (62%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L P++S+ETLEYH+  HH+ Y D    L    E  + SLEEII K+
Sbjct: 1   MSHRLPELPYAMNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+   +FNN +Q +NH  +W C+    G+ +   AL DAI +NFGSF  FK     +A 
Sbjct: 61  SGA---IFNNGAQIWNHTFYWNCLAPQGGE-EPNGALMDAIRENFGSFADFKEKFSQSAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G L+I  T NA NPL  G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 117 TLFGSGWAWL-VKNPDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E+F  NL NW++V +
Sbjct: 176 EAFW-NLANWDFVAK 189


>gi|319952832|ref|YP_004164099.1| superoxide dismutase [Cellulophaga algicola DSM 14237]
 gi|319421492|gb|ADV48601.1| Superoxide dismutase [Cellulophaga algicola DSM 14237]
          Length = 202

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L P +   T+E HH  HH  Y  N     +  ++   S+E I+   
Sbjct: 1   MAFDLPKLPYAYDALEPNIDARTMEIHHTKHHNGYTTNLNNAIAGTDLESKSIETILDTL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA + NN   +YNH+LFW  M   DG GK    L+ AID  +GS E FK     AA+
Sbjct: 61  DMSNAAVRNNGGGFYNHSLFWEVMSP-DGGGKPTGELATAIDAAYGSLEAFKDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+EI  T N +NPL+     G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEICSTPNQDNPLMPGVGCGGFPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N++NW  V E Y
Sbjct: 180 DYINAFF-NVINWNKVSELY 198


>gi|4455253|emb|CAB36752.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis
           thaliana]
 gi|7269360|emb|CAB79419.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis
           thaliana]
          Length = 234

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 123/195 (63%), Gaps = 3/195 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAG 66
           P++ D L P+MSK+TLE+H   HH+ Y DN  K     E+    LE II  ++  G    
Sbjct: 39  PFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLP 98

Query: 67  LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 99  AFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYEEFNAAAATQFGAG 157

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  N KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+TNLV
Sbjct: 158 WAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLV 217

Query: 187 NWEYVCERYETAMLA 201
           +WE V  R E A  A
Sbjct: 218 SWEAVSARLEAAKAA 232


>gi|15234913|ref|NP_194240.1| FSD1 (FE SUPEROXIDE DISMUTASE 1); copper ion binding / superoxide
           dismutase [Arabidopsis thaliana]
 gi|30686762|ref|NP_849440.1| FSD1 (FE SUPEROXIDE DISMUTASE 1); copper ion binding / superoxide
           dismutase [Arabidopsis thaliana]
 gi|30686768|ref|NP_849441.1| FSD1 (FE SUPEROXIDE DISMUTASE 1); copper ion binding / superoxide
           dismutase [Arabidopsis thaliana]
 gi|39932722|sp|P21276|SODF_ARATH RecName: Full=Superoxide dismutase [Fe], chloroplastic; Flags:
           Precursor
 gi|11692918|gb|AAG40062.1|AF324711_1 AT4g25100 [Arabidopsis thaliana]
 gi|11908030|gb|AAG41444.1|AF326862_1 putative Fe superoxide dismutase [Arabidopsis thaliana]
 gi|12642850|gb|AAK00367.1|AF339685_1 putative Fe superoxide dismutase [Arabidopsis thaliana]
 gi|14517450|gb|AAK62615.1| AT4g25100/F13M23_240 [Arabidopsis thaliana]
 gi|21592826|gb|AAM64776.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis
           thaliana]
 gi|22136540|gb|AAM91056.1| AT4g25100/F13M23_240 [Arabidopsis thaliana]
 gi|332659607|gb|AEE85007.1| Superoxide dismutase [Fe] [Arabidopsis thaliana]
 gi|332659608|gb|AEE85008.1| Superoxide dismutase [Fe] [Arabidopsis thaliana]
 gi|332659609|gb|AEE85009.1| Superoxide dismutase [Fe] [Arabidopsis thaliana]
 gi|332659611|gb|AEE85011.1| Superoxide dismutase [Fe] [Arabidopsis thaliana]
          Length = 212

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 123/195 (63%), Gaps = 3/195 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAG 66
           P++ D L P+MSK+TLE+H   HH+ Y DN  K     E+    LE II  ++  G    
Sbjct: 17  PFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLP 76

Query: 67  LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 77  AFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYEEFNAAAATQFGAG 135

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  N KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+TNLV
Sbjct: 136 WAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLV 195

Query: 187 NWEYVCERYETAMLA 201
           +WE V  R E A  A
Sbjct: 196 SWEAVSARLEAAKAA 210


>gi|283785132|ref|YP_003364997.1| superoxide dismutase [Fe] [Citrobacter rodentium ICC168]
 gi|282948586|emb|CBG88177.1| superoxide dismutase [Fe] [Citrobacter rodentium ICC168]
          Length = 193

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  +
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF  FK+    AA 
Sbjct: 61  DG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGELADAIVASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL   K+GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGKDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNW +V + +
Sbjct: 177 NFWA-LVNWAFVAKNF 191


>gi|329895207|ref|ZP_08270871.1| Superoxide dismutase (Fe) [gamma proteobacterium IMCC3088]
 gi|328922445|gb|EGG29787.1| Superoxide dismutase (Fe) [gamma proteobacterium IMCC3088]
          Length = 193

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (62%), Gaps = 9/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+ D L P++S ETLE+H+  HH+ Y D    L    +M   SLE+I+  S
Sbjct: 1   MSFELPSLPYAKDALEPHISAETLEFHYGKHHQTYVDKLNGLVDGTDMASKSLEDIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI   FGSF+ FK     AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLSPN-GGGQATGAIADAITAAFGSFDAFKEQFTNAAL 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHY 177
             FGSGW WL VKN  G + I  T NA  PL + ++ P+L +DVWEHAYY+D++  R  Y
Sbjct: 117 NNFGSGWTWL-VKNADGSVAIVNTSNAATPLTDSSVTPLLTVDVWEHAYYVDYRNARPKY 175

Query: 178 IESFITNLVNWEYVCERY 195
           +E+F   LVNW++V   +
Sbjct: 176 MEAFWA-LVNWDFVNANF 192


>gi|256617381|ref|ZP_05474227.1| manganese superoxide dismutase [Enterococcus faecalis ATCC 4200]
 gi|256761384|ref|ZP_05501964.1| manganese superoxide dismutase [Enterococcus faecalis T3]
 gi|256957636|ref|ZP_05561807.1| manganese superoxide dismutase [Enterococcus faecalis DS5]
 gi|256959656|ref|ZP_05563827.1| manganese superoxide dismutase [Enterococcus faecalis Merz96]
 gi|256963231|ref|ZP_05567402.1| manganese superoxide dismutase [Enterococcus faecalis HIP11704]
 gi|257080127|ref|ZP_05574488.1| manganese superoxide dismutase [Enterococcus faecalis JH1]
 gi|257080860|ref|ZP_05575221.1| manganese superoxide dismutase [Enterococcus faecalis E1Sol]
 gi|257083544|ref|ZP_05577905.1| manganese superoxide dismutase [Enterococcus faecalis Fly1]
 gi|257085817|ref|ZP_05580178.1| manganese superoxide dismutase [Enterococcus faecalis D6]
 gi|257088959|ref|ZP_05583320.1| manganese superoxide dismutase [Enterococcus faecalis CH188]
 gi|257415180|ref|ZP_05592174.1| manganese superoxide dismutase [Enterococcus faecalis AR01/DG]
 gi|257418235|ref|ZP_05595229.1| manganese superoxide dismutase [Enterococcus faecalis T11]
 gi|293384848|ref|ZP_06630691.1| superoxide dismutase, Mn [Enterococcus faecalis R712]
 gi|293389137|ref|ZP_06633605.1| superoxide dismutase, Mn [Enterococcus faecalis S613]
 gi|294780697|ref|ZP_06746058.1| superoxide dismutase, Mn [Enterococcus faecalis PC1.1]
 gi|307268575|ref|ZP_07549947.1| superoxide dismutase, Mn [Enterococcus faecalis TX4248]
 gi|307272273|ref|ZP_07553533.1| superoxide dismutase, Mn [Enterococcus faecalis TX0855]
 gi|307275563|ref|ZP_07556704.1| superoxide dismutase, Mn [Enterococcus faecalis TX2134]
 gi|307288824|ref|ZP_07568802.1| superoxide dismutase, Mn [Enterococcus faecalis TX0109]
 gi|307290623|ref|ZP_07570531.1| superoxide dismutase, Mn [Enterococcus faecalis TX0411]
 gi|312900205|ref|ZP_07759517.1| superoxide dismutase, Mn [Enterococcus faecalis TX0470]
 gi|312904839|ref|ZP_07763979.1| superoxide dismutase, Mn [Enterococcus faecalis TX0635]
 gi|312908146|ref|ZP_07767124.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 512]
 gi|312952098|ref|ZP_07770980.1| superoxide dismutase, Mn [Enterococcus faecalis TX0102]
 gi|312979082|ref|ZP_07790797.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 516]
 gi|256596908|gb|EEU16084.1| manganese superoxide dismutase [Enterococcus faecalis ATCC 4200]
 gi|256682635|gb|EEU22330.1| manganese superoxide dismutase [Enterococcus faecalis T3]
 gi|256948132|gb|EEU64764.1| manganese superoxide dismutase [Enterococcus faecalis DS5]
 gi|256950152|gb|EEU66784.1| manganese superoxide dismutase [Enterococcus faecalis Merz96]
 gi|256953727|gb|EEU70359.1| manganese superoxide dismutase [Enterococcus faecalis HIP11704]
 gi|256988157|gb|EEU75459.1| manganese superoxide dismutase [Enterococcus faecalis JH1]
 gi|256988890|gb|EEU76192.1| manganese superoxide dismutase [Enterococcus faecalis E1Sol]
 gi|256991574|gb|EEU78876.1| manganese superoxide dismutase [Enterococcus faecalis Fly1]
 gi|256993847|gb|EEU81149.1| manganese superoxide dismutase [Enterococcus faecalis D6]
 gi|256997771|gb|EEU84291.1| manganese superoxide dismutase [Enterococcus faecalis CH188]
 gi|257157008|gb|EEU86968.1| manganese superoxide dismutase [Enterococcus faecalis ARO1/DG]
 gi|257160063|gb|EEU90023.1| manganese superoxide dismutase [Enterococcus faecalis T11]
 gi|291077852|gb|EFE15216.1| superoxide dismutase, Mn [Enterococcus faecalis R712]
 gi|291081529|gb|EFE18492.1| superoxide dismutase, Mn [Enterococcus faecalis S613]
 gi|294452307|gb|EFG20748.1| superoxide dismutase, Mn [Enterococcus faecalis PC1.1]
 gi|295114169|emb|CBL32806.1| Superoxide dismutase [Enterococcus sp. 7L76]
 gi|306498337|gb|EFM67846.1| superoxide dismutase, Mn [Enterococcus faecalis TX0411]
 gi|306500293|gb|EFM69632.1| superoxide dismutase, Mn [Enterococcus faecalis TX0109]
 gi|306507668|gb|EFM76797.1| superoxide dismutase, Mn [Enterococcus faecalis TX2134]
 gi|306511162|gb|EFM80172.1| superoxide dismutase, Mn [Enterococcus faecalis TX0855]
 gi|306515064|gb|EFM83607.1| superoxide dismutase, Mn [Enterococcus faecalis TX4248]
 gi|310625854|gb|EFQ09137.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 512]
 gi|310629945|gb|EFQ13228.1| superoxide dismutase, Mn [Enterococcus faecalis TX0102]
 gi|310631845|gb|EFQ15128.1| superoxide dismutase, Mn [Enterococcus faecalis TX0635]
 gi|311288116|gb|EFQ66672.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 516]
 gi|311292566|gb|EFQ71122.1| superoxide dismutase, Mn [Enterococcus faecalis TX0470]
 gi|315026273|gb|EFT38205.1| superoxide dismutase, Mn [Enterococcus faecalis TX2137]
 gi|315032225|gb|EFT44157.1| superoxide dismutase, Mn [Enterococcus faecalis TX0017]
 gi|315035539|gb|EFT47471.1| superoxide dismutase, Mn [Enterococcus faecalis TX0027]
 gi|315143953|gb|EFT87969.1| superoxide dismutase, Mn [Enterococcus faecalis TX2141]
 gi|315146817|gb|EFT90833.1| superoxide dismutase, Mn [Enterococcus faecalis TX4244]
 gi|315149456|gb|EFT93472.1| superoxide dismutase, Mn [Enterococcus faecalis TX0012]
 gi|315153949|gb|EFT97965.1| superoxide dismutase, Mn [Enterococcus faecalis TX0031]
 gi|315161029|gb|EFU05046.1| superoxide dismutase, Mn [Enterococcus faecalis TX0645]
 gi|315166229|gb|EFU10246.1| superoxide dismutase, Mn [Enterococcus faecalis TX1302]
 gi|315167721|gb|EFU11738.1| superoxide dismutase, Mn [Enterococcus faecalis TX1341]
 gi|315170818|gb|EFU14835.1| superoxide dismutase, Mn [Enterococcus faecalis TX1342]
 gi|315173876|gb|EFU17893.1| superoxide dismutase, Mn [Enterococcus faecalis TX1346]
 gi|315576480|gb|EFU88671.1| superoxide dismutase, Mn [Enterococcus faecalis TX0630]
 gi|327534201|gb|AEA93035.1| superoxide dismutase [Enterococcus faecalis OG1RF]
          Length = 202

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|300861936|ref|ZP_07108016.1| superoxide dismutase [Enterococcus faecalis TUSoD Ef11]
 gi|300848461|gb|EFK76218.1| superoxide dismutase [Enterococcus faecalis TUSoD Ef11]
          Length = 202

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMASNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|229548388|ref|ZP_04437113.1| Mn superoxide dismutase [Enterococcus faecalis ATCC 29200]
 gi|255971016|ref|ZP_05421602.1| manganese superoxide dismutase [Enterococcus faecalis T1]
 gi|257420742|ref|ZP_05597732.1| superoxide dismutase [Enterococcus faecalis X98]
 gi|229306604|gb|EEN72600.1| Mn superoxide dismutase [Enterococcus faecalis ATCC 29200]
 gi|255962034|gb|EET94510.1| manganese superoxide dismutase [Enterococcus faecalis T1]
 gi|257162566|gb|EEU92526.1| superoxide dismutase [Enterococcus faecalis X98]
 gi|315155011|gb|EFT99027.1| superoxide dismutase, Mn [Enterococcus faecalis TX0043]
          Length = 202

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWKIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|238920005|ref|YP_002933520.1| superoxide dismutase [Edwardsiella ictaluri 93-146]
 gi|238869574|gb|ACR69285.1| superoxide dismutase [Edwardsiella ictaluri 93-146]
          Length = 192

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L    E    SLEEI+   
Sbjct: 1   MSFELPELPYAMNALEPHISAETLEYHYGKHHNAYVVNLNNLIKGTEFEGKSLEEIV--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            GS+ G+FNNA+Q +NH  +W C+  N G G+   AL+DAI   FGSF  FK  L  +A 
Sbjct: 58  KGSSGGIFNNAAQVWNHTFYWHCLSPNGG-GEPSGALADAISTAFGSFAAFKDALTKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLAIVNTANAATPLTGDDKPLLTVDVWEHAYYIDYRNARPVYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F T LVNWE+V +
Sbjct: 177 NFWT-LVNWEFVAK 189


>gi|295397325|ref|ZP_06807417.1| superoxide dismutase [Aerococcus viridans ATCC 11563]
 gi|294974399|gb|EFG50134.1| superoxide dismutase [Aerococcus viridans ATCC 11563]
          Length = 201

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 120/202 (59%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L PY  +ET+  HHD HH  Y  NA    +  ++   S EEI+   
Sbjct: 1   MAFELPELPYAYDALEPYFDEETMHLHHDKHHNTYVTNANAALAGTDLADKSAEEILSNF 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW     N G G+   AL +AID  FGSF  F+    
Sbjct: 61  DAVPEDKKTAVRNNVGGHANHTLFWEQFAANAG-GEPTGALKEAIDAKFGSFADFQEAFK 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TAA+ +FGSGW WL + NG++ I+ T N ++PL++G  P+LGIDVWEHAYYL +K  R  
Sbjct: 120 TAATGRFGSGWAWLVLANGEVAITSTPNQDSPLMDGQTPLLGIDVWEHAYYLKYKNVRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F  N+VNW+ V +R++ A
Sbjct: 180 YIAAFW-NIVNWDEVAKRFDAA 200


>gi|317492119|ref|ZP_07950549.1| iron/manganese superoxide dismutase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919824|gb|EFV41153.1| iron/manganese superoxide dismutase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 192

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYH+  HH  Y  N   L    E    SLEEII  S
Sbjct: 1   MSFELPALPYEKNALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+    G      A++DAI+  FGSFE FK +L  +A 
Sbjct: 61  TG---GIFNNAAQVWNHTFYWHCLSPKGGNAPT-GAVADAINKAFGSFEAFKEELTKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  PL +G  P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGSLAIVNTSNAATPLTSGDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNWE+V +
Sbjct: 177 NFWA-LVNWEFVAK 189


>gi|149275669|gb|ABR23160.1| iron-superoxide dismutase 2 [Ulva fasciata]
          Length = 203

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 125/202 (61%), Gaps = 5/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP  P+    L P+MSKE++EYH   HH+ Y  N  K  +  +M  L++EEI+  +
Sbjct: 1   MPVELPPPPFELHALEPHMSKESMEYHWGKHHRGYVTNLNKAIAGTDMDGLAIEEIVKAT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +G+    FNNA+Q +NH  FW  MK  +G G+    L ++I+  FGSFE+F     TA
Sbjct: 61  WNNGAPTASFNNAAQVWNHTFFWDSMKP-EGGGEPSGKLLESINTAFGSFEEFSKQFKTA 119

Query: 119 ASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL   + G L + KT NAE P+ +GA  P+L  DVWEHAYY+D++ +R  
Sbjct: 120 AVTQFGSGWAWLVTDSAGALSVVKTPNAETPIASGAGTPVLCCDVWEHAYYVDYRNQRPV 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+++F+  L+NW  V ERY  A
Sbjct: 180 YVDTFMDKLINWGKVEERYAAA 201


>gi|297622786|ref|YP_003704220.1| Superoxide dismutase [Truepera radiovictrix DSM 17093]
 gi|297163966|gb|ADI13677.1| Superoxide dismutase [Truepera radiovictrix DSM 17093]
          Length = 198

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/196 (45%), Positives = 118/196 (60%), Gaps = 3/196 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP+LPY  D L P++  +T+E HHD HH  Y           E+  LS+EEI+ K 
Sbjct: 1   MAFNLPDLPYPTDALEPHIDAKTMEIHHDKHHGTYTTKLNDAVQGTELEGLSIEEILRKG 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           +    A + NN   YYNHNLFW  +    G G+    L++AI  +FGSF  FK     AA
Sbjct: 61  AENLPAAVRNNGGGYYNHNLFWEWLSPQGG-GEPTGELAEAIARDFGSFAAFKEKFSEAA 119

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           + +FGSGW WL  +NGKL I+ T N +NP++ G   ILG+DVWEHAYYL ++ RR  YI+
Sbjct: 120 ANRFGSGWAWLVSENGKLSITSTPNQDNPMMEGKHAILGLDVWEHAYYLKYQNRRPEYIQ 179

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW  V E Y
Sbjct: 180 AFW-NVVNWPKVSELY 194


>gi|194434719|ref|ZP_03066972.1| superoxide dismutase [Shigella dysenteriae 1012]
 gi|194417057|gb|EDX33173.1| superoxide dismutase [Shigella dysenteriae 1012]
 gi|332093986|gb|EGI99039.1| superoxide dismutase [Shigella dysenteriae 155-74]
          Length = 193

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEDKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNTG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|170768862|ref|ZP_02903315.1| superoxide dismutase [Fe] [Escherichia albertii TW07627]
 gi|170122410|gb|EDS91341.1| superoxide dismutase [Fe] [Escherichia albertii TW07627]
          Length = 193

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 119/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGELADAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNW +V +
Sbjct: 176 EHFWA-LVNWAFVAK 189


>gi|329114583|ref|ZP_08243342.1| Superoxide dismutase [Acetobacter pomorum DM001]
 gi|326696063|gb|EGE47745.1| Superoxide dismutase [Acetobacter pomorum DM001]
          Length = 236

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 122/197 (61%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIII 58
           M F+LP LP++   L P  M  ETLEYHH  HH  Y +   KL  D  E    SLEEII+
Sbjct: 35  MAFELPALPFAPTALGPRGMCPETLEYHHGKHHLAYVNTLNKLLEDKPEFQGKSLEEIIL 94

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
            +HG     GLFNNA Q++NH+ FW C+  N G   +P+ L+  I  +FGS + FK +  
Sbjct: 95  AAHGKADLTGLFNNAGQHWNHSFFWNCLSPNGGV--MPEKLAAKIAADFGSIDTFKEEFR 152

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLING-AIPILGIDVWEHAYYLDFKYRR 174
            AA +QFGSGW WL + K+GKL I+KT N  NPL  G    +L +DVWEH+YYLDF+ RR
Sbjct: 153 KAAVSQFGSGWAWLVLGKDGKLAITKTPNGTNPLAEGQGKALLTVDVWEHSYYLDFRNRR 212

Query: 175 AHYIESFITNLVNWEYV 191
             Y+ +F+  L N+E+ 
Sbjct: 213 PDYVTNFLDKLANYEFA 229


>gi|56420992|ref|YP_148310.1| manganese superoxide dismutase [Geobacillus kaustophilus HTA426]
 gi|261417679|ref|YP_003251361.1| superoxide dismutase [Geobacillus sp. Y412MC61]
 gi|297529375|ref|YP_003670650.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           C56-T3]
 gi|319767515|ref|YP_004133016.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y412MC52]
 gi|134649|sp|P28760|SODM_BACCA RecName: Full=Superoxide dismutase [Mn]
 gi|7578509|gb|AAF64074.1|AF147780_1 superoxide dismutase [Geobacillus thermoleovorans]
 gi|39453|emb|CAA44556.1| Manganese superoxide dismutase [Bacillus caldotenax]
 gi|56380834|dbj|BAD76742.1| manganese superoxide dismutase [Geobacillus kaustophilus HTA426]
 gi|261374136|gb|ACX76879.1| Superoxide dismutase [Geobacillus sp. Y412MC61]
 gi|297252627|gb|ADI26073.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           C56-T3]
 gi|315361444|gb|ADU05414.1| Mn-sod [Geobacillus sp. POT5]
 gi|317112381|gb|ADU94873.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y412MC52]
 gi|384175|prf||1905285A superoxide dismutase
          Length = 204

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N    L    ++ + SLEE++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELAEAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 EYIAAFW-NIVNWDEVAKRYSEA 201


>gi|258542819|ref|YP_003188252.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-01]
 gi|256633897|dbj|BAH99872.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-01]
 gi|256636956|dbj|BAI02925.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-03]
 gi|256640009|dbj|BAI05971.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-07]
 gi|256643065|dbj|BAI09020.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-22]
 gi|256646120|dbj|BAI12068.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-26]
 gi|256649173|dbj|BAI15114.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-32]
 gi|256652160|dbj|BAI18094.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655217|dbj|BAI21144.1| superoxide dismutase SOD [Acetobacter pasteurianus IFO 3283-12]
          Length = 202

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 123/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIII 58
           M F+LP LP++   L+P  M  ETLEYHH  HH  Y +   KL  D  E    SLEEII+
Sbjct: 1   MAFELPALPFAPTALAPRGMCPETLEYHHGKHHLAYVNTLNKLLEDKPEFQGKSLEEIIL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
            +HG     GLFNNA Q++NH+ FW C+  N G   +P+ L+  I  +FGS + FK +  
Sbjct: 61  AAHGKADLTGLFNNAGQHWNHSFFWNCLSPNGGV--MPEKLAAKIASDFGSIDTFKEEFR 118

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLING-AIPILGIDVWEHAYYLDFKYRR 174
            AA +QFGSGW WL + K+GKL I+KT N  NPL  G    +L +DVWEH+YYLDF+ RR
Sbjct: 119 KAAVSQFGSGWAWLVLGKDGKLAITKTPNGTNPLAEGQGKALLTVDVWEHSYYLDFRNRR 178

Query: 175 AHYIESFITNLVNWEYV 191
             Y+ +F+  L N+E+ 
Sbjct: 179 PDYVTNFLDKLANYEFA 195


>gi|332161657|ref|YP_004298234.1| superoxide dismutase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318605851|emb|CBY27349.1| superoxide dismutase [Fe] [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665887|gb|ADZ42531.1| superoxide dismutase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330864090|emb|CBX74164.1| superoxide dismutase [Fe] [Yersinia enterocolitica W22703]
          Length = 192

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEI+  S
Sbjct: 1   MSFELPTLPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGQSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKSDGTLAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|283781947|ref|YP_003372702.1| superoxide dismutase [Pirellula staleyi DSM 6068]
 gi|283440400|gb|ADB18842.1| Superoxide dismutase [Pirellula staleyi DSM 6068]
          Length = 201

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 119/203 (58%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+ + L PY+  +T+E HH  HH+ Y  NA    + +E+  LS+E +I   
Sbjct: 1   MAFTLPALPYATNALEPYIDAKTMEIHHTKHHQAYITNANNALAGSELESLSVEALIADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDL 115
                   A + NNA  + NH+LFW  +    G G  P   L DAI   FGSF+ FK   
Sbjct: 61  SKVPENIRATVRNNAGGHANHSLFWTIL--GPGAGGTPSGELGDAITSTFGSFDTFKEAF 118

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A +T+FGSGW WLSV  GKL +  T N ++P++ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 119 AKAGATRFGSGWAWLSVSGGKLIVESTPNQDSPIMEGRTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW  V  R+  A
Sbjct: 179 DYIAAFW-NIVNWNEVARRFAAA 200


>gi|15802070|ref|NP_288092.1| superoxide dismutase [Escherichia coli O157:H7 EDL933]
 gi|15831619|ref|NP_310392.1| superoxide dismutase [Escherichia coli O157:H7 str. Sakai]
 gi|16129614|ref|NP_416173.1| superoxide dismutase, Fe [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24113046|ref|NP_707556.1| superoxide dismutase [Shigella flexneri 2a str. 301]
 gi|26247905|ref|NP_753945.1| superoxide dismutase [Escherichia coli CFT073]
 gi|30063172|ref|NP_837343.1| superoxide dismutase [Shigella flexneri 2a str. 2457T]
 gi|74312017|ref|YP_310436.1| superoxide dismutase [Shigella sonnei Ss046]
 gi|82543974|ref|YP_407921.1| superoxide dismutase [Shigella boydii Sb227]
 gi|82777132|ref|YP_403481.1| superoxide dismutase [Shigella dysenteriae Sd197]
 gi|89108498|ref|AP_002278.1| superoxide dismutase, Fe [Escherichia coli str. K-12 substr. W3110]
 gi|91210870|ref|YP_540856.1| superoxide dismutase [Escherichia coli UTI89]
 gi|110641777|ref|YP_669507.1| superoxide dismutase [Escherichia coli 536]
 gi|110805634|ref|YP_689154.1| superoxide dismutase [Shigella flexneri 5 str. 8401]
 gi|117623838|ref|YP_852751.1| superoxide dismutase [Escherichia coli APEC O1]
 gi|157154847|ref|YP_001462950.1| superoxide dismutase [Escherichia coli E24377A]
 gi|157161121|ref|YP_001458439.1| superoxide dismutase [Escherichia coli HS]
 gi|168752329|ref|ZP_02777351.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4113]
 gi|168758992|ref|ZP_02783999.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4401]
 gi|168771201|ref|ZP_02796208.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4486]
 gi|168775889|ref|ZP_02800896.1| superoxide dismutase (Fe) [Escherichia coli O157:H7 str. EC4196]
 gi|168783928|ref|ZP_02808935.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4076]
 gi|168790557|ref|ZP_02815564.1| superoxide dismutase [Escherichia coli O157:H7 str. EC869]
 gi|170019992|ref|YP_001724946.1| superoxide dismutase [Escherichia coli ATCC 8739]
 gi|170081319|ref|YP_001730639.1| superoxide dismutase, Fe [Escherichia coli str. K-12 substr. DH10B]
 gi|170683613|ref|YP_001743597.1| superoxide dismutase [Escherichia coli SMS-3-5]
 gi|187733707|ref|YP_001880416.1| superoxide dismutase [Shigella boydii CDC 3083-94]
 gi|188493216|ref|ZP_03000486.1| superoxide dismutase (Fe) [Escherichia coli 53638]
 gi|191165923|ref|ZP_03027760.1| superoxide dismutase [Escherichia coli B7A]
 gi|191173467|ref|ZP_03034995.1| superoxide dismutase [Escherichia coli F11]
 gi|193064932|ref|ZP_03046008.1| superoxide dismutase [Escherichia coli E22]
 gi|193070249|ref|ZP_03051193.1| superoxide dismutase [Escherichia coli E110019]
 gi|194426030|ref|ZP_03058586.1| superoxide dismutase [Escherichia coli B171]
 gi|194436433|ref|ZP_03068534.1| superoxide dismutase [Escherichia coli 101-1]
 gi|208810549|ref|ZP_03252425.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4206]
 gi|208816511|ref|ZP_03257631.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4045]
 gi|208818557|ref|ZP_03258877.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4042]
 gi|209399418|ref|YP_002270725.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4115]
 gi|209918971|ref|YP_002293055.1| superoxide dismutase [Escherichia coli SE11]
 gi|215486832|ref|YP_002329263.1| superoxide dismutase [Escherichia coli O127:H6 str. E2348/69]
 gi|217328858|ref|ZP_03444939.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14588]
 gi|218554224|ref|YP_002387137.1| superoxide dismutase [Escherichia coli IAI1]
 gi|218558527|ref|YP_002391440.1| superoxide dismutase [Escherichia coli S88]
 gi|218689601|ref|YP_002397813.1| superoxide dismutase [Escherichia coli ED1a]
 gi|218695219|ref|YP_002402886.1| superoxide dismutase [Escherichia coli 55989]
 gi|218705156|ref|YP_002412675.1| superoxide dismutase [Escherichia coli UMN026]
 gi|227885926|ref|ZP_04003731.1| superoxide dismutase [Escherichia coli 83972]
 gi|237705602|ref|ZP_04536083.1| superoxide dismutase [Escherichia sp. 3_2_53FAA]
 gi|238900872|ref|YP_002926668.1| superoxide dismutase, Fe [Escherichia coli BW2952]
 gi|253773385|ref|YP_003036216.1| superoxide dismutase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161718|ref|YP_003044826.1| superoxide dismutase [Escherichia coli B str. REL606]
 gi|254793274|ref|YP_003078111.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14359]
 gi|256018149|ref|ZP_05432014.1| superoxide dismutase [Shigella sp. D9]
 gi|260843962|ref|YP_003221740.1| superoxide dismutase SodB [Escherichia coli O103:H2 str. 12009]
 gi|260855481|ref|YP_003229372.1| superoxide dismutase SodB [Escherichia coli O26:H11 str. 11368]
 gi|260868148|ref|YP_003234550.1| superoxide dismutase SodB [Escherichia coli O111:H- str. 11128]
 gi|261227898|ref|ZP_05942179.1| superoxide dismutase, Fe [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258368|ref|ZP_05950901.1| superoxide dismutase SodB [Escherichia coli O157:H7 str. FRIK966]
 gi|291282788|ref|YP_003499606.1| Superoxide dismutase (Fe) [Escherichia coli O55:H7 str. CB9615]
 gi|293405156|ref|ZP_06649148.1| Fe-superoxide dismutase [Escherichia coli FVEC1412]
 gi|293414973|ref|ZP_06657616.1| Fe-superoxide dismutase [Escherichia coli B185]
 gi|293446032|ref|ZP_06662454.1| Fe-superoxide dismutase [Escherichia coli B088]
 gi|297520499|ref|ZP_06938885.1| superoxide dismutase [Escherichia coli OP50]
 gi|298380800|ref|ZP_06990399.1| Fe-superoxide dismutase [Escherichia coli FVEC1302]
 gi|300819586|ref|ZP_07099779.1| superoxide dismutase [Escherichia coli MS 107-1]
 gi|300821471|ref|ZP_07101618.1| superoxide dismutase [Escherichia coli MS 119-7]
 gi|300901534|ref|ZP_07119605.1| superoxide dismutase [Escherichia coli MS 198-1]
 gi|300904504|ref|ZP_07122345.1| superoxide dismutase [Escherichia coli MS 84-1]
 gi|300924689|ref|ZP_07140637.1| superoxide dismutase [Escherichia coli MS 182-1]
 gi|300930875|ref|ZP_07146244.1| superoxide dismutase [Escherichia coli MS 187-1]
 gi|300939024|ref|ZP_07153719.1| superoxide dismutase [Escherichia coli MS 21-1]
 gi|300951244|ref|ZP_07165096.1| superoxide dismutase [Escherichia coli MS 116-1]
 gi|300958532|ref|ZP_07170665.1| superoxide dismutase [Escherichia coli MS 175-1]
 gi|300987871|ref|ZP_07178422.1| superoxide dismutase [Escherichia coli MS 200-1]
 gi|300995385|ref|ZP_07181065.1| superoxide dismutase [Escherichia coli MS 45-1]
 gi|301026840|ref|ZP_07190240.1| superoxide dismutase [Escherichia coli MS 69-1]
 gi|301027668|ref|ZP_07190984.1| superoxide dismutase [Escherichia coli MS 196-1]
 gi|301051015|ref|ZP_07197859.1| superoxide dismutase [Escherichia coli MS 185-1]
 gi|301303170|ref|ZP_07209296.1| superoxide dismutase [Escherichia coli MS 124-1]
 gi|301326582|ref|ZP_07219921.1| superoxide dismutase [Escherichia coli MS 78-1]
 gi|301647837|ref|ZP_07247621.1| superoxide dismutase [Escherichia coli MS 146-1]
 gi|306813379|ref|ZP_07447569.1| superoxide dismutase [Escherichia coli NC101]
 gi|307138313|ref|ZP_07497669.1| superoxide dismutase [Escherichia coli H736]
 gi|307310771|ref|ZP_07590417.1| Superoxide dismutase [Escherichia coli W]
 gi|309788375|ref|ZP_07682979.1| superoxide dismutase [Fe] [Shigella dysenteriae 1617]
 gi|309793422|ref|ZP_07687849.1| superoxide dismutase [Escherichia coli MS 145-7]
 gi|312966580|ref|ZP_07780800.1| superoxide dismutase [Fe] [Escherichia coli 2362-75]
 gi|312969679|ref|ZP_07783862.1| superoxide dismutase [Fe] [Escherichia coli 1827-70]
 gi|331642251|ref|ZP_08343386.1| superoxide dismutase [Fe] [Escherichia coli H736]
 gi|331647145|ref|ZP_08348239.1| superoxide dismutase [Fe] [Escherichia coli M605]
 gi|331653053|ref|ZP_08354058.1| superoxide dismutase [Fe] [Escherichia coli M718]
 gi|331657630|ref|ZP_08358592.1| superoxide dismutase [Fe] [Escherichia coli TA206]
 gi|331663132|ref|ZP_08364042.1| superoxide dismutase [Fe] [Escherichia coli TA143]
 gi|331673220|ref|ZP_08373988.1| superoxide dismutase [Fe] [Escherichia coli TA280]
 gi|331677526|ref|ZP_08378201.1| superoxide dismutase [Fe] [Escherichia coli H591]
 gi|331683164|ref|ZP_08383765.1| superoxide dismutase [Fe] [Escherichia coli H299]
 gi|332279195|ref|ZP_08391608.1| superoxide dismutase [Shigella sp. D9]
 gi|84028732|sp|P0AGD5|SODF_ECO57 RecName: Full=Superoxide dismutase [Fe]
 gi|84028733|sp|P0AGD4|SODF_ECOL6 RecName: Full=Superoxide dismutase [Fe]
 gi|84028734|sp|P0AGD3|SODF_ECOLI RecName: Full=Superoxide dismutase [Fe]
 gi|84028735|sp|P0AGD6|SODF_SHIFL RecName: Full=Superoxide dismutase [Fe]
 gi|12515654|gb|AAG56645.1|AE005389_1 superoxide dismutase, iron [Escherichia coli O157:H7 str. EDL933]
 gi|26108308|gb|AAN80510.1|AE016761_85 Superoxide dismutase (Fe) [Escherichia coli CFT073]
 gi|147842|gb|AAA24637.1| superoxide dismutase (sodB) [Escherichia coli]
 gi|1742729|dbj|BAA15422.1| superoxide dismutase, Fe [Escherichia coli str. K12 substr. W3110]
 gi|1787946|gb|AAC74728.1| superoxide dismutase, Fe [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13361832|dbj|BAB35788.1| superoxide dismutase [Escherichia coli O157:H7 str. Sakai]
 gi|24052016|gb|AAN43263.1| superoxide dismutase [Shigella flexneri 2a str. 301]
 gi|30041424|gb|AAP17152.1| superoxide dismutase [Shigella flexneri 2a str. 2457T]
 gi|73855494|gb|AAZ88201.1| superoxide dismutase, iron [Shigella sonnei Ss046]
 gi|81241280|gb|ABB61990.1| superoxide dismutase, iron [Shigella dysenteriae Sd197]
 gi|81245385|gb|ABB66093.1| superoxide dismutase, iron [Shigella boydii Sb227]
 gi|91072444|gb|ABE07325.1| superoxide dismutase, iron [Escherichia coli UTI89]
 gi|110343369|gb|ABG69606.1| superoxide dismutase [Escherichia coli 536]
 gi|110615182|gb|ABF03849.1| superoxide dismutase, iron [Shigella flexneri 5 str. 8401]
 gi|115512962|gb|ABJ01037.1| superoxide dismutase [Escherichia coli APEC O1]
 gi|157066801|gb|ABV06056.1| superoxide dismutase (Fe) [Escherichia coli HS]
 gi|157076877|gb|ABV16585.1| superoxide dismutase (Fe) [Escherichia coli E24377A]
 gi|169754920|gb|ACA77619.1| Superoxide dismutase [Escherichia coli ATCC 8739]
 gi|169889154|gb|ACB02861.1| superoxide dismutase, Fe [Escherichia coli str. K-12 substr. DH10B]
 gi|170521331|gb|ACB19509.1| superoxide dismutase (Fe) [Escherichia coli SMS-3-5]
 gi|187430699|gb|ACD09973.1| superoxide dismutase (Fe) [Shigella boydii CDC 3083-94]
 gi|187768669|gb|EDU32513.1| superoxide dismutase (Fe) [Escherichia coli O157:H7 str. EC4196]
 gi|188013801|gb|EDU51923.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4113]
 gi|188488415|gb|EDU63518.1| superoxide dismutase (Fe) [Escherichia coli 53638]
 gi|188998799|gb|EDU67785.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4076]
 gi|189354315|gb|EDU72734.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4401]
 gi|189360003|gb|EDU78422.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4486]
 gi|189370005|gb|EDU88421.1| superoxide dismutase [Escherichia coli O157:H7 str. EC869]
 gi|190904054|gb|EDV63766.1| superoxide dismutase [Escherichia coli B7A]
 gi|190906309|gb|EDV65920.1| superoxide dismutase [Escherichia coli F11]
 gi|192927419|gb|EDV82037.1| superoxide dismutase [Escherichia coli E22]
 gi|192956430|gb|EDV86889.1| superoxide dismutase [Escherichia coli E110019]
 gi|194416085|gb|EDX32351.1| superoxide dismutase [Escherichia coli B171]
 gi|194424465|gb|EDX40451.1| superoxide dismutase [Escherichia coli 101-1]
 gi|208725065|gb|EDZ74772.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4206]
 gi|208730854|gb|EDZ79543.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4045]
 gi|208738680|gb|EDZ86362.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4042]
 gi|209160818|gb|ACI38251.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4115]
 gi|209769398|gb|ACI83011.1| superoxide dismutase [Escherichia coli]
 gi|209769400|gb|ACI83012.1| superoxide dismutase [Escherichia coli]
 gi|209769402|gb|ACI83013.1| superoxide dismutase [Escherichia coli]
 gi|209769404|gb|ACI83014.1| superoxide dismutase [Escherichia coli]
 gi|209769406|gb|ACI83015.1| superoxide dismutase [Escherichia coli]
 gi|209912230|dbj|BAG77304.1| superoxide dismutase [Escherichia coli SE11]
 gi|215264904|emb|CAS09290.1| superoxide dismutase, Fe [Escherichia coli O127:H6 str. E2348/69]
 gi|217318205|gb|EEC26632.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14588]
 gi|218351951|emb|CAU97683.1| superoxide dismutase, Fe [Escherichia coli 55989]
 gi|218360992|emb|CAQ98565.1| superoxide dismutase, Fe [Escherichia coli IAI1]
 gi|218365296|emb|CAR03017.1| superoxide dismutase, Fe [Escherichia coli S88]
 gi|218427165|emb|CAR08048.2| superoxide dismutase, Fe [Escherichia coli ED1a]
 gi|218432253|emb|CAR13143.1| superoxide dismutase, Fe [Escherichia coli UMN026]
 gi|222033414|emb|CAP76155.1| Superoxide dismutase [Fe] [Escherichia coli LF82]
 gi|226900359|gb|EEH86618.1| superoxide dismutase [Escherichia sp. 3_2_53FAA]
 gi|227837105|gb|EEJ47571.1| superoxide dismutase [Escherichia coli 83972]
 gi|238863610|gb|ACR65608.1| superoxide dismutase, Fe [Escherichia coli BW2952]
 gi|242377386|emb|CAQ32133.1| superoxide dismutase (Fe) [Escherichia coli BL21(DE3)]
 gi|253324429|gb|ACT29031.1| Superoxide dismutase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973619|gb|ACT39290.1| superoxide dismutase, Fe [Escherichia coli B str. REL606]
 gi|253977814|gb|ACT43484.1| superoxide dismutase, Fe [Escherichia coli BL21(DE3)]
 gi|254592674|gb|ACT72035.1| superoxide dismutase, Fe [Escherichia coli O157:H7 str. TW14359]
 gi|257754130|dbj|BAI25632.1| superoxide dismutase SodB [Escherichia coli O26:H11 str. 11368]
 gi|257759109|dbj|BAI30606.1| superoxide dismutase SodB [Escherichia coli O103:H2 str. 12009]
 gi|257764504|dbj|BAI35999.1| superoxide dismutase SodB [Escherichia coli O111:H- str. 11128]
 gi|260449219|gb|ACX39641.1| Superoxide dismutase [Escherichia coli DH1]
 gi|281601093|gb|ADA74077.1| Superoxide dismutase(Fe) [Shigella flexneri 2002017]
 gi|284921580|emb|CBG34652.1| superoxide dismutase [Fe] [Escherichia coli 042]
 gi|290762661|gb|ADD56622.1| Superoxide dismutase (Fe) [Escherichia coli O55:H7 str. CB9615]
 gi|291322862|gb|EFE62290.1| Fe-superoxide dismutase [Escherichia coli B088]
 gi|291427364|gb|EFF00391.1| Fe-superoxide dismutase [Escherichia coli FVEC1412]
 gi|291432621|gb|EFF05600.1| Fe-superoxide dismutase [Escherichia coli B185]
 gi|294489937|gb|ADE88693.1| superoxide dismutase (Fe) [Escherichia coli IHE3034]
 gi|298278242|gb|EFI19756.1| Fe-superoxide dismutase [Escherichia coli FVEC1302]
 gi|299879211|gb|EFI87422.1| superoxide dismutase [Escherichia coli MS 196-1]
 gi|300297310|gb|EFJ53695.1| superoxide dismutase [Escherichia coli MS 185-1]
 gi|300306019|gb|EFJ60539.1| superoxide dismutase [Escherichia coli MS 200-1]
 gi|300314806|gb|EFJ64590.1| superoxide dismutase [Escherichia coli MS 175-1]
 gi|300355064|gb|EFJ70934.1| superoxide dismutase [Escherichia coli MS 198-1]
 gi|300395280|gb|EFJ78818.1| superoxide dismutase [Escherichia coli MS 69-1]
 gi|300403570|gb|EFJ87108.1| superoxide dismutase [Escherichia coli MS 84-1]
 gi|300406146|gb|EFJ89684.1| superoxide dismutase [Escherichia coli MS 45-1]
 gi|300419116|gb|EFK02427.1| superoxide dismutase [Escherichia coli MS 182-1]
 gi|300449482|gb|EFK13102.1| superoxide dismutase [Escherichia coli MS 116-1]
 gi|300456052|gb|EFK19545.1| superoxide dismutase [Escherichia coli MS 21-1]
 gi|300461291|gb|EFK24784.1| superoxide dismutase [Escherichia coli MS 187-1]
 gi|300525974|gb|EFK47043.1| superoxide dismutase [Escherichia coli MS 119-7]
 gi|300527834|gb|EFK48896.1| superoxide dismutase [Escherichia coli MS 107-1]
 gi|300841579|gb|EFK69339.1| superoxide dismutase [Escherichia coli MS 124-1]
 gi|300846744|gb|EFK74504.1| superoxide dismutase [Escherichia coli MS 78-1]
 gi|301074027|gb|EFK88833.1| superoxide dismutase [Escherichia coli MS 146-1]
 gi|305853124|gb|EFM53564.1| superoxide dismutase [Escherichia coli NC101]
 gi|306908949|gb|EFN39445.1| Superoxide dismutase [Escherichia coli W]
 gi|307553678|gb|ADN46453.1| superoxide dismutase, iron [Escherichia coli ABU 83972]
 gi|307626857|gb|ADN71161.1| superoxide dismutase [Escherichia coli UM146]
 gi|308123009|gb|EFO60271.1| superoxide dismutase [Escherichia coli MS 145-7]
 gi|308923757|gb|EFP69260.1| superoxide dismutase [Fe] [Shigella dysenteriae 1617]
 gi|309701883|emb|CBJ01195.1| superoxide dismutase [Fe] [Escherichia coli ETEC H10407]
 gi|310337964|gb|EFQ03053.1| superoxide dismutase [Fe] [Escherichia coli 1827-70]
 gi|312288690|gb|EFR16590.1| superoxide dismutase [Fe] [Escherichia coli 2362-75]
 gi|312946257|gb|ADR27084.1| superoxide dismutase [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648937|gb|EFS13374.1| superoxide dismutase [Shigella flexneri 2a str. 2457T]
 gi|315060963|gb|ADT75290.1| superoxide dismutase, Fe [Escherichia coli W]
 gi|315136298|dbj|BAJ43457.1| superoxide dismutase, Fe [Escherichia coli DH1]
 gi|315257542|gb|EFU37510.1| superoxide dismutase [Escherichia coli MS 85-1]
 gi|315286353|gb|EFU45789.1| superoxide dismutase [Escherichia coli MS 110-3]
 gi|315290562|gb|EFU49936.1| superoxide dismutase [Escherichia coli MS 153-1]
 gi|315299701|gb|EFU58943.1| superoxide dismutase [Escherichia coli MS 16-3]
 gi|315618849|gb|EFU99432.1| superoxide dismutase [Fe] [Escherichia coli 3431]
 gi|320174134|gb|EFW49299.1| Fe-uperoxide dismutase [Shigella dysenteriae CDC 74-1112]
 gi|320181320|gb|EFW56239.1| Fe-superoxide dismutase [Shigella boydii ATCC 9905]
 gi|320183526|gb|EFW58374.1| Fe-superoxide dismutase [Shigella flexneri CDC 796-83]
 gi|320188344|gb|EFW63006.1| Fe-superoxide dismutase [Escherichia coli O157:H7 str. EC1212]
 gi|320195447|gb|EFW70072.1| Fe-superoxide dismutase [Escherichia coli WV_060327]
 gi|320197839|gb|EFW72447.1| Fe-superoxide dismutase [Escherichia coli EC4100B]
 gi|320642011|gb|EFX11375.1| superoxide dismutase [Escherichia coli O157:H7 str. G5101]
 gi|320647328|gb|EFX16136.1| superoxide dismutase [Escherichia coli O157:H- str. 493-89]
 gi|320652622|gb|EFX20891.1| superoxide dismutase [Escherichia coli O157:H- str. H 2687]
 gi|320653008|gb|EFX21204.1| superoxide dismutase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658691|gb|EFX26368.1| superoxide dismutase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668681|gb|EFX35486.1| superoxide dismutase [Escherichia coli O157:H7 str. LSU-61]
 gi|323152837|gb|EFZ39107.1| superoxide dismutase [Escherichia coli EPECa14]
 gi|323163494|gb|EFZ49320.1| superoxide dismutase [Escherichia coli E128010]
 gi|323169220|gb|EFZ54896.1| superoxide dismutase [Shigella sonnei 53G]
 gi|323169967|gb|EFZ55623.1| superoxide dismutase [Escherichia coli LT-68]
 gi|323180972|gb|EFZ66510.1| superoxide dismutase [Escherichia coli 1180]
 gi|323186070|gb|EFZ71426.1| superoxide dismutase [Escherichia coli 1357]
 gi|323187082|gb|EFZ72398.1| superoxide dismutase [Escherichia coli RN587/1]
 gi|323378466|gb|ADX50734.1| Superoxide dismutase [Escherichia coli KO11]
 gi|323937261|gb|EGB33540.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E1520]
 gi|323940676|gb|EGB36867.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E482]
 gi|323948047|gb|EGB44039.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H120]
 gi|323952165|gb|EGB48038.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H252]
 gi|323956667|gb|EGB52404.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H263]
 gi|323962149|gb|EGB57744.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H489]
 gi|323968424|gb|EGB63830.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli M863]
 gi|323973963|gb|EGB69135.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli TA007]
 gi|323978205|gb|EGB73291.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli TW10509]
 gi|324007013|gb|EGB76232.1| superoxide dismutase [Escherichia coli MS 57-2]
 gi|324011420|gb|EGB80639.1| superoxide dismutase [Escherichia coli MS 60-1]
 gi|324119142|gb|EGC13030.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E1167]
 gi|326342023|gb|EGD65804.1| Fe-superoxide dismutase [Escherichia coli O157:H7 str. 1044]
 gi|326343575|gb|EGD67337.1| Fe-superoxide dismutase [Escherichia coli O157:H7 str. 1125]
 gi|327252773|gb|EGE64427.1| superoxide dismutase [Escherichia coli STEC_7v]
 gi|330911463|gb|EGH39973.1| superoxide dismutase (Fe) [Escherichia coli AA86]
 gi|331039049|gb|EGI11269.1| superoxide dismutase [Fe] [Escherichia coli H736]
 gi|331043928|gb|EGI16064.1| superoxide dismutase [Fe] [Escherichia coli M605]
 gi|331049151|gb|EGI21223.1| superoxide dismutase [Fe] [Escherichia coli M718]
 gi|331055878|gb|EGI27887.1| superoxide dismutase [Fe] [Escherichia coli TA206]
 gi|331058931|gb|EGI30908.1| superoxide dismutase [Fe] [Escherichia coli TA143]
 gi|331069418|gb|EGI40805.1| superoxide dismutase [Fe] [Escherichia coli TA280]
 gi|331073986|gb|EGI45306.1| superoxide dismutase [Fe] [Escherichia coli H591]
 gi|331079379|gb|EGI50576.1| superoxide dismutase [Fe] [Escherichia coli H299]
 gi|332096044|gb|EGJ01049.1| superoxide dismutase [Shigella boydii 3594-74]
 gi|332101547|gb|EGJ04893.1| superoxide dismutase [Shigella sp. D9]
 gi|332343375|gb|AEE56709.1| superoxide dismutase [Escherichia coli UMNK88]
 gi|332756974|gb|EGJ87317.1| superoxide dismutase [Shigella flexneri 4343-70]
 gi|332757772|gb|EGJ88101.1| superoxide dismutase [Shigella flexneri 2747-71]
 gi|332758496|gb|EGJ88817.1| superoxide dismutase [Shigella flexneri K-671]
 gi|332766859|gb|EGJ97059.1| sodB [Shigella flexneri 2930-71]
 gi|333003886|gb|EGK23421.1| superoxide dismutase [Shigella flexneri K-218]
 gi|333005315|gb|EGK24835.1| superoxide dismutase [Shigella flexneri VA-6]
 gi|333005895|gb|EGK25411.1| superoxide dismutase [Shigella flexneri K-272]
 gi|333017939|gb|EGK37244.1| superoxide dismutase [Shigella flexneri K-304]
 gi|333018860|gb|EGK38153.1| superoxide dismutase [Shigella flexneri K-227]
          Length = 193

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|227519125|ref|ZP_03949174.1| superoxide dismutase, Mn [Enterococcus faecalis TX0104]
 gi|227073473|gb|EEI11436.1| superoxide dismutase, Mn [Enterococcus faecalis TX0104]
          Length = 202

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNTIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFVAA 201


>gi|33439120|gb|AAQ18699.1| iron superoxide dismutase [Solanum lycopersicum]
          Length = 249

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 123/200 (61%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F L   PY  D L P+MS  T E+H   +H+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 49  FDLIPPPYPMDALEPHMSSRTFEFHWGKYHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 108

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + A L  FNNA+Q +NH  FW  MK N G G+    L + I+ +FGS++ F  +   AA+
Sbjct: 109 NGAPLPAFNNAAQAWNHQFFWESMKPNGG-GEPSGELLELINRDFGSYDTFVKEFKAAAA 167

Query: 121 TQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K  + KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 168 TQFGSGWAWLAYKPEDKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 227

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 228 SIFMEKLVSWEAVSIRLKAA 247


>gi|237748841|ref|ZP_04579321.1| superoxide dismutase [Oxalobacter formigenes OXCC13]
 gi|229380203|gb|EEO30294.1| superoxide dismutase [Oxalobacter formigenes OXCC13]
          Length = 192

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/196 (45%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D L PY+S+ETLEYH+  HH+ Y +N      + E  ++ LEEI+ KS
Sbjct: 1   MEHKLPPLPYPMDALQPYISQETLEYHYGKHHQTYVNNLNNQIKNTEFENMPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W CMK N G GK    L DAI   +G+FE F+     A +
Sbjct: 61  SG---GIFNNAAQDWNHTFYWNCMKPNGG-GKPAGKLLDAIVAKWGTFEDFQKAYGQACA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           + FGSGW WL  K +G ++I  T NA  PL     P+L  DVWEHAYY+D++  R  Y++
Sbjct: 117 SNFGSGWTWLVKKPDGSVDIVNTSNAATPLTGADKPLLTCDVWEHAYYIDYRNARVKYVD 176

Query: 180 SFITNLVNWEYVCERY 195
            F  N+VNW++V   Y
Sbjct: 177 EFW-NVVNWDFVVSNY 191


>gi|29375094|ref|NP_814247.1| superoxide dismutase, Mn [Enterococcus faecalis V583]
 gi|227553829|ref|ZP_03983878.1| Mn superoxide dismutase [Enterococcus faecalis HH22]
 gi|56404874|sp|Q838I4|SODM_ENTFA RecName: Full=Superoxide dismutase [Fe]
 gi|29342553|gb|AAO80318.1| superoxide dismutase, Mn [Enterococcus faecalis V583]
 gi|227177082|gb|EEI58054.1| Mn superoxide dismutase [Enterococcus faecalis HH22]
 gi|315574928|gb|EFU87119.1| superoxide dismutase, Mn [Enterococcus faecalis TX0309B]
 gi|315582183|gb|EFU94374.1| superoxide dismutase, Mn [Enterococcus faecalis TX0309A]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVENLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|229547650|ref|ZP_04436375.1| Mn superoxide dismutase [Enterococcus faecalis TX1322]
 gi|256852436|ref|ZP_05557812.1| superoxide dismutase [Enterococcus faecalis T8]
 gi|229307142|gb|EEN73129.1| Mn superoxide dismutase [Enterococcus faecalis TX1322]
 gi|256712290|gb|EEU27322.1| superoxide dismutase [Enterococcus faecalis T8]
 gi|315028409|gb|EFT40341.1| superoxide dismutase, Mn [Enterococcus faecalis TX4000]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKYPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|255973529|ref|ZP_05424115.1| manganese superoxide dismutase [Enterococcus faecalis T2]
 gi|307282801|ref|ZP_07563001.1| superoxide dismutase, Mn [Enterococcus faecalis TX0860]
 gi|255966401|gb|EET97023.1| manganese superoxide dismutase [Enterococcus faecalis T2]
 gi|306503657|gb|EFM72888.1| superoxide dismutase, Mn [Enterococcus faecalis TX0860]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAG-GQPNGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|227251|prf||1617125A Fe superoxide dismutase
          Length = 191

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 126/197 (63%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L +LPY+ D L+P +SKET+E+HH+ H K Y DN  KL    E  +  L  I+ KS
Sbjct: 1   MTHELISLPYAVDALAPVISKETVEFHHEKHLKTYVDNLNKLIIGTEFENADLNTIVQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
            G   G+FNNA Q  NHNL++   +   GKG  P+  L +AID  FGSFEKFK +  TA 
Sbjct: 61  EG---GIFNNAGQTLNHNLYFTQFRP--GKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAG 115

Query: 120 STQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +T FGSGW WL S  NGKL I K  NA NP+  G  P+LG DVWEHAYYL ++ RRA ++
Sbjct: 116 TTLFGSGWVWLASDANGKLSIEKEPNAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHL 175

Query: 179 ESFITNLVNWEYVCERY 195
           +  + ++V+W+ V  RY
Sbjct: 176 KD-LWSIVDWDIVESRY 191


>gi|256022680|ref|ZP_05436545.1| superoxide dismutase [Escherichia sp. 4_1_40B]
          Length = 193

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE++ +
Sbjct: 176 EHFWA-LVNWEFIAK 189


>gi|126725467|ref|ZP_01741309.1| Superoxide dismutase [Rhodobacterales bacterium HTCC2150]
 gi|126704671|gb|EBA03762.1| Superoxide dismutase [Rhodobacterales bacterium HTCC2150]
          Length = 199

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 127/201 (63%), Gaps = 10/201 (4%)

Query: 1   MDFKLPNLPYSYDDLSP-YMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F LP+LPY++D L+   MS ET+E+HHD+HH  Y  N     +  E    SLE+II  
Sbjct: 1   MAFTLPDLPYAHDALAADGMSAETMEFHHDLHHNAYVTNGNAAIAGTEWEGKSLEDIITG 60

Query: 60  SHGSNA----GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           ++ +++    G+FNN SQ +NHN FW  M    G   +P  L  A++++FGS ++FK   
Sbjct: 61  TYDASSVAQNGIFNNISQLWNHNQFWEMMSP--GASAMPSELEAALNESFGSVDEFKKQF 118

Query: 116 ITAASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
             A + QFGSGW WL VK+  G L+++KT+N  NPL  G   +LG DVWEH+YY+DF+ +
Sbjct: 119 SAAGAGQFGSGWCWL-VKDTDGGLKVTKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNK 177

Query: 174 RAHYIESFITNLVNWEYVCER 194
           R  Y+ +F+ NLVNWE V  R
Sbjct: 178 RPVYLTNFLDNLVNWENVASR 198


>gi|114797796|ref|YP_759425.1| superoxide dismutase, Fe [Hyphomonas neptunium ATCC 15444]
 gi|114737970|gb|ABI76095.1| superoxide dismutase, Fe [Hyphomonas neptunium ATCC 15444]
          Length = 220

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 126/196 (64%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ + L+P++S+ETL +H+  HH+ Y  N   L    ++   SLEEII  S
Sbjct: 19  MAFTLPELPYARNALAPHISEETLNFHYGKHHQAYVTNLNGLVEGTDLAGKSLEEIIKIS 78

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNN++Q +NH  +W  MK   G     +A ++ I+ + G ++ F  +   A
Sbjct: 79  AADKSKAGIFNNSAQVWNHTFYWHSMKPGGGGKPHGKA-AELIERDLGGYDAFVKEFKQA 137

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WLS K GKL ISKT NAE PL   G  P++ +DVWEHAYYLD++ RR  Y
Sbjct: 138 GATQFGSGWAWLSYKGGKLVISKTPNAETPLTEEGTTPLMTMDVWEHAYYLDYQNRRPDY 197

Query: 178 IESFITNLVNWEYVCE 193
           I++F+ +LVNW++V +
Sbjct: 198 IDTFLGSLVNWDFVNQ 213


>gi|117620827|ref|YP_855942.1| superoxide dismutase (Fe) [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|16588764|gb|AAL26891.1|AF317227_1 superoxide dismutase FeSOD [Aeromonas hydrophila]
 gi|117562234|gb|ABK39182.1| superoxide dismutase (Fe) [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 194

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S
Sbjct: 1   MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI   FGSF +FK     +A 
Sbjct: 61  TG---GIFNNAAQIWNHTFYWHCLSPNGG-GEPTGALADAITKAFGSFAEFKDAFTKSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 GNFGSSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYM 176

Query: 179 ESFITNLVNWEYVCE 193
           E+F T LVNWE+V +
Sbjct: 177 ETFWT-LVNWEFVAK 190


>gi|238762492|ref|ZP_04623462.1| Superoxide dismutase [Fe] [Yersinia kristensenii ATCC 33638]
 gi|238699137|gb|EEP91884.1| Superoxide dismutase [Fe] [Yersinia kristensenii ATCC 33638]
          Length = 192

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/192 (46%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEII  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  SG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGALAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|121604829|ref|YP_982158.1| superoxide dismutase [Polaromonas naphthalenivorans CJ2]
 gi|120593798|gb|ABM37237.1| Superoxide dismutase [Polaromonas naphthalenivorans CJ2]
          Length = 193

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 120/192 (62%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E   ++LEEII KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFESMTLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NN++Q +NH  FW CMK   G G+   AL++AI+  FGS+  FK   + +A 
Sbjct: 61  SG---GVYNNSAQVWNHTFFWNCMKPAGG-GEPSGALAEAINAKFGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKPDGTVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYV 191
           +F+++LVNWE+ 
Sbjct: 177 TFLSSLVNWEFA 188


>gi|323490090|ref|ZP_08095311.1| superoxide dismutase (Mn) [Planococcus donghaensis MPA1U2]
 gi|323396386|gb|EGA89211.1| superoxide dismutase (Mn) [Planococcus donghaensis MPA1U2]
          Length = 202

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N    L    ++   S+EE+I  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYITNVNAALEGHEDLASKSVEELIAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  + G G    AL +AI+  FGSF++FK   
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWKLLSPSGG-GNPTGALGEAINSKFGSFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A  T+FGSGW WL + NG+LE+  T N ++PL+ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AAAGKTRFGSGWAWLVLSNGELEVVSTPNQDSPLMEGKTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V  RYETA
Sbjct: 180 DYINAFW-NVVNWEEVSNRYETA 201


>gi|119356810|ref|YP_911454.1| superoxide dismutase [Chlorobium phaeobacteroides DSM 266]
 gi|119354159|gb|ABL65030.1| Superoxide dismutase [Chlorobium phaeobacteroides DSM 266]
          Length = 200

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+ + L PY+S  T+ +H+  HH  Y  N   L ++  +  +++EE+II +
Sbjct: 1   MAYQQPPLPYADNALEPYISATTIGFHYGKHHATYITNYNNLVANTPLDAMTIEEVIIAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                  G+FNN +Q +NH+ +W  +   DG G+    L++ I+ + G F+KF+ +L  A
Sbjct: 61  ANDPQKIGIFNNGAQAWNHSFYWNSLSP-DGGGEPGGILAEKINTDLGGFDKFREELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+I KT NA  PL +G  P+L +DVWEHAYYLD++ RR  Y+
Sbjct: 120 ATTQFGSGWAWLVLDNGVLKIVKTANAGTPLTSGQTPLLAVDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I +L+NWE+  + +  A
Sbjct: 180 STTIEHLLNWEFAEKNFLAA 199


>gi|300870465|ref|YP_003785336.1| superoxide dismutase [Brachyspira pilosicoli 95/1000]
 gi|300688164|gb|ADK30835.1| superoxide dismutase [Brachyspira pilosicoli 95/1000]
          Length = 198

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 121/199 (60%), Gaps = 6/199 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKSH 61
           F+L  LPY  +DL+PYMS  TL++HH  H   Y      L S D  +   S+EE+I+ SH
Sbjct: 2   FELMKLPYGKEDLAPYMSSNTLDFHHGKHLNAYVTTVNDLVSKDKSLEGKSIEELILLSH 61

Query: 62  GSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
            ++    LFNNA Q YNH  F+  +KK+     +P  +   I+ +FGSF+ FK    T  
Sbjct: 62  NNSEKQALFNNAGQVYNHEEFFKMLKKDVA---IPAEVKSKIEADFGSFDAFKEAFTTGG 118

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            TQFGSGW WL + NGKLE+ K  NA NP+ +    +L  DVWEHAYYLD++ RR  ++ 
Sbjct: 119 KTQFGSGWVWLVLNNGKLEVRKYANAMNPIADKVHGVLTCDVWEHAYYLDYQNRRPDFLT 178

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+ +LVNW+YV ER   A
Sbjct: 179 TFVEHLVNWDYVAERLNKA 197


>gi|229543843|ref|ZP_04432902.1| Superoxide dismutase [Bacillus coagulans 36D1]
 gi|229324982|gb|EEN90658.1| Superoxide dismutase [Bacillus coagulans 36D1]
          Length = 202

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 95/203 (46%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+ KET+  HH  HH  Y  N  K L    ++   S+E++I  
Sbjct: 1   MTYTLPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNKALEGHDDLASKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH+LFW  +  N G G+   AL DAI+  FGSFEKFK   
Sbjct: 61  LNAVPEEIRTAVRNNGGGHANHSLFWTLLSPNGG-GEPKGALLDAINSKFGSFEKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N +NPL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGELEITSTPNQDNPLSEGKKPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V + YE A
Sbjct: 180 EYISAFW-NVVNWDEVEKLYEAA 201


>gi|253997562|ref|YP_003049626.1| Superoxide dismutase [Methylotenera mobilis JLW8]
 gi|253984241|gb|ACT49099.1| Superoxide dismutase [Methylotenera mobilis JLW8]
          Length = 193

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 124/196 (63%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ +LP LPY+ D L P++S ET+EYH+  HH+ Y  N   L    E  +LSLEEII K 
Sbjct: 1   MEHQLPALPYAQDALVPHISVETIEYHYGKHHQTYVTNLNNLIKGTEFENLSLEEIIKK- 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S+AG++NN++Q +NH  FW+ MK N G G    AL+DAI+  +GSF++FK     +A 
Sbjct: 60  --SSAGIYNNSAQIWNHTFFWSSMKPNGG-GAPTGALADAINAKWGSFDEFKKAFQASAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G   +L IDVWEHAYY+D++  RA ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLTIDVWEHAYYIDYRNARAKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
            F+T+L NW++    +
Sbjct: 177 VFLTSLANWDFAAANF 192


>gi|123442418|ref|YP_001006397.1| superoxide dismutase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089379|emb|CAL12227.1| superoxide dismutase [Fe] [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 192

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEI+  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKTDGTLAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|183219454|ref|YP_001837450.1| superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189909599|ref|YP_001961154.1| superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|106879732|emb|CAJ90435.1| superoxide dismutase-[Fe] [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|167774275|gb|ABZ92576.1| Superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167777876|gb|ABZ96174.1| Superoxide dismutase (Fe) [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 190

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 119/191 (62%), Gaps = 5/191 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P++S ETLE+H+  HH+ Y  N   L    E    SLE+I+ KS
Sbjct: 1   MEHKLPELPYAKDALAPHISAETLEFHYGKHHQTYITNLNNLIKGTEFESASLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G    A++D I  +FGSF+ FK     +A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHSLSPNGG-GAPKGAVADLITKSFGSFDAFKEKFTQSAV 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           T FGSGW WL  K   LEI  T NA +PL +G   +L IDVWEHAYY+DF+  R  Y+E+
Sbjct: 117 TNFGSGWTWLVKKGDGLEIVNTSNAGSPLKDGMQALLTIDVWEHAYYIDFRNARPKYVEA 176

Query: 181 FITNLVNWEYV 191
           F  NLVNW++ 
Sbjct: 177 FW-NLVNWDFA 186


>gi|226355653|ref|YP_002785393.1| superoxide dismutase [Deinococcus deserti VCD115]
 gi|226317643|gb|ACO45639.1| putative superoxide dismutase [Deinococcus deserti VCD115]
          Length = 207

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 124/208 (59%), Gaps = 12/208 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K    +E+  L +EE+I K 
Sbjct: 1   MAYELPQLPYAYDALEPHIDTRTMEIHHTKHHQAYVDNANKALEGSELASLPVEELIQKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  M    G     + L +AI+  FGSFE FK+   
Sbjct: 61  DQVPADKKTALRNNAGGHANHSLFWQVMGPGQGGQPSGE-LMEAINAAFGSFEAFKTKFE 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLDF 170
            AA T+FGSGW WL VK+G L +  T N +NPL+  AI      P+LG+DVWEHAYYL++
Sbjct: 120 DAAKTRFGSGWAWLVVKDGSLTVVSTANQDNPLMGEAIAGVSGTPVLGVDVWEHAYYLNY 179

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETA 198
           + +R  Y+ +F  N+VNW+ V  RY  A
Sbjct: 180 QNKRPDYLTAFW-NVVNWDEVSRRYAAA 206


>gi|293409969|ref|ZP_06653545.1| Fe-superoxide dismutase [Escherichia coli B354]
 gi|291470437|gb|EFF12921.1| Fe-superoxide dismutase [Escherichia coli B354]
          Length = 193

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 119/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    + +AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVVEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|134095671|ref|YP_001100746.1| superoxide dismutase, iron [Herminiimonas arsenicoxydans]
 gi|133739574|emb|CAL62625.1| Superoxide dismutase [Fe] [Herminiimonas arsenicoxydans]
          Length = 192

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 123/194 (63%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  + SLE+II KS
Sbjct: 1   MEHTLPALPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENASLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G G     ++DAI+  +GSF+KFK +   +  
Sbjct: 61  SG---GVFNNAAQVWNHTFYWNGMKPNGG-GAPTGKVADAINAKWGSFDKFKEEFTKSCV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL  K +G L+++ T NA  PL     P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TNFGSGWTWLVKKADGSLDLANTSNAGCPLTGTDTPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCE 193
           SF   LVNW++V +
Sbjct: 177 SFWA-LVNWDFVAK 189


>gi|294636404|ref|ZP_06714789.1| superoxide dismutase [Edwardsiella tarda ATCC 23685]
 gi|291090324|gb|EFE22885.1| superoxide dismutase [Edwardsiella tarda ATCC 23685]
          Length = 192

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L   +E    SLEEII  S
Sbjct: 1   MSFELPALPYAKNALEPHISAETLEYHYGKHHNTYVVNLNNLIKGSEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF  F+  L  +A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGALADAINAAFGSFAAFQEALTKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 ANFGSGWTWLVKKADGSLAIVNTSNAATPLTGEDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNWE+V +
Sbjct: 177 NFWA-LVNWEFVAQ 189


>gi|218548749|ref|YP_002382540.1| superoxide dismutase [Escherichia fergusonii ATCC 35469]
 gi|218356290|emb|CAQ88908.1| superoxide dismutase, Fe [Escherichia fergusonii ATCC 35469]
 gi|324113430|gb|EGC07405.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia fergusonii B253]
 gi|325497158|gb|EGC95017.1| superoxide dismutase [Escherichia fergusonii ECD227]
          Length = 193

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 120/197 (60%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           E F   LVNWE+  + +
Sbjct: 176 EHFWA-LVNWEFAAKNF 191


>gi|87307276|ref|ZP_01089421.1| superoxide dismutase [Blastopirellula marina DSM 3645]
 gi|87290016|gb|EAQ81905.1| superoxide dismutase [Blastopirellula marina DSM 3645]
          Length = 202

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 122/202 (60%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNY---ADNALK-LASDAEMLHLSLEEI 56
           M + LP LPY+YD L P +  +T+E HH  HH+ Y    ++A+K  A +++ +   + ++
Sbjct: 1   MAYTLPELPYAYDALEPSIDAKTMEIHHTKHHQAYITKVNDAIKGTALESKTIEELVSDL 60

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  MK N G G    AL+ AID   G FEKFK D  
Sbjct: 61  SAVPENVRGAVRNNGGGHANHSLFWTIMKPNGG-GAPTGALAAAIDAELGGFEKFKEDFS 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WLSV  GKL +  T N + PL+ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAAATRFGSGWAWLSVDGGKLLVESTPNQDTPLMEGRTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ +F  N++NW+ V + Y  A
Sbjct: 180 YVSAFF-NVINWDEVSKLYAAA 200


>gi|83719621|ref|YP_441300.1| superoxide dismutase [Burkholderia thailandensis E264]
 gi|83653446|gb|ABC37509.1| superoxide dismutase [Burkholderia thailandensis E264]
          Length = 221

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 206 AFW-NIVNWDFAAKNF 220


>gi|305665917|ref|YP_003862204.1| superoxide dismutase, Mn family protein [Maribacter sp. HTCC2170]
 gi|88710692|gb|EAR02924.1| superoxide dismutase, Mn family protein [Maribacter sp. HTCC2170]
          Length = 202

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 120/200 (60%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y +N     +  ++   S+E+I+   
Sbjct: 1   MAFELPKLPYAYDALEPHIDARTMEIHHTKHHNGYTNNLNGAIAGTDLETKSIEDILANL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH LFW  M   DG G+    L+DAI++ FGSFE FK     AA 
Sbjct: 61  DMDNGAVRNNGGGFYNHALFWEIMSP-DGGGEPSGELADAINEAFGSFESFKEKFSKAAG 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  T N +N L+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEVCSTPNQDNSLMPNVGCGGHPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ +F  N++NW  V E Y
Sbjct: 180 DYVNAFF-NVINWSKVSELY 198


>gi|86143640|ref|ZP_01062016.1| manganese superoxide dismutase [Leeuwenhoekiella blandensis MED217]
 gi|85829683|gb|EAQ48145.1| manganese superoxide dismutase [Leeuwenhoekiella blandensis MED217]
          Length = 202

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 121/200 (60%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+ D L P++  +T+E HHD HH  Y           ++   ++E I+I  
Sbjct: 1   MSFQLPELKYAKDALEPHIDAKTMEIHHDKHHAGYTSKLNAAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   +YNH+LFW  M   DG G+    L++AI+  FGSFE FK    +AA 
Sbjct: 61  DMTNKAVRNNGGGFYNHSLFWDVMSP-DGGGEPTGELAEAINAAFGSFEAFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V + GK+E+  T N +NPL+     G  PILGIDVWEHAYYL ++ +R 
Sbjct: 120 TQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPEVGCGGTPILGIDVWEHAYYLKYQNQRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI++F  N++NW+ V  RY
Sbjct: 180 AYIDAFF-NVINWQEVSSRY 198


>gi|315158809|gb|EFU02826.1| superoxide dismutase, Mn [Enterococcus faecalis TX0312]
          Length = 197

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 89/198 (44%), Positives = 121/198 (61%), Gaps = 7/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWKIMAPNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCE 193
            YIE+F  N+VNW+ V E
Sbjct: 180 DYIEAFW-NVVNWDKVNE 196


>gi|91215426|ref|ZP_01252397.1| SodA [Psychroflexus torquis ATCC 700755]
 gi|91186378|gb|EAS72750.1| SodA [Psychroflexus torquis ATCC 700755]
          Length = 202

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  L Y++D L P++  +T+E HH  HH  Y          +++   ++E I+I  
Sbjct: 1   MAFELQKLDYAHDALEPHIDAKTMEIHHGKHHAGYTQKLNTALEGSDLEGRTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NNA  +YNH+LFW  M    G GK    L+ AID++FGSF+ FK    TAA+
Sbjct: 61  DLSNNAVRNNAGGFYNHSLFWKVMSPKGG-GKPSGELAKAIDESFGSFDSFKDAFSTAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL+V   GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLTVHSGGKVEVCSTANQDNPLMPNVGQGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N++NWE V +RY
Sbjct: 180 DYINAFF-NVINWEEVSKRY 198


>gi|5771529|gb|AAD51417.1|AF173990_1 iron superoxide dismutase [Nostoc sp. PCC 7120]
          Length = 200

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 121/201 (60%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LPY ++ L  Y M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  
Sbjct: 1   MAFVQEPLPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +      AG+FNNA+Q +NH  FW  +K   G G      +  I+ +FGSF+K K +   
Sbjct: 61  AFKDAYKAGIFNNAAQVWNHTFFWNSLKPAGG-GAPTGEFAAKINQDFGSFDKLKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L+++KT NAENPL +G   +L +DVWEHAYY+DF+  R  +
Sbjct: 120 AAATQFGSGWAWLIDDGGTLKVTKTPNAENPLAHGQKALLTLDVWEHAYYIDFRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++++ NLVNW++    Y  A
Sbjct: 180 IKNYLDNLVNWDFAAANYAKA 200


>gi|297799484|ref|XP_002867626.1| hypothetical protein ARALYDRAFT_492324 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313462|gb|EFH43885.1| hypothetical protein ARALYDRAFT_492324 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 215

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 3/197 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
           ++ L   PY+ D L P+MSK+TLE+H   HH+ Y +N  K     E+    LE II  ++
Sbjct: 10  NYVLKPPPYALDALEPHMSKQTLEFHWGKHHRAYVENLKKQVLGTELEGKPLEHIIHSTY 69

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
            +   L  FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA
Sbjct: 70  NNGELLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYEEFNAAA 128

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           +TQFG+GW WL+  N KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI+
Sbjct: 129 ATQFGAGWAWLAYANDKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIK 188

Query: 180 SFITNLVNWEYVCERYE 196
           +F+TNLV+WE V  R E
Sbjct: 189 TFMTNLVSWEAVSARLE 205


>gi|238796365|ref|ZP_04639874.1| Superoxide dismutase [Fe] [Yersinia mollaretii ATCC 43969]
 gi|238719810|gb|EEQ11617.1| Superoxide dismutase [Fe] [Yersinia mollaretii ATCC 43969]
          Length = 192

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYHH  HH  Y  N   L  + E    +LEEI+  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHHGKHHNTYVVNLNSLIKETEFAGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTNDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|239817957|ref|YP_002946867.1| superoxide dismutase [Variovorax paradoxus S110]
 gi|239804534|gb|ACS21601.1| Superoxide dismutase [Variovorax paradoxus S110]
          Length = 193

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 119/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P  SKETLEYH+  HH  Y  N   L    E   + LE+I+ KS
Sbjct: 1   MEHTLPPLPYALDALAPEYSKETLEYHYGKHHNAYVVNLNNLQKGTEFESMPLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW+CMK   G G    AL+ AID  +G+++ FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWSCMKPQGG-GAPTGALAKAIDAKWGNYDAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I     A  PL  G  P+L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSLDIVNMGAAGTPLTTGDTPVLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLAKLVNWDFAAKNF 192


>gi|89889936|ref|ZP_01201447.1| superoxide dismutase, iron/manganese-dependent [Flavobacteria
           bacterium BBFL7]
 gi|89518209|gb|EAS20865.1| superoxide dismutase, iron/manganese-dependent [Flavobacteria
           bacterium BBFL7]
          Length = 201

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E HH  HH  Y           ++   S+E+I+   
Sbjct: 1   MAFELPKLNYAYDALEPHIDARTMEIHHSKHHNGYTTKLNNAIEGTDLEGKSIEDILANL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH LFW  M  N G GK    L+ AID  FGS++ F+    TAA 
Sbjct: 61  DMDNKAVRNNGGGFYNHRLFWEVMSPN-GGGKPTGDLAAAIDSAFGSYDAFQDKFATAAK 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           TQFGSGW +L VK+G LE+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 TQFGSGWAFLCVKDGALEVCGTPNQDNPLMPGVGCGGTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ +F  N+++W+ V E+Y  A
Sbjct: 180 YVSAFF-NVIDWDAVSEKYNAA 200


>gi|296102684|ref|YP_003612830.1| superoxide dismutase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057143|gb|ADF61881.1| superoxide dismutase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 193

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L    +    +LEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTDFEGKTLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+ AI+  FGSF +FK+    AA 
Sbjct: 61  DG---GVFNNAAQVWNHTFYWHCLAPNAG-GEPTGELATAINAAFGSFAEFKAKFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  + +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKEADGKLAIVSTSNAGTPLTTSATPLMTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   LVNW++V + +
Sbjct: 177 HFWA-LVNWDFVAKNF 191


>gi|224824987|ref|ZP_03698093.1| Superoxide dismutase [Lutiella nitroferrum 2002]
 gi|224602658|gb|EEG08835.1| Superoxide dismutase [Lutiella nitroferrum 2002]
          Length = 193

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+PY+SKETLEYH+  HH+ Y  N   L    E  + SLEEI+ KS
Sbjct: 1   MEHKLPELPYALDALAPYISKETLEYHYGKHHQTYVTNLNNLIKGTEFENASLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W  +  N G G+   AL+DAI+  +GSF++FK      A+
Sbjct: 61  TG---GLFNNAAQVWNHTFYWFGLAPNAG-GEPTGALADAINAKWGSFDEFKKAFNAVAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  G L++  T NA  PL      +L  DVWEHAYY+D++  R +Y+
Sbjct: 117 GTFGSGWAWL-VKNPDGSLDLVSTSNAATPLTTDKKALLTCDVWEHAYYIDYRNSRPNYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           ESF   LVNW++  + +
Sbjct: 176 ESFW-KLVNWDFAAKNF 191


>gi|3114705|gb|AAC15842.1| superoxide dismutase [Raphanus sativus]
          Length = 212

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 124/195 (63%), Gaps = 3/195 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL- 67
           PY  D L P+MSK+TLE+H   HH+ Y DN  K    +E+   +LE II  ++ +   L 
Sbjct: 17  PYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKALEHIIQNTYNNGDLLP 76

Query: 68  -FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 77  PFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYDEFNAAAATQFGAG 135

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  + KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+ NLV
Sbjct: 136 WAWLAYADNKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMNNLV 195

Query: 187 NWEYVCERYETAMLA 201
           +WE V  R E A  A
Sbjct: 196 SWEAVSSRLEAAKAA 210


>gi|167994260|ref|ZP_02575352.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205327849|gb|EDZ14613.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
          Length = 193

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+   L P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKYALVPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|226945828|ref|YP_002800901.1| Fe-Superoxide dismutase [Azotobacter vinelandii DJ]
 gi|4106403|gb|AAD02836.1| iron superoxide dismutase FeSOD [Azotobacter vinelandii]
 gi|6552344|dbj|BAA88212.1| iron superoxide dismutase [Azotobacter vinelandii]
 gi|226720755|gb|ACO79926.1| Fe-Superoxide dismutase [Azotobacter vinelandii DJ]
          Length = 193

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L PY+S ETLEYH+  HH  Y  N   L    E    SLE+I+  S
Sbjct: 1   MAFELPPLPYEKNALEPYISTETLEYHYGKHHNTYVVNLNNLIPGTEFEGKSLEDIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G G+    L+DAI+  FGSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNGLKPQGG-GQPTGPLADAINAAFGSFDKFKEEFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  NLVNW++V   Y
Sbjct: 177 AFW-NLVNWDFVAANY 191


>gi|226330328|ref|ZP_03805846.1| hypothetical protein PROPEN_04242 [Proteus penneri ATCC 35198]
 gi|225201123|gb|EEG83477.1| hypothetical protein PROPEN_04242 [Proteus penneri ATCC 35198]
          Length = 223

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++SKETLEYH+  HH+ Y  N   L    ++   SLEEII  +
Sbjct: 32  MSFELPKLPYALDALEPHISKETLEYHYGKHHQTYVTNLNNLVKGTDLESKSLEEIIKST 91

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G     ++DAI+  FGSFE+FK     AA+
Sbjct: 92  DG---GIFNNAAQVWNHTFYWNCLAPNAG-GAPTGKIADAINKAFGSFEEFKKQFNDAAA 147

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + I  T NA  P+     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 148 KNFGSGWTWLVKKADGSVAIVNTSNAATPVSGADKPLLTVDVWEHAYYIDYRNARVKYLE 207

Query: 180 SFITNLVNWEYV 191
            F   LVNW +V
Sbjct: 208 EFWA-LVNWSFV 218


>gi|299822911|ref|ZP_07054797.1| manganese (Mn) superoxide dismutase SodA [Listeria grayi DSM 20601]
 gi|299816440|gb|EFI83678.1| manganese (Mn) superoxide dismutase SodA [Listeria grayi DSM 20601]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 123/205 (60%), Gaps = 11/205 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYA---DNALKLASDAEMLHLSLEEII 57
           M ++LP LPY+YD L P   KET+E HH  HH  Y    ++ALK   D  +   S++E++
Sbjct: 1   MAYELPKLPYAYDALEPNFDKETMEIHHTKHHNTYVTKLNDALKGHDD--LASKSVDELV 58

Query: 58  IKSHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
              +         + NN   + NH  FW  +  N G G+   A+ DAI+  FGSF+ FK 
Sbjct: 59  ADLNSVPEDIRTAVRNNGGGHSNHTFFWQILSPN-GGGEPTGAIKDAIESTFGSFDAFKE 117

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
               AA+ +FGSGW WL V NG LEI+ T N ++PL +G  P+LG+DVWEHAYYL F+ R
Sbjct: 118 KFAEAATGRFGSGWAWLVVNNGNLEITSTANQDSPLTDGKTPVLGLDVWEHAYYLKFQNR 177

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R  YI +F  N+VNW+ V +R+E A
Sbjct: 178 RPEYITTFW-NVVNWDEVNKRFEAA 201


>gi|238782578|ref|ZP_04626609.1| Superoxide dismutase [Fe] [Yersinia bercovieri ATCC 43970]
 gi|238716505|gb|EEQ08486.1| Superoxide dismutase [Fe] [Yersinia bercovieri ATCC 43970]
          Length = 192

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D+E    +LEEI+  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDSEFADKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  SG---GLFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWAFV 187


>gi|53803912|ref|YP_114498.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
 gi|53757673|gb|AAU91964.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
          Length = 210

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 120/191 (62%), Gaps = 3/191 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGS- 63
           LP LPY+ + L+P +S  T+ +H+  HHK Y DN  KL +  E    +LE+II  + G  
Sbjct: 18  LPPLPYAENALAPVISANTIGFHYGKHHKGYVDNLNKLVAGTEYADSTLEKIIHDTGGKA 77

Query: 64  -NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               +FNNA+Q +NH  +W  ++ N G G+ P AL   I+ +FGS    K +  +AA +Q
Sbjct: 78  DRTSIFNNAAQVWNHTFYWKSLRPNGG-GEPPAALRRKIEASFGSVAACKKEFASAAVSQ 136

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL +   KLEI +T NA+ PL +G  P+L IDVWEHAYYLD++ RRA Y+ + +
Sbjct: 137 FGSGWAWLVLDGDKLEIIRTANADIPLTSGKKPLLVIDVWEHAYYLDYQNRRADYVNAVL 196

Query: 183 TNLVNWEYVCE 193
             L+NWE+  +
Sbjct: 197 EKLLNWEFALQ 207


>gi|34541205|ref|NP_905684.1| superoxide dismutase, Fe-Mn [Porphyromonas gingivalis W83]
 gi|188994428|ref|YP_001928680.1| superoxide dismutase Fe-Mn [Porphyromonas gingivalis ATCC 33277]
 gi|134644|sp|P19665|SODF_PORGI RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|9257063|pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas
           Gingivalis
 gi|9257064|pdb|1QNN|B Chain B, Cambialistic Superoxide Dismutase From Porphyromonas
           Gingivalis
 gi|9257065|pdb|1QNN|C Chain C, Cambialistic Superoxide Dismutase From Porphyromonas
           Gingivalis
 gi|9257066|pdb|1QNN|D Chain D, Cambialistic Superoxide Dismutase From Porphyromonas
           Gingivalis
 gi|49259335|pdb|1UER|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259336|pdb|1UER|B Chain B, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259337|pdb|1UER|C Chain C, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259338|pdb|1UER|D Chain D, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|216380|dbj|BAA14182.1| superoxide dismutase [Porphyromonas gingivalis ATCC 33277]
 gi|34397521|gb|AAQ66583.1| superoxide dismutase, Fe-Mn [Porphyromonas gingivalis W83]
 gi|188594108|dbj|BAG33083.1| superoxide dismutase Fe-Mn [Porphyromonas gingivalis ATCC 33277]
          Length = 191

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 125/197 (63%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L +LPY+ D L+P +SKET+E+HH  H K Y DN  KL    E  +  L  I+ KS
Sbjct: 1   MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
            G   G+FNNA Q  NHNL++   +   GKG  P+  L +AID  FGSFEKFK +  TA 
Sbjct: 61  EG---GIFNNAGQTLNHNLYFTQFRP--GKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAG 115

Query: 120 STQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +T FGSGW WL S  NGKL I K  NA NP+  G  P+LG DVWEHAYYL ++ RRA ++
Sbjct: 116 TTLFGSGWVWLASDANGKLSIEKEPNAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHL 175

Query: 179 ESFITNLVNWEYVCERY 195
           +  + ++V+W+ V  RY
Sbjct: 176 KD-LWSIVDWDIVESRY 191


>gi|163754622|ref|ZP_02161744.1| superoxide dismutase, Mn family protein [Kordia algicida OT-1]
 gi|161325563|gb|EDP96890.1| superoxide dismutase, Mn family protein [Kordia algicida OT-1]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P +   T+E HH  HH  Y +         ++   S+E+I+   
Sbjct: 1   MAFELPKLPYAYDALEPNIDARTMEIHHSKHHNGYTNKLNAAIEGTDLEGKSIEDILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+G+ NN   +YNH+LFW  M   D +G +   L DAI+  FGS ++F      AA+
Sbjct: 61  DMSNSGVRNNGGGFYNHSLFWEVMNPED-RGYLSGELKDAIEAAFGSKDEFIDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPEVGCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NW  V  RY  A
Sbjct: 180 DYIKAFF-NVINWNEVERRYAEA 201


>gi|23014241|ref|ZP_00054068.1| COG0605: Superoxide dismutase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 198

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 124/194 (63%), Gaps = 4/194 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LP++ D L P++S  T E+HH  HH  Y  N   L  D ++   SLEE+I  +
Sbjct: 1   MAFELPPLPFANDALEPHISARTFEFHHGKHHAAYVTNLNNLTKDTDLASKSLEEVIKVA 60

Query: 61  HG---SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                +  G+FNNA+Q +NH  FW C+KK  G    P+ L+  I+ + G F+KFK D   
Sbjct: 61  AADLPAKQGIFNNAAQVWNHTFFWNCLKKGGGGKPGPKLLAK-IESDLGGFDKFKEDFKA 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA  QFGSGW WL +  GKL+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  +
Sbjct: 120 AAVGQFGSGWAWLVLDGGKLKITKTANADLPLAHGQKALLTVDVWEHAYYLDWQNRRPDF 179

Query: 178 IESFITNLVNWEYV 191
           ++ F+ NLVNW++V
Sbjct: 180 VQCFLDNLVNWDFV 193


>gi|324016546|gb|EGB85765.1| superoxide dismutase [Escherichia coli MS 117-3]
          Length = 193

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE++ +
Sbjct: 176 EHFWA-LVNWEFLAK 189


>gi|323479601|gb|ADX79040.1| superoxide dismutase (Mn) [Enterococcus faecalis 62]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+E++I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH  FW  M  N G G+   A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMASNAG-GQPTGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NG LEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGNLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  N+VNW+ V E +  A
Sbjct: 180 DYIEAFW-NVVNWDKVNELFAAA 201


>gi|281206647|gb|EFA80833.1| superoxide dismutase [Polysphondylium pallidum PN500]
          Length = 193

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 121/194 (62%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY  D L+P++S+ETL++H+  HHK Y  N   L    E  H ++EEII  +
Sbjct: 1   MSFVLPELPYPKDGLAPHISEETLDFHYGAHHKTYVTNLNNLVKGTENEHKTIEEIIKTT 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  +W  +  N G G    AL DAI  N+GSFE FK++   AA+
Sbjct: 61  TGP---VFNNAAQCWNHTFYWHSLSPNGG-GDADGALRDAIIKNWGSFESFKAEFSKAAT 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            QFGSGW WL + K+G L I+ T NA  P+     P+L  DVWEHAYY+D++  RA YI+
Sbjct: 117 GQFGSGWAWLVLKKDGTLAITTTSNAATPITTDDKPLLTCDVWEHAYYIDYRNARAKYID 176

Query: 180 SFITNLVNWEYVCE 193
           +F   +VNW++  E
Sbjct: 177 AFW-EVVNWKFANE 189


>gi|326798487|ref|YP_004316306.1| superoxide dismutase [Sphingobacterium sp. 21]
 gi|326549251|gb|ADZ77636.1| Superoxide dismutase [Sphingobacterium sp. 21]
          Length = 203

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P++ KET+E HH  HH+ Y DN  K  +  +   LS+EEII   
Sbjct: 1   MAFSLPALPYASDALEPHIDKETMEIHHGKHHQAYVDNLNKAIAGTDAESLSIEEIIKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   +YNH+LFW  +   D +      L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYPAAVRNNGGGHYNHSLFWTILSP-DAQTTPSGELATAIDETFGSFDELKKKLQDAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V  +GKL+++ T N ++PL++ A     PILGIDVWEHAYYL ++ +R 
Sbjct: 120 TRFGSGWSWLVVDASGKLQVTSTPNQDSPLMDVAEVKGTPILGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+E+ I N++ W+ V ERY  A
Sbjct: 180 AYLEA-IFNVICWKSVGERYANA 201


>gi|328957652|ref|YP_004375038.1| superoxide dismutase [Carnobacterium sp. 17-4]
 gi|328673976|gb|AEB30022.1| superoxide dismutase [Carnobacterium sp. 17-4]
          Length = 207

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M ++LP LPY YD L P++ + T+E+HHD HH  Y +     L    E+   S+EE++  
Sbjct: 6   MTYELPKLPYGYDALEPHIDQATMEFHHDKHHATYVEKTNAALEKYPELAKKSIEELVAD 65

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH+ FW  +  N G G+    L + I+  FGSF+KFK  +
Sbjct: 66  LNSVPEEIRTAIRNNGGGHANHSFFWEILSPNGG-GEPTGTLKEDIEATFGSFDKFKEAI 124

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TA + QFGSGW WL + NGKLE++ T N ++PL +G  P+ G+DVWEHAYYL+++ +R 
Sbjct: 125 ETAGAGQFGSGWAWLVLNNGKLEVTSTANQDSPLTDGKTPLFGVDVWEHAYYLNYQNKRP 184

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+++ + N+VNW  V +RYE A
Sbjct: 185 AYLKA-VWNVVNWNEVAKRYEAA 206


>gi|332184751|gb|AEE27005.1| Superoxide dismutase (Fe) [Francisella cf. novicida 3523]
          Length = 192

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 119/197 (60%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L P +SKET+EYH+  HH+ Y  N   L    E    +LEEII  S
Sbjct: 1   MKFELPKLPYEIDALEPTISKETIEYHYGKHHQTYVTNLNNLVEGTEHAGRNLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N  K +V   L  A+ + FGS E FK     AA 
Sbjct: 61  TG---GIFNNAAQVFNHTFYWNCLTPN--KTEVSSLLKAALIETFGSVENFKEQFSKAAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL +   P+L  DVWEHAYY+D++  R  Y+
Sbjct: 116 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTDNKKPLLTFDVWEHAYYIDYRNARPKYV 174

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW +V E++
Sbjct: 175 EA-LWDIVNWRFVSEQF 190


>gi|254251600|ref|ZP_04944918.1| superoxide dismutase [Burkholderia dolosa AUO158]
 gi|124894209|gb|EAY68089.1| superoxide dismutase [Burkholderia dolosa AUO158]
          Length = 226

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/196 (45%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEII KS
Sbjct: 34  MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIIKKS 93

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 94  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSYDAFKEAFTKAAV 149

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 150 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 209

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 210 AFW-NIVNWDFAAKNF 224


>gi|238787139|ref|ZP_04630939.1| Superoxide dismutase [Fe] [Yersinia frederiksenii ATCC 33641]
 gi|238724927|gb|EEQ16567.1| Superoxide dismutase [Fe] [Yersinia frederiksenii ATCC 33641]
          Length = 192

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 120/192 (62%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    +LEEII  +
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKTLEEIIKTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  NG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTSDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F + LVNW +V
Sbjct: 177 NFWS-LVNWSFV 187


>gi|332090795|gb|EGI95887.1| superoxide dismutase [Shigella boydii 5216-82]
          Length = 193

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N   G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPN-ASGEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|281178728|dbj|BAI55058.1| superoxide dismutase [Escherichia coli SE15]
          Length = 193

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 8/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L          LEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKPLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYL 175

Query: 179 ESFITNLVNWEYVCE 193
           E F   LVNWE+V +
Sbjct: 176 EHFWA-LVNWEFVAK 189


>gi|294340375|emb|CAZ88756.1| Superoxide dismutase [Fe] [Thiomonas sp. 3As]
          Length = 193

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 123/196 (62%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LP++ D L+P+MS+ETLEYHH  HH+ Y +N   L    E  ++SLE+II KS
Sbjct: 1   MQHELPPLPFAPDALAPHMSRETLEYHHGKHHQAYVNNTNNLIKGTEFDNMSLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNN++Q +NH  FW C+K   G G+   AL+ AI+  +GS+  FK     +A 
Sbjct: 61  SG---GLFNNSAQVWNHTFFWNCLKAGGG-GEPKGALAAAINAKWGSYAAFKEAFHKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T N + PL      +L IDVWEHAYY+DF+ RR  ++ 
Sbjct: 117 GNFGSGWTWLVKKADGNVDIVNTANGQTPLTTADKALLTIDVWEHAYYIDFRNRRPDFVT 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+ +L NW++  + +
Sbjct: 177 TFLDHLANWDFAEKNF 192


>gi|167580078|ref|ZP_02372952.1| superoxide dismutase [Burkholderia thailandensis TXDOH]
 gi|167618144|ref|ZP_02386775.1| superoxide dismutase [Burkholderia thailandensis Bt4]
 gi|257140029|ref|ZP_05588291.1| superoxide dismutase [Burkholderia thailandensis E264]
          Length = 192

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|330828837|ref|YP_004391789.1| Superoxide dismutase [Aeromonas veronii B565]
 gi|123999382|gb|ABM86976.1| Fe-superoxide dismutase [Aeromonas veronii]
 gi|328803973|gb|AEB49172.1| Superoxide dismutase [Aeromonas veronii B565]
          Length = 194

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 120/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S
Sbjct: 1   MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF +FK     +A 
Sbjct: 61  NG---GIFNNAAQIWNHTFYWHCLSPNGG-GEPTGALADAINKAFGSFAEFKDAFTKSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 GNFGSSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYM 176

Query: 179 ESFITNLVNWEYVCE 193
           E+F   LVNWE+V +
Sbjct: 177 ETFWA-LVNWEFVAK 190


>gi|296127012|ref|YP_003634264.1| superoxide dismutase [Brachyspira murdochii DSM 12563]
 gi|296018828|gb|ADG72065.1| Superoxide dismutase [Brachyspira murdochii DSM 12563]
          Length = 198

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 122/199 (61%), Gaps = 6/199 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKSH 61
           F+L  LPY+ +DL+PYMS  TL++HH  H   Y      L S D+ +   S+EE+I  S+
Sbjct: 2   FELMKLPYAKEDLAPYMSSNTLDFHHGKHLNTYVTTLNDLVSKDSSLQGKSIEELITLSY 61

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
                  +FNNA Q YNH  F+  +KK+     +P  +   I+ +FGSF+ FK    T  
Sbjct: 62  NNADKQAVFNNAGQVYNHEEFFKMIKKD---AAIPAEVKSKIEADFGSFDAFKEAFTTGG 118

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            TQFGSGW WL + NGKLE+ K  NA NP+ +    +L  DVWEHAYYLD++ RR  ++ 
Sbjct: 119 KTQFGSGWVWLVMNNGKLEVRKYANAMNPVADKVHGVLTCDVWEHAYYLDYQNRRPDFLT 178

Query: 180 SFITNLVNWEYVCERYETA 198
           +F+ +LVNW+YV ER ++A
Sbjct: 179 TFVDHLVNWDYVAERIKSA 197


>gi|312282991|dbj|BAJ34361.1| unnamed protein product [Thellungiella halophila]
          Length = 215

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 121/190 (63%), Gaps = 3/190 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--GSNAG 66
           PYS D L P+MS++TLE+H   HH+ Y DN  K     E+    L+ II+K++  G    
Sbjct: 17  PYSLDALEPHMSRQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLDHIILKTYNNGDLLP 76

Query: 67  LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 77  AFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYDEFNAAAATQFGAG 135

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  N KL++ KT NA NPL+  + P+L IDVWEHAYYLDF+ RR  YI++F+ NLV
Sbjct: 136 WAWLAYANDKLKVVKTPNAVNPLVLDSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMNNLV 195

Query: 187 NWEYVCERYE 196
           +WE V  R E
Sbjct: 196 SWEAVSSRLE 205


>gi|256828955|ref|YP_003157683.1| Superoxide dismutase [Desulfomicrobium baculatum DSM 4028]
 gi|256578131|gb|ACU89267.1| Superoxide dismutase [Desulfomicrobium baculatum DSM 4028]
          Length = 207

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 121/191 (63%), Gaps = 3/191 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGS- 63
           LP LPY+ + L P +S +T+ +H+D HHK Y DN  KL +      ++LE+I+ ++ G  
Sbjct: 14  LPFLPYAENALEPVISAKTIGFHYDKHHKGYVDNLKKLVAGTRFADMTLEKIMSETAGKS 73

Query: 64  -NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
            N  +FNNA+Q +NHN +W  ++ + G  ++   L   I+ +FGS +  K +L  AA  Q
Sbjct: 74  DNIAIFNNAAQTWNHNFYWQSLRPSGG-AELAAVLQKKIEVSFGSLDACKKELAAAAMAQ 132

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL + +  L++ KT NAE P+     P+L IDVWEHAYYLD++ RRA Y+++ +
Sbjct: 133 FGSGWAWLVMDSDMLKVVKTANAEVPMTMSMKPLLTIDVWEHAYYLDYQNRRADYVKAVL 192

Query: 183 TNLVNWEYVCE 193
             L+NWE+  E
Sbjct: 193 DTLINWEFAAE 203


>gi|226940636|ref|YP_002795710.1| SodB1 [Laribacter hongkongensis HLHK9]
 gi|226715563|gb|ACO74701.1| SodB1 [Laribacter hongkongensis HLHK9]
          Length = 196

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 121/198 (61%), Gaps = 7/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L P+MS+ETLEYH+  HH+ Y  N   L    E  +  LE I+ +S
Sbjct: 1   MEHKLPELPYALDALVPFMSRETLEYHYGKHHQTYITNLNNLIKGTEFENAPLETIVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            G   G+FNNA+Q +NH  FW     N  G+ ++P  AL+ AID  +GS E+FK      
Sbjct: 61  SG---GVFNNAAQTWNHTFFWFGFAPNASGEARLPSGALASAIDAKWGSLEEFKKAFNAV 117

Query: 119 ASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           A+  FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R +Y
Sbjct: 118 AAGTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDATPLLTCDVWEHAYYIDYRNSRPNY 177

Query: 178 IESFITNLVNWEYVCERY 195
           +E+F   LV+W  V ER+
Sbjct: 178 LENFW-KLVDWNVVAERF 194


>gi|224025807|ref|ZP_03644173.1| hypothetical protein BACCOPRO_02549 [Bacteroides coprophilus DSM
           18228]
 gi|224019043|gb|EEF77041.1| hypothetical protein BACCOPRO_02549 [Bacteroides coprophilus DSM
           18228]
          Length = 191

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  KLP LPY  ++L+P MS+ETLE+H+  H + Y DN  KL        LSLE+II K+
Sbjct: 1   MTHKLPTLPYQMEELAPLMSQETLEFHYGKHLQTYIDNLNKLIPGTPYETLSLEDIICKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+   +FNNA+Q +NH  F+  +  +     +PQ L   +  NFGS E FK     AA 
Sbjct: 61  DGA---IFNNAAQTWNHTFFFQTLTSHSDV--IPQKLDALLTSNFGSAEAFKEQFTKAAL 115

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL+  K GKL I    NA NPL  G  P+L ID+WEHAYY+D++ RRA YIE
Sbjct: 116 GLFGSGWVWLAADKEGKLFILPESNAGNPLTKGYTPLLVIDIWEHAYYIDYRNRRAAYIE 175

Query: 180 SFITNLVNWEYVCER 194
           +F   LVNWE V ER
Sbjct: 176 AFW-KLVNWEKVAER 189


>gi|238028443|ref|YP_002912674.1| Superoxide dismutase [Burkholderia glumae BGR1]
 gi|237877637|gb|ACR29970.1| Superoxide dismutase [Burkholderia glumae BGR1]
          Length = 192

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|172056895|ref|YP_001813355.1| superoxide dismutase [Exiguobacterium sibiricum 255-15]
 gi|171989416|gb|ACB60338.1| Superoxide dismutase [Exiguobacterium sibiricum 255-15]
          Length = 202

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 123/200 (61%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKS 60
           F+LP L Y+YD L P++   T+E HH  HH  Y  N       +E    SLEE++  + S
Sbjct: 4   FELPELGYAYDALEPHIDARTMEIHHSKHHNTYVTNVNAALEGSEHEGKSLEELLQNLDS 63

Query: 61  HGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +N    + NN   ++NH+ FW  +KKNDG     + L+ AID+ FGSF+ FK +   A
Sbjct: 64  LPANIQTAVRNNGGGHWNHSFFWKLLKKNDGAAPTGE-LATAIDEAFGSFDAFKDEFTKA 122

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+T+FGSGW WL V  GKL +  T N + P++ G  PILG+DVWEHAYYL+++ RR  YI
Sbjct: 123 ATTRFGSGWAWLIVDGGKLAVVSTPNQDTPVMEGKTPILGLDVWEHAYYLNYQNRRPDYI 182

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W++V + Y  A
Sbjct: 183 NAFF-NVVDWDHVAKLYADA 201


>gi|53803389|ref|YP_114872.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
 gi|53757150|gb|AAU91441.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
          Length = 194

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 120/197 (60%), Gaps = 7/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+   L P++S ETLEYH+  HH+ Y  N   L    E  +LSLEEII K+
Sbjct: 1   MTHELPALPYAKTALEPHISAETLEYHYGKHHQTYVTNLNNLIPGTEYENLSLEEIIRKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G+FNNA+Q +NH  +W  +  N G G+   AL++AI  +FGSFEKFK      A 
Sbjct: 61  PA--GGVFNNAAQVWNHTFYWNSLSPNGG-GEPTGALAEAIVKSFGSFEKFKEAFTQCAV 117

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           T FGSGW WL VKN  G L +  T NA  PL +   P+L  DVWEHAYY+D++  R  Y+
Sbjct: 118 TTFGSGWAWL-VKNADGSLALVSTSNAGCPLTSDQTPLLTCDVWEHAYYIDYRNARPKYL 176

Query: 179 ESFITNLVNWEYVCERY 195
           E+F  NLVNWE+    +
Sbjct: 177 EAFW-NLVNWEFAAANF 192


>gi|640114|pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
 gi|640115|pdb|1ISA|B Chain B, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
 gi|640116|pdb|1ISB|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
 gi|640117|pdb|1ISB|B Chain B, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
 gi|640118|pdb|1ISC|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
 gi|640119|pdb|1ISC|B Chain B, Structure-Function In E. Coli Iron Superoxide Dismutase:
           Comparisons With The Manganese Enzyme From T.
           Thermophilus
          Length = 192

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 119/194 (61%), Gaps = 8/194 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S 
Sbjct: 1   SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSE 60

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA  
Sbjct: 61  G---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAIK 116

Query: 122 QFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 NFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 175

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 176 HFWA-LVNWEFVAK 188


>gi|197285256|ref|YP_002151128.1| superoxide dismutase [Proteus mirabilis HI4320]
 gi|227355685|ref|ZP_03840078.1| superoxide dismutase [Proteus mirabilis ATCC 29906]
 gi|194682743|emb|CAR42952.1| superoxide dismutase [Fe] [Proteus mirabilis HI4320]
 gi|227164004|gb|EEI48901.1| superoxide dismutase [Proteus mirabilis ATCC 29906]
          Length = 192

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 119/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++SKETLEYH+  HH+ Y  N   L    ++ + SLEE+I  +
Sbjct: 1   MSFELPKLPYALDALEPHISKETLEYHYGKHHQTYVTNLNNLVKGTDLENKSLEELIKTT 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G     +++AI+  FGSFE+FK     AA+
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAG-GAPTGKIAEAINKAFGSFEEFKKQFNDAAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  P+     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKKADGSLAIVNTSNAATPVSGEDKPLLTVDVWEHAYYIDYRNARVKYLE 176

Query: 180 SFITNLVNWEYV 191
            F   LVNW +V
Sbjct: 177 EFWA-LVNWSFV 187


>gi|295132153|ref|YP_003582829.1| superoxide dismutase [Zunongwangia profunda SM-A87]
 gi|294980168|gb|ADF50633.1| superoxide dismutase [Zunongwangia profunda SM-A87]
          Length = 202

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 122/200 (61%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP L Y++D L P++  +T+E HHD HH  Y           ++   ++E I+   
Sbjct: 1   MAFALPELKYAFDALEPHIDAKTMEIHHDKHHAGYTTKLNNAIEGTDLEGKTIENILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+ + NN   +YNH+LFW  M   DG GK    L++AID  FGSF+ FK +   AA+
Sbjct: 61  DLSNSAVRNNGGGFYNHSLFWEVMSP-DGGGKPEGELAEAIDTAFGSFDAFKEEFSNAAA 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V + GKLEI  T N +NPL+     G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 GQFGSGWAWLCVHDGGKLEICSTPNQDNPLMPEVGCGGTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI++F  N+++W+ V  RY
Sbjct: 180 AYIDAFF-NVIDWKEVASRY 198


>gi|205373987|ref|ZP_03226787.1| hypothetical protein Bcoam_12417 [Bacillus coahuilensis m4-4]
          Length = 202

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+YD L P+  KET+  HH  HH  Y       LA   E+L  S+EE+I  
Sbjct: 1   MAFELPQLPYAYDVLEPHFDKETMNIHHTKHHNAYVTKLNDALAGHDELLSKSVEEVIAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                  +   + NN   + NH+LFW  +  N G G     L +AI++ FGSF++FKS  
Sbjct: 61  LDAVPESARTAVRNNGGGHANHSLFWTILSPN-GGGNPTGELGEAINNKFGSFDEFKSQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLIVNNGELEITSTPNQDSPIMEGKTPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N+V+W+ V  RY  A
Sbjct: 180 DYIDAFW-NVVDWDAVNTRYNEA 201


>gi|160871779|ref|ZP_02061911.1| superoxide dismutase (Fe) [Rickettsiella grylli]
 gi|159120578|gb|EDP45916.1| superoxide dismutase (Fe) [Rickettsiella grylli]
          Length = 195

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 118/196 (60%), Gaps = 3/196 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPYS + L+P +SKETLEYH+  HHK Y +   +L  +     LSLE II K+
Sbjct: 1   MKHQLPPLPYSLEALAPIISKETLEYHYGKHHKAYVNKLNELIPNTTFETLSLENIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 +FNNA+Q +NH  +W CM     K K+  AL ++I  +FGSF +FK     AA 
Sbjct: 61  --PKGPIFNNAAQTWNHTFYWHCMTPLAAKNKLKGALEESICKSFGSFSQFKEAFTNAAI 118

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL      L+I  T NA  PL    I +L  DVWEHAYY+D++  R HY+E 
Sbjct: 119 AQFGSGWAWLIKDAHGLKIETTSNALTPLSEDKICLLTCDVWEHAYYIDYRNARPHYLEK 178

Query: 181 FITNLVNWEYVCERYE 196
           F  ++VNW++V E +E
Sbjct: 179 FW-DIVNWDFVAENFE 193


>gi|145298384|ref|YP_001141225.1| hypothetical protein ASA_1375 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|32492798|gb|AAP85514.1| SodB [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851156|gb|ABO89477.1| SodB [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 194

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S
Sbjct: 1   MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G  +   AL+DAI+  FGSF +FK     +A 
Sbjct: 61  TG---GIFNNAAQIWNHTFYWHCLSPNGGN-EPTGALADAINKAFGSFAEFKDAFTKSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 GNFGSSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYM 176

Query: 179 ESFITNLVNWEYVCE 193
           E+F T LVNWE+V +
Sbjct: 177 ETFWT-LVNWEFVAK 190


>gi|325283219|ref|YP_004255760.1| Superoxide dismutase [Deinococcus proteolyticus MRP]
 gi|324315028|gb|ADY26143.1| Superoxide dismutase [Deinococcus proteolyticus MRP]
          Length = 209

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 120/209 (57%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY +D L P++  +T++ HH  HH+ Y DNA K     E     + ++I   
Sbjct: 1   MAFELPQLPYGFDALEPHIDAQTMQIHHGKHHQAYVDNANKALEGTEWADRDVLDVIQNL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDL 115
                     + NNA  + NH+LFW  +    G+G  P   L DAI   FGSF+ FK   
Sbjct: 61  DSLPADKKGAVRNNAGGHANHSLFWTVLSGKGGEGNQPSGELMDAITSTFGSFDAFKEKF 120

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLD 169
             AA T+FGSGW WL VK+G L +  T N +NPL+  A+      PILG+DVWEHAYYL+
Sbjct: 121 EDAAKTRFGSGWAWLVVKDGALAVVSTANQDNPLMGEAVAGTSGTPILGVDVWEHAYYLN 180

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETA 198
           ++ RR  Y+++F  N+VNW+ V  RY  A
Sbjct: 181 YQNRRPDYLKAFW-NVVNWDEVARRYAEA 208


>gi|325954714|ref|YP_004238374.1| Manganese/iron superoxide dismutase [Weeksella virosa DSM 16922]
 gi|323437332|gb|ADX67796.1| Manganese/iron superoxide dismutase [Weeksella virosa DSM 16922]
          Length = 199

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 124/199 (62%), Gaps = 7/199 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY++D L PY+  +T+E HHD HH  Y +N        ++ + ++EEI+ K 
Sbjct: 1   MSFELKKLPYAFDALEPYIDAKTMEIHHDKHHAAYTNNLNAAIEGTDLANATIEEILAKG 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   +YNHNLFW  M     K  V   ++ AID+ FGSF+ FK +   AA+
Sbjct: 61  TDKPA-VRNNGGGFYNHNLFWDIMTPGGSKQPVGN-VAKAIDEAFGSFDAFKDEFSKAAA 118

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL  K+GK+ +S T N +NPL+  A     PILGIDVWEHAYYL ++ +R  
Sbjct: 119 TRFGSGWAWLVKKDGKVVVSSTPNQDNPLMPVADVQGFPILGIDVWEHAYYLKYQNKRPD 178

Query: 177 YIESFITNLVNWEYVCERY 195
           YIE+F + ++NW+ V E +
Sbjct: 179 YIEAFFS-VINWDKVEELF 196


>gi|239815626|ref|YP_002944536.1| superoxide dismutase [Variovorax paradoxus S110]
 gi|239802203|gb|ACS19270.1| Superoxide dismutase [Variovorax paradoxus S110]
          Length = 193

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 119/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P  SKETLEYH+  HH  Y  N   L    E   + LE+I+ KS
Sbjct: 1   MEHVLPPLPYALDALAPEYSKETLEYHYGKHHNAYVVNLNNLQKGTEFESMPLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW+CMK   G G    AL+ AID  +G+++ FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWSCMKPQGG-GAPTGALAKAIDAKWGNYDAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G  P+L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDTPVLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLAKLVNWDFAAKNF 192


>gi|237752708|ref|ZP_04583188.1| superoxide dismutase [Helicobacter winghamensis ATCC BAA-430]
 gi|229376197|gb|EEO26288.1| superoxide dismutase [Helicobacter winghamensis ATCC BAA-430]
          Length = 206

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 120/196 (61%), Gaps = 8/196 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           FKL  LP++  ++  ++SKET E+H+  HH+ Y +N   L    E  + SL EI+ K+ G
Sbjct: 2   FKLRTLPFT--EIVGFISKETCEFHYGKHHQTYVNNLNNLIKGTEFENKSLFEIVTKAQG 59

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q YNH+ +W C+  N         L +AI+  FGS EKFK   + +A T 
Sbjct: 60  ---GVFNNAAQVYNHDFYWDCVSPNASARSAE--LDEAINATFGSLEKFKETFLNSAVTL 114

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL   NGKLEI +T NA+ P+    IP+L +DVWEHAYY+D +  R  Y+E F 
Sbjct: 115 FGSGWCWLVYNNGKLEIKQTSNAQTPVTESMIPLLVVDVWEHAYYIDHRNARPAYLEKFF 174

Query: 183 TNLVNWEYVCERYETA 198
            N +NWE+V +  E A
Sbjct: 175 -NYINWEFVSKSLERA 189


>gi|329119632|ref|ZP_08248313.1| superoxide dismutase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464229|gb|EGF10533.1| superoxide dismutase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 262

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L P++SKETLEYH+  HH+ Y  N        E  + SLEEI+ K+
Sbjct: 70  MEHKLPELPYALDALEPHLSKETLEYHYGKHHQTYITNLNNQIKGTEFENASLEEIVKKA 129

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+G+   AL++AID  +GSFE F+    T A 
Sbjct: 130 EG---GVFNNAAQTWNHTFYWLGFTP-KGQGRPSGALAEAIDAKWGSFEAFQKAFDTCAV 185

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +G+L++  T NA  PL +G IP+L  DVWEHAYY+D++  R +Y+ 
Sbjct: 186 GTFGSGWAWLVKTPSGELDLVSTSNAATPLNSGNIPLLTCDVWEHAYYIDYRNSRPNYLN 245

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V  R+
Sbjct: 246 GFW-EIVNWDEVARRF 260


>gi|222151447|ref|YP_002560603.1| superoxide dismutase SodA [Macrococcus caseolyticus JCSC5402]
 gi|222120572|dbj|BAH17907.1| superoxide dismutase SodA [Macrococcus caseolyticus JCSC5402]
          Length = 199

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 124/203 (61%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP L Y+YD L P++ KET+E HH  HH  Y        +  E  ++S+E+++ + 
Sbjct: 1   MAFELPKLEYAYDALEPHIDKETMEIHHTKHHNTYVTKLNDAVAGTEFENVSIEDLMKRI 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   +YNH+LFW  +    + KG+V     DAI+  FGS + FK + 
Sbjct: 61  DEVPADKKTAVVNNGGGHYNHSLFWTLLAPGKEAKGEV----VDAIESKFGSLDAFKQEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LE++ T N ENPL+ G  PILG+DVWEHAYYL+++ +R 
Sbjct: 117 ADAAAGRFGSGWAWLVVNNGELEVTSTPNQENPLMEGKTPILGLDVWEHAYYLNYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V E Y +A
Sbjct: 177 DYIAAFW-NVVNWDKVNELYLSA 198


>gi|167835698|ref|ZP_02462581.1| superoxide dismutase [Burkholderia thailandensis MSMB43]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E   L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFESLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI   +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAISAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|34497959|ref|NP_902174.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
 gi|34103814|gb|AAQ60175.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  + SLEEI+ KS
Sbjct: 1   MEHKLPELPYALDALAPHISKETLEFHYGKHHQTYITNLNNLIKGTEFENASLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL+DAI+  +GSF++FK      A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWFGLAPNAG-GQPTGALADAINAKWGSFDEFKKAFTQTAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y+
Sbjct: 117 GTFGSGWAWL-VKNSDGSLDLVSTSNAATPLTTDKKPLLTCDVWEHAYYIDYRNSRPNYL 175

Query: 179 ESFITNLVNWEYVCERY 195
           E F   LVNW++V + +
Sbjct: 176 EHFWA-LVNWDFVAKNF 191


>gi|167590713|ref|ZP_02383101.1| superoxide dismutase [Burkholderia ubonensis Bu]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|319796325|ref|YP_004157965.1| superoxide dismutase [Variovorax paradoxus EPS]
 gi|315598788|gb|ADU39854.1| Superoxide dismutase [Variovorax paradoxus EPS]
          Length = 193

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 119/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P  S+ETLEYH+  HH  Y  N   L    E   L+LEEII K+
Sbjct: 1   MEHKLPPLPYALDALAPEYSQETLEYHYGKHHNAYVVNLNNLQKGTEFEALTLEEIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK   G G    AL+ AID  +GS++ FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMKPQGG-GAPTGALAKAIDAKWGSYDAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADTALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLAKLVNWDFAAKNF 192


>gi|161523933|ref|YP_001578945.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|189351306|ref|YP_001946934.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|221199221|ref|ZP_03572265.1| superoxide dismutase [Burkholderia multivorans CGD2M]
 gi|221205877|ref|ZP_03578892.1| superoxide dismutase [Burkholderia multivorans CGD2]
 gi|221211446|ref|ZP_03584425.1| superoxide dismutase [Burkholderia multivorans CGD1]
 gi|160341362|gb|ABX14448.1| Superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|189335328|dbj|BAG44398.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|221168807|gb|EEE01275.1| superoxide dismutase [Burkholderia multivorans CGD1]
 gi|221174715|gb|EEE07147.1| superoxide dismutase [Burkholderia multivorans CGD2]
 gi|221180506|gb|EEE12909.1| superoxide dismutase [Burkholderia multivorans CGD2M]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  ++ LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENMPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFFWNSLSPNGG-GAPSGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+ NW++  + +
Sbjct: 177 AFW-NIANWDFAAKNF 191


>gi|308275157|emb|CBX31754.1| Superoxide dismutase [Fe] [uncultured Desulfobacterium sp.]
          Length = 255

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII--KSHG 62
           LP LPY+ + LSP +S  T+ +H+  HHK Y DN  KL S  E   L LE+II    S  
Sbjct: 63  LPTLPYADNALSPVISANTVSFHYGKHHKGYVDNLNKLISGTEFADLPLEKIITMTASKA 122

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               +FNNA+Q +NH  +W  +    G G+ P  L   I+ +FG+ +  K +L TAA  Q
Sbjct: 123 DKTAIFNNAAQTWNHTFYWHSLSPKGG-GEPPAVLKKKIEISFGALDACKKELATAAMAQ 181

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL +   KL++ KT NA+ P+  G  P+L IDVWEHAYYLD++ RRA Y+ + +
Sbjct: 182 FGSGWVWLVLDGDKLKVVKTGNADVPITTGIKPLLTIDVWEHAYYLDYQNRRADYVNAVL 241

Query: 183 TNLVNWEYVCE 193
             L+NW +  E
Sbjct: 242 DKLINWNFATE 252


>gi|448837|prf||1918164A superoxide dismutase
          Length = 205

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 122/204 (59%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N    L    ++ + SLEE++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELADAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+ +FGSGW WL V NG+LEI+ T N ++ P++ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPPIMEGKTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N+VNW+ V +RY  A
Sbjct: 180 PEYIAAFW-NVVNWDEVAKRYSEA 202


>gi|307730799|ref|YP_003908023.1| Superoxide dismutase [Burkholderia sp. CCGE1003]
 gi|307585334|gb|ADN58732.1| Superoxide dismutase [Burkholderia sp. CCGE1003]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPTGALADAINAKWGSFDKFKEEFAKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNWE+  + +
Sbjct: 177 AYW-NIVNWEFAAKNF 191


>gi|225010262|ref|ZP_03700734.1| Superoxide dismutase [Flavobacteria bacterium MS024-3C]
 gi|225005741|gb|EEG43691.1| Superoxide dismutase [Flavobacteria bacterium MS024-3C]
          Length = 202

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++   T+E HH  HH+ Y +N     + + M   S+E I+   
Sbjct: 1   MAFELPQLDYAHDALEPHVDARTMEIHHGKHHQGYTNNLNAAIAGSAMEGASIETILADL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   +YNHNLFW  M  N G G     L+ AID +FGSF  FK     AA+
Sbjct: 61  DLNNGAVRNNGGGFYNHNLFWKSMAPN-GGGTPSGDLAAAIDASFGSFNAFKETFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GKLE+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKLEVCSTPNQDNPLMPGIGCGGFPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NW      +E 
Sbjct: 180 DYVNAFF-NVINWSNATALFEA 200


>gi|110597404|ref|ZP_01385691.1| Superoxide dismutase [Chlorobium ferrooxidans DSM 13031]
 gi|110340948|gb|EAT59419.1| Superoxide dismutase [Chlorobium ferrooxidans DSM 13031]
          Length = 200

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L PY+S +TL +H+  HH  Y  N   L +++ +  LSLEE I  +
Sbjct: 1   MAYQQPPLPFAENALEPYISAKTLGFHYGKHHAAYITNYNNLVANSNLDALSLEEAIAIA 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                  G+FNN +Q +NH  +W  +  N G G     L+  I ++FGSF+KFK +L  A
Sbjct: 61  AADPQKIGIFNNGAQAWNHTFYWNSLTPNGG-GLPTGELAAKITEDFGSFDKFKDELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +    L++ KT NA+ PL +G  PIL IDVWEHAYYLDF+ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDGSTLKVVKTGNAQTPLTSGQKPILTIDVWEHAYYLDFQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            S I NL+NWE+    Y+ A
Sbjct: 180 ASVIDNLLNWEFAAANYKAA 199


>gi|134296728|ref|YP_001120463.1| superoxide dismutase [Burkholderia vietnamiensis G4]
 gi|134139885|gb|ABO55628.1| Superoxide dismutase [Burkholderia vietnamiensis G4]
          Length = 192

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  LG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPSGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|311069104|ref|YP_003974027.1| superoxide dismutase [Bacillus atrophaeus 1942]
 gi|310869621|gb|ADP33096.1| superoxide dismutase [Bacillus atrophaeus 1942]
 gi|315423625|gb|ADU17255.1| superoxide dismutase [Bacillus subtilis]
          Length = 202

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +    + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNKAVEGNTAFANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G G+    L++AI   FGSF+KFK   
Sbjct: 61  LNAVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGDLAEAIKSEFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 GAAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|56478313|ref|YP_159902.1| superoxide dismutase (Fe) [Aromatoleum aromaticum EbN1]
 gi|56314356|emb|CAI09001.1| Superoxide dismutase [Fe] [Aromatoleum aromaticum EbN1]
          Length = 195

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ + L+P++S ET+E+H+  HH+ Y  N   L    E  +L LE I+ K+
Sbjct: 1   MEHTLPQLPYAKEALAPHISAETMEFHYGKHHQAYVTNLNNLIKGTEFENLDLEAIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G++NN++Q +NH  FW CMK N G G+   +L+DAI   +GSFE FK    T+A 
Sbjct: 61  PA--GGIYNNSAQVWNHTFFWNCMKPNGG-GEPAGSLADAIKAKWGSFEDFKKAFTTSAV 117

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G  P+L IDVWEHAYY+D++ RR  ++ 
Sbjct: 118 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDEPLLCIDVWEHAYYIDYRNRRPDFVA 177

Query: 180 SFITNLVNWEYVCERY 195
           +F+ NL NW++  + +
Sbjct: 178 AFLNNLANWDFASKNF 193


>gi|289449262|dbj|BAI77484.1| oxidoreductase [Burkholderia sp. AK-5]
          Length = 193

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP+  + L+P+MS+ETLEYH+  HH+ Y  N  KL    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFDKNALAPHMSEETLEYHYGKHHQTYVTNLNKLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A+
Sbjct: 61  SG---GVFNNSAQVWNHTFFWNSLSPKGG-GAPTGALADAINAKYGSFDKFKEEFAKVAT 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T NA  PL   A  +L IDVWEHAYY+D++  R  +IE
Sbjct: 117 GTFGSGWTWLVKKTDGTVDIVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFIE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+ NW++  + +
Sbjct: 177 AYW-NIANWDFAAKNF 191


>gi|332526256|ref|ZP_08402385.1| exodeoxyribonuclease VII, large subunit [Rubrivivax benzoatilyticus
           JA2]
 gi|332110090|gb|EGJ10718.1| exodeoxyribonuclease VII, large subunit [Rubrivivax benzoatilyticus
           JA2]
          Length = 641

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 86/196 (43%), Positives = 117/196 (59%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E   L LEE++ KS
Sbjct: 448 MERTLPPLPYALDALAPHYSRETLEYHHGKHHNAYVVNLNNLQKGTEFEGLELEEVVRKS 507

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK  +G G+   AL+ AI   +GS+  FK   + +A 
Sbjct: 508 SG---GIYNNAAQIWNHTFFWNCMKP-EGGGEPAGALAAAIVAKWGSYAAFKEAFVKSAV 563

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G  P+L +DVWEHAYY+D++  R  ++E
Sbjct: 564 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDTPLLTVDVWEHAYYIDYRNLRPKFVE 623

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW +    Y
Sbjct: 624 TFLDKLVNWSFAEANY 639


>gi|192360362|ref|YP_001983105.1| superoxide dismutase [Cellvibrio japonicus Ueda107]
 gi|190686527|gb|ACE84205.1| superoxide dismutase [Cellvibrio japonicus Ueda107]
          Length = 194

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 120/197 (60%), Gaps = 7/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLE+H+  HHK Y D    L    E    SLE++I  S
Sbjct: 1   MAFELPALPYAKDALAPHISVETLEFHYGKHHKAYVDKLNTLVPGTEFEGKSLEDVIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  +W C+  N G G    A++DAI   FGSFEKFK D   +A 
Sbjct: 61  SGP---VFNNAAQIWNHTFYWHCLSPNGG-GAPTGAVADAITSAFGSFEKFKEDFTNSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G + I  T NA  PL +  + PIL ID+WEHAYY+D++  R  YI
Sbjct: 117 NNFGSSWTWLVKKADGSVAIVNTSNAATPLTDATVTPILTIDLWEHAYYIDYRNARPTYI 176

Query: 179 ESFITNLVNWEYVCERY 195
            +F + LVNW++V   Y
Sbjct: 177 GAFWS-LVNWDFVNANY 192


>gi|167627190|ref|YP_001677690.1| superoxide dismutase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|241667752|ref|ZP_04755330.1| superoxide dismutase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876296|ref|ZP_05249006.1| iron/manganese superoxide dismutase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|167597191|gb|ABZ87189.1| Superoxide dismutase [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|254842317|gb|EET20731.1| iron/manganese superoxide dismutase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 192

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 122/198 (61%), Gaps = 9/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P +SKET+EYH+  HH+ Y  N   L    E    +LEEII  S
Sbjct: 1   MKFELPKLPYAFDALEPTISKETIEYHYGKHHQAYVTNLNNLIEGTEHAGKNLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q YNH  +W C+  +  K +    L  AI + FGS + FK     AA 
Sbjct: 61  SG---GIFNNAAQVYNHTFYWNCL--SPVKTEPSSELKAAIIETFGSIDNFKDQFSKAAV 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL +   P+L  DVWEHAYY+D++  R  Y+
Sbjct: 116 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTDNKKPLLTFDVWEHAYYIDYRNARPKYV 174

Query: 179 ESFITNLVNWEYVCERYE 196
           ES + ++VNW++V E+++
Sbjct: 175 ES-LWDIVNWKFVSEQFK 191


>gi|124267667|ref|YP_001021671.1| superoxide dismutase [Methylibium petroleiphilum PM1]
 gi|124260442|gb|ABM95436.1| Superoxide dismutase [Methylibium petroleiphilum PM1]
          Length = 193

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 118/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKET E+H+  HH+ Y  N   L    E   LSLE+I+ KS
Sbjct: 1   MEHTLPPLPYAMDALAPHLSKETFEFHYGKHHQAYVTNLNNLIKGTEFESLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  MK   G G    AL+ AID  +GS   FK     +A 
Sbjct: 61  SG---GVFNNAAQIWNHTFFWNSMKPQGG-GAPSGALAAAIDAKWGSLAAFKEAFAKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T NA  PL      +L +DVWEHAYY+DF+  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGNAATPLTTADKALLTVDVWEHAYYIDFRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+ +LVNW++  + +
Sbjct: 177 TFLNSLVNWDFAAKNF 192


>gi|319941958|ref|ZP_08016279.1| superoxide dismutase [Sutterella wadsworthensis 3_1_45B]
 gi|319804611|gb|EFW01481.1| superoxide dismutase [Sutterella wadsworthensis 3_1_45B]
          Length = 193

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 120/195 (61%), Gaps = 5/195 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
           +F+LP L ++ D L+P MS ET+EYH+  HH +Y  N   L   +      LEEII    
Sbjct: 3   EFQLPKLDFAPDALAPAMSAETIEYHYGKHHASYVANLNALLKGSAFEGKPLEEII---R 59

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G+  GLFNNA+Q++NH+ FW C+  N G G+   AL  AI+  +GSF+ F +    +A+ 
Sbjct: 60  GAEGGLFNNAAQHFNHSFFWKCLTPNGG-GRPEGALLAAIEKTWGSFDAFVAAFSKSAAG 118

Query: 122 QFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            FGSGW WL  K +G L I  T NA  P+  G  P+L +DVWEHAYY+DF+  R  +IE+
Sbjct: 119 NFGSGWTWLVKKADGTLAIVNTSNAGTPVKQGDKPLLTLDVWEHAYYIDFRNARPKFIET 178

Query: 181 FITNLVNWEYVCERY 195
           F T LVNW++   ++
Sbjct: 179 FFTKLVNWKFAESQF 193


>gi|325571023|ref|ZP_08146595.1| superoxide dismutase [Enterococcus casseliflavus ATCC 12755]
 gi|325156108|gb|EGC68294.1| superoxide dismutase [Enterococcus casseliflavus ATCC 12755]
          Length = 201

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKTVEELLAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  +  N G G+   A+ +AID+ FGSFE FK + 
Sbjct: 61  FSSVPEDIQTAVRNNGGGHANHTFFWEILGPNAG-GEPTGAIKEAIDEAFGSFEDFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL VK+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F + +VNW+ V E +  A
Sbjct: 180 DYINAFWS-VVNWDKVNEYFAKA 201


>gi|83647297|ref|YP_435732.1| superoxide dismutase [Hahella chejuensis KCTC 2396]
 gi|83635340|gb|ABC31307.1| Superoxide dismutase [Hahella chejuensis KCTC 2396]
          Length = 194

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 122/195 (62%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L+P++S+ET+EYH+  HHK Y D    L    E    SLEEII+ S
Sbjct: 1   MAFELPALPYEKNALAPHISEETIEYHYGKHHKTYVDKLNGLVPGTEYEGKSLEEIIVAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  +FNNA+Q +NH  +W C+  N G G+    L+DAI+  FGSFE FK+     A 
Sbjct: 61  --KSGPVFNNAAQIWNHTFYWHCLSPNGG-GEPTGELADAINKTFGSFESFKTQFTDKAV 117

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL VKN  G LEI  T NA  P+ +G   +L +DVWEHAYY+D++  R +Y+
Sbjct: 118 NNFGSAWTWL-VKNADGSLEIFNTSNAGTPMTDGKTALLTVDVWEHAYYIDYRNVRPNYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F  NLVNW++V +
Sbjct: 177 NAFW-NLVNWDFVAK 190


>gi|330816165|ref|YP_004359870.1| Superoxide dismutase-like protein [Burkholderia gladioli BSR3]
 gi|327368558|gb|AEA59914.1| Superoxide dismutase-like protein [Burkholderia gladioli BSR3]
          Length = 252

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 6/195 (3%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY+ + L P +S  T+ +H+  HH+ Y DN  KL +   +   SLE++I++SHG  
Sbjct: 59  LPPLPYAENALEPTISARTIGFHYGKHHRAYFDNLHKLLAGTPLQQASLEQLIMQSHGVP 118

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVP-QALSDAIDDNFGSFEKFKSDLITAAST 121
             A +FNNA+Q +NHN +W  +     +   P + L  AI+  FGS E     L+  +++
Sbjct: 119 EMADVFNNAAQAWNHNFYWNSLAP---EASAPSEKLKAAIERKFGSMEALTKALVATSAS 175

Query: 122 QFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           QFGSGWGWL +  G+L + KT NAE P   GA P+L +DVWEHAYYLD++ RR  Y+ + 
Sbjct: 176 QFGSGWGWLVLDGGELAVVKTGNAETPFTRGAAPLLTVDVWEHAYYLDYQNRRPDYLVAT 235

Query: 182 ITNLVNWEYVCERYE 196
           ++  +NW +    +E
Sbjct: 236 VSRHLNWAFASANFE 250


>gi|76810291|ref|YP_332497.1| superoxide dismutase [Burkholderia pseudomallei 1710b]
 gi|76579744|gb|ABA49219.1| superoxide dismutase [Burkholderia pseudomallei 1710b]
          Length = 221

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L   +E  +L LEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGSEFENLPLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 206 AFW-NIVNWDFAAKNF 220


>gi|254283956|ref|ZP_04958924.1| superoxide dismutase (Fe) [gamma proteobacterium NOR51-B]
 gi|219680159|gb|EED36508.1| superoxide dismutase (Fe) [gamma proteobacterium NOR51-B]
          Length = 192

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 120/192 (62%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L+P++S ETL+YH+  HH+ Y D    L    +    SLE+II  S
Sbjct: 1   MAFELPALPYERDALAPHISSETLDYHYGKHHQTYVDKLNGLVEGTDNAEKSLEDIIKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W C+  N G G+    +++AI+  FGSFE FK     +A 
Sbjct: 61  DG---GLFNNAAQVWNHTFYWHCLSPN-GGGEPTGPIAEAINSTFGSFEAFKEQFTNSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + ++ T NA  P+ +   P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 NNFGSGWTWLVKKADGSIALANTSNAGCPITDDVTPLLTVDVWEHAYYVDYRNARPKYME 176

Query: 180 SFITNLVNWEYV 191
           +F  NLVNW++V
Sbjct: 177 AFW-NLVNWDFV 187


>gi|269139025|ref|YP_003295726.1| superoxide dismutase [Edwardsiella tarda EIB202]
 gi|267984686|gb|ACY84515.1| superoxide dismutase [Edwardsiella tarda EIB202]
 gi|304558959|gb|ADM41623.1| Superoxide dismutase [Edwardsiella tarda FL6-60]
          Length = 192

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L    E    SLEEI+  +
Sbjct: 1   MSFELPALPYAMNALEPHISAETLEYHYGKHHNAYVVNLNNLIKGTEFEGKSLEEIVKSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF  FK  L  +A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPRGALADAINAAFGSFAAFKDALTKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYRNARPVYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNWE+V +
Sbjct: 177 NFWA-LVNWEFVAQ 189


>gi|268316483|ref|YP_003290202.1| Superoxide dismutase [Rhodothermus marinus DSM 4252]
 gi|82659489|gb|ABB88856.1| superoxide dismutase [Rhodothermus sp. XMH10]
 gi|262334017|gb|ACY47814.1| Superoxide dismutase [Rhodothermus marinus DSM 4252]
          Length = 209

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 125/205 (60%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F LP LPY YD L PY+  +T+E HH  HH+ Y +N  K L    E+ + S+EE++  
Sbjct: 1   MAFTLPPLPYPYDALEPYVDAQTMEIHHTKHHQGYVNNLNKALEGYPELQNKSIEELLRG 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  MK N G G+    L++AI   FGSFE FK   
Sbjct: 61  INEIPEAIRTAVRNNGGGHANHSLFWTIMKPNGG-GEPTGELAEAIKATFGSFEAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A+ +FGSGW WL V +NGKL++  T N ++P + G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 SAEAAGRFGSGWAWLVVDENGKLQVYSTPNQDSPYMQGHTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
           A YI+++  N+VNW+ V + Y+ A+
Sbjct: 180 AEYIQNWW-NVVNWDQVAQYYKEAL 203


>gi|118498204|ref|YP_899254.1| iron/manganese superoxide dismutase family protein [Francisella
           tularensis subsp. novicida U112]
 gi|194324387|ref|ZP_03058160.1| superoxide dismutase (Mn/Fe family), C- domain protein [Francisella
           tularensis subsp. novicida FTE]
 gi|254373548|ref|ZP_04989035.1| iron/manganese superoxide dismutase family protein [Francisella
           tularensis subsp. novicida GA99-3549]
 gi|254375013|ref|ZP_04990493.1| hypothetical protein FTDG_01200 [Francisella novicida GA99-3548]
 gi|118424110|gb|ABK90500.1| iron/manganese superoxide dismutase family protein [Francisella
           novicida U112]
 gi|151571273|gb|EDN36927.1| iron/manganese superoxide dismutase family protein [Francisella
           novicida GA99-3549]
 gi|151572731|gb|EDN38385.1| hypothetical protein FTDG_01200 [Francisella novicida GA99-3548]
 gi|194321452|gb|EDX18937.1| superoxide dismutase (Mn/Fe family), C- domain protein [Francisella
           tularensis subsp. novicida FTE]
          Length = 192

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 119/197 (60%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P +SKET+EYH+  HH+ Y  N   L    E    +LEEI+  S
Sbjct: 1   MKFELPKLPYAVDALEPTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 61  TG---GIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+
Sbjct: 116 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYV 174

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW++V E++
Sbjct: 175 EA-LWDIVNWQFVSEQF 190


>gi|222475291|ref|YP_002563707.1| Fe superoxide dismutase (sodB) [Anaplasma marginale str. Florida]
 gi|222419428|gb|ACM49451.1| Fe superoxide dismutase (sodB) [Anaplasma marginale str. Florida]
 gi|295243901|gb|ADF87328.1| Fe superoxide dismutase [Anaplasma marginale]
          Length = 223

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 131/204 (64%), Gaps = 11/204 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAE---MLHLSLEEIIIK 59
           F+LP+LPYS   L PY+S + L+ H++ HHK Y D   KL +  E   M +  LE II+K
Sbjct: 21  FELPSLPYS--SLEPYISDKLLDRHYNGHHKTYVDVLNKLVAGTEFDGMNNSDLEGIIVK 78

Query: 60  SHGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +HGS+A  G+FNNA+Q +NH+ +W  MKK DG G  P  L+  + ++FG  ++F      
Sbjct: 79  THGSSATRGIFNNAAQIWNHDFYWRSMKK-DGGGNPPAKLAKMLKESFGGVQEFADAFAA 137

Query: 118 AASTQFGSGWGWLSVKNG--KLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRR 174
           + +  FGSGW WL    G  KL++  T NA++PL+ +G  P+L +DVWEHAYYLD+   R
Sbjct: 138 SGTGHFGSGWAWLLYDRGSNKLQVVSTPNADSPLLTSGYYPLLTMDVWEHAYYLDYLNVR 197

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             Y++ F+ +L+NW++  +R ETA
Sbjct: 198 KKYVDVFLEHLINWDFALQRLETA 221


>gi|167998538|ref|XP_001751975.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697073|gb|EDQ83410.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 202

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 122/200 (61%), Gaps = 4/200 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
           +F+L  LPY  D L P+MSKETLE+H   HHK Y DN  K     E    +L E+++ ++
Sbjct: 2   EFQLRPLPYELDALEPHMSKETLEFHWGKHHKAYVDNLNKQVEGTEAERQNLSELVLSAY 61

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
             G+    FNNA Q +NH  FW+ M  + G G+    L + I  NF S+++F      AA
Sbjct: 62  NDGNPKAYFNNAGQIWNHEFFWSSMSPSGG-GEPQGELLELISSNFVSYKEFAEQFKRAA 120

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +QFGSGW WL + K+GKLEI KT NA  P++   IP+L +DVWEHAYYLD+  +R  Y+
Sbjct: 121 GSQFGSGWVWLVLRKDGKLEILKTPNALTPIVWDHIPLLVVDVWEHAYYLDYHNQRPKYL 180

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+ NLV+W+ V ER   A
Sbjct: 181 SKFLDNLVSWQAVGERLAQA 200


>gi|254995108|ref|ZP_05277298.1| Fe superoxide dismutase (sodB) [Anaplasma marginale str.
           Mississippi]
 gi|255003274|ref|ZP_05278238.1| Fe superoxide dismutase (sodB) [Anaplasma marginale str. Puerto
           Rico]
 gi|255004403|ref|ZP_05279204.1| Fe superoxide dismutase (sodB) [Anaplasma marginale str. Virginia]
          Length = 204

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 131/204 (64%), Gaps = 11/204 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAE---MLHLSLEEIIIK 59
           F+LP+LPYS   L PY+S + L+ H++ HHK Y D   KL +  E   M +  LE II+K
Sbjct: 2   FELPSLPYS--SLEPYISDKLLDRHYNGHHKTYVDVLNKLVAGTEFDGMNNSDLEGIIVK 59

Query: 60  SHGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +HGS+A  G+FNNA+Q +NH+ +W  MKK DG G  P  L+  + ++FG  ++F      
Sbjct: 60  THGSSATRGIFNNAAQIWNHDFYWRSMKK-DGGGNPPAKLAKMLKESFGGVQEFADAFAA 118

Query: 118 AASTQFGSGWGWLSVKNG--KLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRR 174
           + +  FGSGW WL    G  KL++  T NA++PL+ +G  P+L +DVWEHAYYLD+   R
Sbjct: 119 SGTGHFGSGWAWLLYDRGSNKLQVVSTPNADSPLLTSGYYPLLTMDVWEHAYYLDYLNVR 178

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             Y++ F+ +L+NW++  +R ETA
Sbjct: 179 KKYVDVFLEHLINWDFALQRLETA 202


>gi|317128360|ref|YP_004094642.1| Manganese/iron superoxide dismutase-like protein [Bacillus
           cellulosilyticus DSM 2522]
 gi|315473308|gb|ADU29911.1| Manganese/iron superoxide dismutase-like protein [Bacillus
           cellulosilyticus DSM 2522]
          Length = 202

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/205 (42%), Positives = 127/205 (61%), Gaps = 11/205 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYA---DNALKLASDAEMLHLSLEEII 57
           M F LP LPY++D L+P++ +ET++ HH  HH  Y    ++AL+  SD  +   SLEE++
Sbjct: 1   MAFTLPELPYAHDALTPHIDEETMKIHHGKHHNTYVTKLNDALEGHSD--LQGKSLEELL 58

Query: 58  IK----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
                     +  + NN   ++NH LFW  M  N G G+    L+DAI+  FGSF+KFK 
Sbjct: 59  SNLDALPESIHGAVRNNGGGHFNHTLFWEIMSPNGG-GEPTGELADAINSAFGSFDKFKE 117

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
           +   AA T+FGSGW WL V  GKL ++ T N + P++ G   ILG+DVWEHAYYL ++  
Sbjct: 118 EFKNAALTRFGSGWAWLVVDGGKLTVTSTPNQDTPIMEGKTAILGVDVWEHAYYLKYQNL 177

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R +Y+++F  N+VNWE V +R+  A
Sbjct: 178 RPNYVDAFF-NVVNWEEVAKRFSAA 201


>gi|28899634|ref|NP_799239.1| superoxide dismutase, Mn [Vibrio parahaemolyticus RIMD 2210633]
 gi|260361517|ref|ZP_05774564.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus K5030]
 gi|260879124|ref|ZP_05891479.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus AN-5034]
 gi|260895489|ref|ZP_05903985.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Vibrio parahaemolyticus Peru-466]
 gi|28807886|dbj|BAC61123.1| superoxide dismutase, Mn [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088065|gb|EFO37760.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Vibrio parahaemolyticus Peru-466]
 gi|308091598|gb|EFO41293.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus AN-5034]
 gi|308112838|gb|EFO50378.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus K5030]
          Length = 202

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 121/204 (59%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +E+   SL+EI    
Sbjct: 1   MSHTFPALPYPYDALEPYIDAKTMEVHYSKHHKTYFDKFVTAVQGSELETQSLDEIFAAV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM   +G G+   AL+ AI+D FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHILYWNCMSP-EGGGEPQGALAQAINDKFGHFEKFKDEFAQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGDIHITSTSNQDNPLMDVADVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A++
Sbjct: 180 YIDAWW-NVVNWRAVEENYARALV 202


>gi|300722829|ref|YP_003712121.1| superoxide dismutase, iron [Xenorhabdus nematophila ATCC 19061]
 gi|297629338|emb|CBJ89937.1| superoxide dismutase, iron [Xenorhabdus nematophila ATCC 19061]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 94/197 (47%), Positives = 117/197 (59%), Gaps = 12/197 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y  N   L  D E+   SLEEII  S
Sbjct: 1   MSFELPALPYAKDALEPHISAETLEYHYGKHHNAYVVNLNNLVKDTELAGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGK---GKVPQALSDAIDDNFGSFEKFKSDLIT 117
            G   G+FNNA+Q +NH  +W C+  N G    GKV    +DAI+  FGSF +FK     
Sbjct: 61  EG---GIFNNAAQVWNHTFYWHCLSPNGGSEPTGKV----ADAINSAFGSFAEFKQQFTD 113

Query: 118 AASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           AA   FGSGW WL  K +  L I  T NA  PL     P+L +DVWEHAYY+D++  R  
Sbjct: 114 AALKNFGSGWTWLVKKTDDNLAIVNTSNAATPLTGEDKPVLTVDVWEHAYYIDYRNARPQ 173

Query: 177 YIESFITNLVNWEYVCE 193
           Y+E F   LVNW++V E
Sbjct: 174 YLEHFWA-LVNWKFVEE 189


>gi|145589566|ref|YP_001156163.1| superoxide dismutase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047972|gb|ABP34599.1| Superoxide dismutase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLEYH+  HH+ Y  N   L    E   LSLE+II KS
Sbjct: 1   MEHTLPPLPYALDALAPHISKETLEYHYGKHHQAYVTNLNNLIKGTEFEALSLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               AG+FNNA+Q +NH  +W  +K N G G     L+DAI+  +GSF+KFK +    A 
Sbjct: 61  A---AGVFNNAAQVWNHTFYWNSLKPNGG-GAPTGPLADAINAKWGSFDKFKEEFNKCAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D +  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDTRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++    +
Sbjct: 177 NFW-NVVNWDFASSNF 191


>gi|7798571|dbj|BAA95631.1| superoxide dismutase [Geobacillus thermoleovorans]
          Length = 204

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N    L    ++ + SLEE++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGG-GEPTGELAEAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +F  GW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFSPGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +RY  A
Sbjct: 180 EYIAAFW-NIVNWDEVAKRYSEA 201


>gi|120554940|ref|YP_959291.1| superoxide dismutase [Marinobacter aquaeolei VT8]
 gi|120324789|gb|ABM19104.1| Superoxide dismutase [Marinobacter aquaeolei VT8]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S+ETLEYH+  HH  Y      L    E  + SLE+II  +
Sbjct: 1   MAFELPALPYEKNALEPHISQETLEYHYGKHHNTYVTKLNGLVEGTENANKSLEDIIKSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    LFNNA+Q +NH  +W C+  N G G+   A  +AI+  FGSFE FK +    A+
Sbjct: 61  SGP---LFNNAAQVWNHTFYWHCLSPNGG-GEPTGAAKEAIEKAFGSFEDFKKEFNDKAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + I+ T NAE PL     P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 NNFGSGWTWLVKKADGSVAIANTSNAETPLTGADKPVLTVDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F  NLVNW++V E
Sbjct: 177 AFW-NLVNWDFVNE 189


>gi|297795915|ref|XP_002865842.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297311677|gb|EFH42101.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 305

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 126/216 (58%), Gaps = 20/216 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P+MS+ETL+YH   HH+ Y +N  K     ++  L LEE+++ S+ 
Sbjct: 53  FELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLPLEEVVLLSYN 112

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  ++   G GK    L   I+ +FGSFE+F     +AA+
Sbjct: 113 RGNMLPAFNNAAQAWNHEFFWESIQPGGG-GKPTGELPRLIERDFGSFEEFLERFKSAAA 171

Query: 121 TQFGSGWGWLSVKNGKLEIS-----------------KTQNAENPLINGAIPILGIDVWE 163
           + FGSGW WL+ K  +L+++                 KT NA NPL+    P+L ID WE
Sbjct: 172 SNFGSGWTWLAYKANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWE 231

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           HAYYLDF+ RRA YI +F+  LV+WE V  R E+AM
Sbjct: 232 HAYYLDFENRRAEYINTFMERLVSWETVSTRLESAM 267


>gi|167561820|ref|ZP_02354736.1| superoxide dismutase [Burkholderia oklahomensis EO147]
 gi|167569043|ref|ZP_02361917.1| superoxide dismutase [Burkholderia oklahomensis C6786]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQTYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPQGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|238792295|ref|ZP_04635930.1| Superoxide dismutase [Fe] [Yersinia intermedia ATCC 29909]
 gi|238728532|gb|EEQ20051.1| Superoxide dismutase [Fe] [Yersinia intermedia ATCC 29909]
          Length = 192

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTEFAGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI+ +FGSF +FK+    AA 
Sbjct: 61  NG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVADAINQSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTTDKPVLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|53725863|ref|YP_103834.1| superoxide dismutase [Burkholderia mallei ATCC 23344]
 gi|52429286|gb|AAU49879.1| superoxide dismutase [Burkholderia mallei ATCC 23344]
          Length = 221

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 206 AFW-NIVNWDFAAKNF 220


>gi|208780231|ref|ZP_03247573.1| superoxide dismutase (Mn/Fe family), C- domain protein [Francisella
           novicida FTG]
 gi|208743880|gb|EDZ90182.1| superoxide dismutase (Mn/Fe family), C- domain protein [Francisella
           novicida FTG]
 gi|332678939|gb|AEE88068.1| Superoxide dismutase Fe [Francisella cf. novicida Fx1]
          Length = 192

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 119/197 (60%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P +SKET+EYH+  HH+ Y  N   L    E    +LEEI+  S
Sbjct: 1   MKFELPKLPYAVDALEPTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGKNLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 61  TG---GIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+
Sbjct: 116 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYV 174

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW++V E++
Sbjct: 175 EA-LWDIVNWQFVSEQF 190


>gi|325299355|ref|YP_004259272.1| Manganese/iron superoxide dismutase [Bacteroides salanitronis DSM
           18170]
 gi|324318908|gb|ADY36799.1| Manganese/iron superoxide dismutase [Bacteroides salanitronis DSM
           18170]
          Length = 191

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 121/195 (62%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   +P LPY+ + L+PYMS+ETLEYH+  H + Y DN  KL +     +++LE+II K+
Sbjct: 1   MKHSMPQLPYTMEALAPYMSQETLEYHYGKHLQTYVDNLNKLIAGTPFENMTLEDIIRKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  F+  +     +  +P  L   + ++FGS E FK +    A+
Sbjct: 61  DG---GIFNNAAQTWNHTFFFETLTPR--QTAMPDKLVQKLTEDFGSPEAFKQEFTQKAT 115

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL+    GKL I    NA NPL  G  PIL +DVWEHAYY+D++ RRA +IE
Sbjct: 116 TLFGSGWVWLTEDTQGKLSIQTEPNAGNPLTKGMKPILVLDVWEHAYYIDYRNRRAAFIE 175

Query: 180 SFITNLVNWEYVCER 194
           +F  NL +WE V  R
Sbjct: 176 AFW-NLTDWEKVALR 189


>gi|229180552|ref|ZP_04307894.1| Superoxide dismutase [Bacillus cereus 172560W]
 gi|228602976|gb|EEK60455.1| Superoxide dismutase [Bacillus cereus 172560W]
          Length = 203

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 119/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
              G    + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEGIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|119390689|pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e
           At 1.1 Angstrom Resolution
 gi|119390690|pdb|2NYB|B Chain B, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e
           At 1.1 Angstrom Resolution
 gi|119390691|pdb|2NYB|C Chain C, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e
           At 1.1 Angstrom Resolution
 gi|119390692|pdb|2NYB|D Chain D, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e
           At 1.1 Angstrom Resolution
 gi|126030142|pdb|2BKB|A Chain A, Q69e-Fesod
 gi|126030143|pdb|2BKB|B Chain B, Q69e-Fesod
 gi|126030144|pdb|2BKB|C Chain C, Q69e-Fesod
 gi|126030145|pdb|2BKB|D Chain D, Q69e-Fesod
          Length = 192

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 119/193 (61%), Gaps = 8/193 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S G
Sbjct: 2   FELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA++ +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA   
Sbjct: 62  ---GVFNNAAEVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAIKN 117

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E 
Sbjct: 118 FGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEH 176

Query: 181 FITNLVNWEYVCE 193
           F   LVNWE+V +
Sbjct: 177 FWA-LVNWEFVAK 188


>gi|160899011|ref|YP_001564593.1| superoxide dismutase [Delftia acidovorans SPH-1]
 gi|160364595|gb|ABX36208.1| Superoxide dismutase [Delftia acidovorans SPH-1]
          Length = 193

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 121/196 (61%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  +++LEEI+ KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+DAI+  +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPNGG-GEPTGALADAINKKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTEDKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLGQLVNWKFAEQNF 192


>gi|238757736|ref|ZP_04618919.1| Superoxide dismutase [Fe] [Yersinia aldovae ATCC 35236]
 gi|238703979|gb|EEP96513.1| Superoxide dismutase [Fe] [Yersinia aldovae ATCC 35236]
          Length = 192

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLE+I+  S
Sbjct: 1   MSFELPILPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFADKSLEDIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI++ FGSF +FK+    AA 
Sbjct: 61  SG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPSGKVAEAINNTFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTADKPVLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|120437698|ref|YP_863384.1| superoxide dismutase [Mn] [Gramella forsetii KT0803]
 gi|117579848|emb|CAL68317.1| superoxide dismutase [Mn] [Gramella forsetii KT0803]
          Length = 202

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y           +M   ++E I+   
Sbjct: 1   MSFELPKLKYAFDALEPHIDAKTMEIHHGKHHAGYTKKLNAAIEGTDMDGKNIENILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH+LFW  M   DG GK    L+ AID  +GSFE FK +   AA+
Sbjct: 61  DKSNKAVRNNGGGFYNHSLFWEIMSP-DGGGKPEGELASAIDAAYGSFEAFKEEFSKAAA 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V N GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 GQFGSGWAWLCVHNGGKVEVCSTPNQDNPLMPEVGCGGAPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N+++W+ V  RY  A
Sbjct: 180 EYIDAFF-NVIDWKEVSSRYAKA 201


>gi|323495119|ref|ZP_08100205.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
 gi|323310620|gb|EGA63798.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
          Length = 205

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 122/203 (60%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D  +    D+E+   +L +I  + 
Sbjct: 1   MSHTFPELPYTYDALEPYIDAKTMEVHYSKHHRTYYDKFIAAIKDSELESTNLSDIFAQI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM  N G G    AL+ AI+D FGSF +F+     AA 
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWNCMAPN-GGGTPSGALAQAINDTFGSFAEFQDQFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G+L IS T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGQLLISSTTNQDNPLMDVAEVQGEPILALDVWEHAYYISYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI+++  N+VNW+ V E Y  A+
Sbjct: 180 YIDAWW-NVVNWDAVSEFYAVAL 201


>gi|225621115|ref|YP_002722373.1| superoxide dismutase [Brachyspira hyodysenteriae WA1]
 gi|225215935|gb|ACN84669.1| superoxide dismutase [Brachyspira hyodysenteriae WA1]
          Length = 194

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 117/194 (60%), Gaps = 6/194 (3%)

Query: 8   LPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKSH--GSN 64
           LPY  +DL+PYMS  TL++HH  H   Y      L S D+ +   S+EE+I  SH     
Sbjct: 3   LPYGKEDLAPYMSSNTLDFHHGKHLNTYVTTLNDLVSKDSSLQGKSIEELITLSHNNADK 62

Query: 65  AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFG 124
             +FNNA Q YNH  F+  +KK+     +P  +   I+ +FGSF+ FK    T   TQFG
Sbjct: 63  QAVFNNAGQVYNHEEFFKMLKKDVA---IPAEVKSKIEADFGSFDAFKEAFTTGGKTQFG 119

Query: 125 SGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITN 184
           SGW WL + NGKLE+ K  NA NP+ +    +L  DVWEHAYYLD++ RR  ++ +F+ +
Sbjct: 120 SGWVWLVINNGKLEVRKYANAMNPVADKVHGVLTCDVWEHAYYLDYQNRRPDFLTTFVDH 179

Query: 185 LVNWEYVCERYETA 198
           LVNW+YV ER + A
Sbjct: 180 LVNWDYVAERIKLA 193


>gi|307110195|gb|EFN58431.1| hypothetical protein CHLNCDRAFT_140393 [Chlorella variabilis]
          Length = 204

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 128/200 (64%), Gaps = 6/200 (3%)

Query: 1   MDFKLPNLPYSYDDL-SPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHL-SLEEIII 58
           M F LP LPY+ D L S  MSK+T E+H+  HH  Y +N     +  E+ +  S+ E+++
Sbjct: 1   MAFTLPPLPYAMDALESKGMSKQTFEFHYGKHHAAYLNNLNGQVAGKELANAASVHEVML 60

Query: 59  KS-HGSNAGL-FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
            + +G   G  FNNA+Q  NH  FW  M  + G       +++AI+ + G ++KF     
Sbjct: 61  ATWNGGKPGPEFNNAAQVINHTFFWESMSPSGGGKPG-GKVAEAIEKDLGGYDKFVEAFK 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A +TQFGSGW WLSV K GKLE+SKT NAENP ++GA PIL +DVWEHAYYLD + RR 
Sbjct: 120 AAGATQFGSGWAWLSVGKEGKLEVSKTANAENPWVHGATPILTLDVWEHAYYLDVQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            +I +FI+NL++W+ V +RY
Sbjct: 180 DFISNFISNLIDWQRVEQRY 199


>gi|308067487|ref|YP_003869092.1| superoxide dismutase [Paenibacillus polymyxa E681]
 gi|305856766|gb|ADM68554.1| Superoxide dismutase [Paenibacillus polymyxa E681]
          Length = 204

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+ D L P++   T+E HHD HH  Y  N    L S  E+   SLE++I  
Sbjct: 1   MAFQLPELPYAKDALEPHIDALTVEIHHDRHHNTYVTNLNAALESAPELQSKSLEDLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+LFW  +  N G G+   A+++AI++  G ++KFK D 
Sbjct: 61  LDSVPESIRTAVRNNGGGHHNHSLFWEVIAPNGG-GQPTGAIAEAINNELGGYDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V K+GKL I+ T N ++PL  G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVGKDGKLAITSTPNQDSPLFEGLTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N++NW+ V +RY  A
Sbjct: 180 PDYIAAFY-NVINWDEVNKRYAAA 202


>gi|254258617|ref|ZP_04949671.1| superoxide dismutase [Burkholderia pseudomallei 1710a]
 gi|254217306|gb|EET06690.1| superoxide dismutase [Burkholderia pseudomallei 1710a]
          Length = 192

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L   +E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGSEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|171323164|ref|ZP_02911764.1| Superoxide dismutase [Burkholderia ambifaria MEX-5]
 gi|171091442|gb|EDT37105.1| Superoxide dismutase [Burkholderia ambifaria MEX-5]
          Length = 192

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPSGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|34557910|ref|NP_907725.1| superoxide dismutase [Wolinella succinogenes DSM 1740]
 gi|34483628|emb|CAE10625.1| SUPEROXIDE DISMUTASE [Wolinella succinogenes]
          Length = 209

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (61%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F L  LP+    ++ ++S+ETL+YHH  HH  Y +N   L  + E    SL +II KS G
Sbjct: 2   FTLRKLPFEAQQVASFISQETLDYHHGKHHAAYVNNLNNLTKEGEFSASSLWDIIQKSQG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q +NH+ +W C+       ++P+ L  A+   FGS E FK   + AA+T 
Sbjct: 62  ---GIFNNAAQVFNHDFYWDCIAT--APQEIPEKLKLALKAGFGSVEAFKEAYLKAATTL 116

Query: 123 FGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           FGSGW WL +   GKLEI +TQNA  PL +G IP+L  DVWEHAYY+DF+  R  Y++ F
Sbjct: 117 FGSGWAWLVLDLEGKLEIVQTQNAATPLTSGKIPLLVCDVWEHAYYVDFRNARPGYLDKF 176

Query: 182 ITNLVNWEYVCERYETAM 199
             + +NW++V + YE  +
Sbjct: 177 WES-INWDFVTKNYELGL 193


>gi|319793938|ref|YP_004155578.1| superoxide dismutase [Variovorax paradoxus EPS]
 gi|315596401|gb|ADU37467.1| Superoxide dismutase [Variovorax paradoxus EPS]
          Length = 193

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 118/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P  SKETLEYH+  HH  Y  N   L    E   L+LEEII K+
Sbjct: 1   MEHVLPPLPYALDALAPEYSKETLEYHYGKHHNAYVVNLNNLQKGTEFEALTLEEIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK   G G    AL+ AID  +GS++ FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMKPQGG-GAPTGALAKAIDAKWGSYDAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADTALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLAKLVNWDFAAKNF 192


>gi|257867782|ref|ZP_05647435.1| manganese superoxide dismutase [Enterococcus casseliflavus EC30]
 gi|257874109|ref|ZP_05653762.1| manganese superoxide dismutase [Enterococcus casseliflavus EC10]
 gi|257876670|ref|ZP_05656323.1| manganese superoxide dismutase [Enterococcus casseliflavus EC20]
 gi|3320377|gb|AAC26483.1| manganese superoxide dismutase [Vibrio alginolyticus]
 gi|257801865|gb|EEV30768.1| manganese superoxide dismutase [Enterococcus casseliflavus EC30]
 gi|257808273|gb|EEV37095.1| manganese superoxide dismutase [Enterococcus casseliflavus EC10]
 gi|257810836|gb|EEV39656.1| manganese superoxide dismutase [Enterococcus casseliflavus EC20]
          Length = 201

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKTVEELLAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  +  N G G+   A+ +AI++ FGSFE FK + 
Sbjct: 61  FSSVPEDIQTAVRNNGGGHANHTFFWEILGPNAG-GEPTGAIKEAIEETFGSFEDFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL VK+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F + +VNW+ V E +  A
Sbjct: 180 DYINAFWS-VVNWDKVNEYFAKA 201


>gi|49259339|pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259340|pdb|1UES|B Chain B, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259341|pdb|1UES|C Chain C, Crystal Structure Of Porphyromonas Gingivalis Sod
 gi|49259342|pdb|1UES|D Chain D, Crystal Structure Of Porphyromonas Gingivalis Sod
          Length = 191

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L +LPY+ D L+P +SKET+E+HH  H K Y DN  KL    E  +  L  I+ KS
Sbjct: 1   MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
            G   G+FNNA Q  NHNL++   +   GKG  P+  L +AID  FGSFEKFK +  TA 
Sbjct: 61  EG---GIFNNAGQTLNHNLYFTQFRP--GKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAG 115

Query: 120 STQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +T FGSGW WL S  NGKL I K  NA NP+  G  P+L  DVWEHAYYL ++ RRA ++
Sbjct: 116 TTLFGSGWVWLASDANGKLSIEKEPNAGNPVRKGLNPLLTFDVWEHAYYLTYQNRRADHL 175

Query: 179 ESFITNLVNWEYVCERY 195
           +  + ++V+W+ V  RY
Sbjct: 176 KD-LWSIVDWDIVESRY 191


>gi|170693528|ref|ZP_02884687.1| Superoxide dismutase [Burkholderia graminis C4D1M]
 gi|170141683|gb|EDT09852.1| Superoxide dismutase [Burkholderia graminis C4D1M]
          Length = 192

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPTGALADAINAKWGSFDKFKEEFAKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  ++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALITIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNWE+  + +
Sbjct: 177 AYW-NIVNWEFASKNF 191


>gi|198277630|ref|ZP_03210161.1| hypothetical protein BACPLE_03853 [Bacteroides plebeius DSM 17135]
 gi|198269327|gb|EDY93597.1| hypothetical protein BACPLE_03853 [Bacteroides plebeius DSM 17135]
          Length = 190

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 122/195 (62%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  + L+P MSKETLEYH+  H + Y DN  KL         +LE+I++++
Sbjct: 1   MKHLLPELPYQLEALAPKMSKETLEYHYGKHLQTYIDNLNKLIVGTPYEEKTLEQILLEA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  F+  +     + ++PQ L+DA+  +FGS E FK     AA+
Sbjct: 61  EGP---MFNNAAQTWNHTFFFDTLTPQ--QPEMPQPLADALTRDFGSVETFKEKFTQAAT 115

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL S K+G L I    NA NPL  G  P+L IDVWEHAYY+D++ RRA +IE
Sbjct: 116 TLFGSGWTWLVSDKDGHLSIVSESNAGNPLKKGLKPLLVIDVWEHAYYIDYRNRRAAFIE 175

Query: 180 SFITNLVNWEYVCER 194
           +F T LV+W+ V  R
Sbjct: 176 AFWT-LVDWQKVAAR 189


>gi|296333339|ref|ZP_06875792.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675156|ref|YP_003866828.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296149537|gb|EFG90433.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413400|gb|ADM38519.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 202

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL+D I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPN-GGGEPTGALADDINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|270158352|ref|ZP_06187009.1| superoxide dismutase (Fe) [Legionella longbeachae D-4968]
 gi|289163406|ref|YP_003453544.1| superoxide dismutase, iron [Legionella longbeachae NSW150]
 gi|269990377|gb|EEZ96631.1| superoxide dismutase (Fe) [Legionella longbeachae D-4968]
 gi|288856579|emb|CBJ10384.1| superoxide dismutase, iron [Legionella longbeachae NSW150]
          Length = 192

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ + L P++S ETLEYH+  HH+ Y  N  KL    E   + LEEII  S
Sbjct: 1   MTFTLPELPYAKNALEPHISSETLEYHYGKHHQAYVTNLNKLIPGTEFESMKLEEIIKNS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI+  FGSF+ FK      A 
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPQGKVAEAINKYFGSFDSFKEKFTQTAI 116

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   + G+L+I  T NA  P+  G   +L  DVWEHAYY+D++  R  Y+ 
Sbjct: 117 TTFGSGWAWLVQDSAGELKIISTSNAGTPMTEGLTALLTCDVWEHAYYIDYRNARPDYVT 176

Query: 180 SFITNLVNWEYVCE 193
           +F  NLVNW++V +
Sbjct: 177 AFW-NLVNWDFVAD 189


>gi|186475308|ref|YP_001856778.1| superoxide dismutase [Burkholderia phymatum STM815]
 gi|184191767|gb|ACC69732.1| Superoxide dismutase [Burkholderia phymatum STM815]
          Length = 192

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E   LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFESLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNSAQVWNHTFFWNSLSPQGG-GAPKGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNW +  + +
Sbjct: 177 AYW-NIVNWAFAEKNF 191


>gi|53718519|ref|YP_107505.1| putative superoxide dismutase [Burkholderia pseudomallei K96243]
 gi|67641288|ref|ZP_00440070.1| superoxide dismutase (Fe) [Burkholderia mallei GB8 horse 4]
 gi|121598701|ref|YP_991914.1| superoxide dismutase [Burkholderia mallei SAVP1]
 gi|124384132|ref|YP_001027029.1| superoxide dismutase [Burkholderia mallei NCTC 10229]
 gi|126440422|ref|YP_001057981.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 668]
 gi|126451400|ref|YP_001081678.1| superoxide dismutase [Burkholderia mallei NCTC 10247]
 gi|126454128|ref|YP_001065214.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 1106a]
 gi|134279848|ref|ZP_01766560.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 305]
 gi|167003946|ref|ZP_02269724.1| superoxide dismutase [Burkholderia mallei PRL-20]
 gi|167718410|ref|ZP_02401646.1| superoxide dismutase [Burkholderia pseudomallei DM98]
 gi|167737459|ref|ZP_02410233.1| superoxide dismutase [Burkholderia pseudomallei 14]
 gi|167814577|ref|ZP_02446257.1| superoxide dismutase [Burkholderia pseudomallei 91]
 gi|167823048|ref|ZP_02454519.1| superoxide dismutase [Burkholderia pseudomallei 9]
 gi|167844610|ref|ZP_02470118.1| superoxide dismutase [Burkholderia pseudomallei B7210]
 gi|167893143|ref|ZP_02480545.1| superoxide dismutase [Burkholderia pseudomallei 7894]
 gi|167905705|ref|ZP_02492910.1| superoxide dismutase [Burkholderia pseudomallei NCTC 13177]
 gi|167909840|ref|ZP_02496931.1| superoxide dismutase [Burkholderia pseudomallei 112]
 gi|167917866|ref|ZP_02504957.1| superoxide dismutase [Burkholderia pseudomallei BCC215]
 gi|217419967|ref|ZP_03451473.1| superoxide dismutase [Burkholderia pseudomallei 576]
 gi|226192852|ref|ZP_03788465.1| superoxide dismutase [Burkholderia pseudomallei Pakistan 9]
 gi|237811129|ref|YP_002895580.1| superoxide dismutase (Fe) [Burkholderia pseudomallei MSHR346]
 gi|242317972|ref|ZP_04816988.1| superoxide dismutase [Burkholderia pseudomallei 1106b]
 gi|254175464|ref|ZP_04882124.1| superoxide dismutase [Burkholderia mallei ATCC 10399]
 gi|254187489|ref|ZP_04894001.1| superoxide dismutase, Fe [Burkholderia pseudomallei Pasteur 52237]
 gi|254196245|ref|ZP_04902669.1| superoxide dismutase, Fe [Burkholderia pseudomallei S13]
 gi|254202539|ref|ZP_04908902.1| superoxide dismutase [Burkholderia mallei FMH]
 gi|254207876|ref|ZP_04914226.1| superoxide dismutase [Burkholderia mallei JHU]
 gi|254296391|ref|ZP_04963848.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|254298215|ref|ZP_04965667.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|254356228|ref|ZP_04972504.1| superoxide dismutase [Burkholderia mallei 2002721280]
 gi|52208933|emb|CAH34872.1| putative superoxide dismutase [Burkholderia pseudomallei K96243]
 gi|121227511|gb|ABM50029.1| superoxide dismutase [Burkholderia mallei SAVP1]
 gi|124292152|gb|ABN01421.1| superoxide dismutase [Burkholderia mallei NCTC 10229]
 gi|126219915|gb|ABN83421.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 668]
 gi|126227770|gb|ABN91310.1| superoxide dismutase [Burkholderia pseudomallei 1106a]
 gi|126244270|gb|ABO07363.1| superoxide dismutase [Burkholderia mallei NCTC 10247]
 gi|134249048|gb|EBA49130.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 305]
 gi|147746786|gb|EDK53863.1| superoxide dismutase [Burkholderia mallei FMH]
 gi|147751770|gb|EDK58837.1| superoxide dismutase [Burkholderia mallei JHU]
 gi|148025225|gb|EDK83379.1| superoxide dismutase [Burkholderia mallei 2002721280]
 gi|157805858|gb|EDO83028.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|157808109|gb|EDO85279.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|157935169|gb|EDO90839.1| superoxide dismutase, Fe [Burkholderia pseudomallei Pasteur 52237]
 gi|160696508|gb|EDP86478.1| superoxide dismutase [Burkholderia mallei ATCC 10399]
 gi|169652988|gb|EDS85681.1| superoxide dismutase, Fe [Burkholderia pseudomallei S13]
 gi|217397271|gb|EEC37287.1| superoxide dismutase [Burkholderia pseudomallei 576]
 gi|225935102|gb|EEH31076.1| superoxide dismutase [Burkholderia pseudomallei Pakistan 9]
 gi|237503404|gb|ACQ95722.1| superoxide dismutase (Fe) [Burkholderia pseudomallei MSHR346]
 gi|238522197|gb|EEP85643.1| superoxide dismutase (Fe) [Burkholderia mallei GB8 horse 4]
 gi|242141211|gb|EES27613.1| superoxide dismutase [Burkholderia pseudomallei 1106b]
 gi|243060596|gb|EES42782.1| superoxide dismutase [Burkholderia mallei PRL-20]
          Length = 192

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|120601870|ref|YP_966270.1| superoxide dismutase [Desulfovibrio vulgaris DP4]
 gi|120562099|gb|ABM27843.1| Superoxide dismutase [Desulfovibrio vulgaris DP4]
          Length = 238

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F +P LPY    L P +S  T+ +H+  H   Y  N  K  +   M  + LE+++    G
Sbjct: 41  FPMPPLPYPDTALEPAISARTISFHYGKHTAAYYANLNKAVASTPMATMRLEDVVKSVAG 100

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + AGLFNNA+Q +NH  +WA MK   G G  P  ++DA+  +FGS E     L  AA 
Sbjct: 101 DPAKAGLFNNAAQSWNHTFYWAGMKPGGG-GTPPAKVADALKASFGSVEACIEQLSEAAK 159

Query: 121 TQFGSGWGWLS--VKNGK--LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TQF SGW WL+   +NGK  L++ KT NA+NP+  G  P+L IDVWEHAYYLD++ +R  
Sbjct: 160 TQFASGWAWLAKGTENGKPVLKVMKTSNADNPMTQGLTPVLTIDVWEHAYYLDYQNKRPD 219

Query: 177 YIESFITNLVNWEYVCER 194
           Y+++F   LVNW+ V  R
Sbjct: 220 YVKAFFEKLVNWDEVATR 237


>gi|156935949|ref|YP_001439865.1| superoxide dismutase [Cronobacter sakazakii ATCC BAA-894]
 gi|156534203|gb|ABU79029.1| hypothetical protein ESA_03843 [Cronobacter sakazakii ATCC BAA-894]
          Length = 211

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 127/209 (60%), Gaps = 17/209 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+ +L +EE+I K
Sbjct: 6   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPELANLPVEELITK 65

Query: 60  SHGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSD 114
                A     L NNA  + NH+LFW  +KK    G   Q  L  AI+ +FGS EKFK +
Sbjct: 66  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK----GTTLQGDLKAAIERDFGSVEKFKEE 121

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYL 168
              AA+T+FGSGW WL +K  KL +  T N ++PL+  AI      PILG+DVWEHAYYL
Sbjct: 122 FEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGYPILGLDVWEHAYYL 181

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            F+ RR  YI+ F  N+VNW+    R+ +
Sbjct: 182 KFQNRRPDYIKEFW-NVVNWDEAAARFAS 209


>gi|225012048|ref|ZP_03702485.1| Superoxide dismutase [Flavobacteria bacterium MS024-2A]
 gi|225003603|gb|EEG41576.1| Superoxide dismutase [Flavobacteria bacterium MS024-2A]
          Length = 202

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 119/200 (59%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+L Y+YD L P +   T+E HH  HH  Y  N     +   +   S+EEI+   
Sbjct: 1   MAFELPSLSYAYDALEPNIDSRTMEIHHSKHHNGYTTNLNNAIAGTPLADQSIEEILKGL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   YYNH LFW  M  N G G     L+ AID  FGSF+ FKS+   AA+
Sbjct: 61  DLNNKAVRNNGGGYYNHRLFWNIMSPN-GGGLPTGTLATAIDSAFGSFDNFKSEFAKAAA 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V  +G +++  T N +NPL+     G  PILGIDVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHVDGTVKVCATANQDNPLMPGIGCGGTPILGIDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI++F  N+++W  V E +
Sbjct: 180 DYIQAFF-NVIDWNKVNELF 198


>gi|311234519|gb|ADP87373.1| Superoxide dismutase [Desulfovibrio vulgaris RCH1]
          Length = 238

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F +P LPY    L P +S  T+ +H+  H   Y  N  K  +   M  + LE+++    G
Sbjct: 41  FPMPPLPYPDTALEPAISARTISFHYGKHTAAYYANLNKAVAGTPMATMRLEDVVKSVAG 100

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + AGLFNNA+Q +NH  +WA MK   G G  P  ++DA+  +FGS E     L  AA 
Sbjct: 101 DPAKAGLFNNAAQSWNHTFYWAGMKPGGG-GTPPAKVADALKASFGSVEACMEQLSEAAK 159

Query: 121 TQFGSGWGWLS--VKNGK--LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TQF SGW WL+   +NGK  L++ KT NA+NP+  G  P+L IDVWEHAYYLD++ +R  
Sbjct: 160 TQFASGWAWLAKGTENGKPVLKVMKTGNADNPMTQGLTPVLTIDVWEHAYYLDYQNKRPD 219

Query: 177 YIESFITNLVNWEYVCER 194
           Y+++F   LVNW+ V  R
Sbjct: 220 YVKAFFEKLVNWDEVATR 237


>gi|304569722|ref|YP_011623.2| superoxide dismutase, Fe [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 228

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F +P LPY    L P +S  T+ +H+  H   Y  N  K  +   M  + LE+++    G
Sbjct: 31  FPMPPLPYPDTALEPAISARTISFHYGKHTAAYYANLNKAVAGTPMATMRLEDVVKSVAG 90

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + AGLFNNA+Q +NH  +WA MK   G G  P  ++DA+  +FGS E     L  AA 
Sbjct: 91  DPAKAGLFNNAAQSWNHTFYWAGMKPGGG-GTPPAKVADALKASFGSVEACMEQLSEAAK 149

Query: 121 TQFGSGWGWLS--VKNGK--LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TQF SGW WL+   +NGK  L++ KT NA+NP+  G  P+L IDVWEHAYYLD++ +R  
Sbjct: 150 TQFASGWAWLAKGTENGKPVLKVMKTGNADNPMTQGLTPVLTIDVWEHAYYLDYQNKRPD 209

Query: 177 YIESFITNLVNWEYVCER 194
           Y+++F   LVNW+ V  R
Sbjct: 210 YVKAFFEKLVNWDEVATR 227


>gi|220898261|gb|ACL81495.1| FeSOD [Ginkgo biloba]
          Length = 239

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKS 60
           F+L   PYS+D L P+MSK T E+H   HH+ Y DN  K     E+   +L ++I    S
Sbjct: 41  FELKPPPYSFDALEPHMSKRTFEFHWGKHHRAYVDNLNKQIEGTELEGYTLGDVIKATYS 100

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G     FNNA+Q +NH  FW CM    GK    + L   I+ +FGS+++F  +   AA+
Sbjct: 101 NGEPQPAFNNAAQAWNHEFFWECMSPGGGKKPGGEILK-LIEKDFGSYDEFLKEFKQAAA 159

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL +K+ KL + K+ NA NPLI G  P+L IDVWEHAYYLD++ RR  YI  
Sbjct: 160 TQFGSGWAWLVLKDKKLVVEKSPNAINPLIWGHTPLLTIDVWEHAYYLDYQNRRPDYISV 219

Query: 181 FITNLVNWEYVCERYETA 198
           F+  LV+W+ V  R + A
Sbjct: 220 FMNELVSWDGVNARLDRA 237


>gi|91788805|ref|YP_549757.1| superoxide dismutase [Polaromonas sp. JS666]
 gi|91698030|gb|ABE44859.1| Superoxide dismutase [Polaromonas sp. JS666]
          Length = 193

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P+ S+E  EYHH  HH  Y  N   L    E   ++LEEII KS
Sbjct: 1   MEHKLPPLPYAIDALAPHYSQEAFEYHHGKHHNAYVVNLNNLQKGTEFEAMTLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK   G G+   AL+ AI+  FGS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMKPAGG-GEPSGALAAAINAKFGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVRKADGSVDIVNTGPAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F++N+VNW + 
Sbjct: 177 TFLSNMVNWGFA 188


>gi|46203613|ref|ZP_00051264.2| COG0605: Superoxide dismutase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 147

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (67%), Gaps = 1/148 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLQGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G+ P  L+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGG-GQPPAELAKKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENP 148
            QFGSGW WL+VK+GKL I KT N ENP
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENP 147


>gi|27468158|ref|NP_764795.1| superoxide dismutase SodA [Staphylococcus epidermidis ATCC 12228]
 gi|57867086|ref|YP_188695.1| superoxide dismutase [Staphylococcus epidermidis RP62A]
 gi|242242825|ref|ZP_04797270.1| superoxide dismutase SodA [Staphylococcus epidermidis W23144]
 gi|251810970|ref|ZP_04825443.1| superoxide dismutase SodA [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876021|ref|ZP_06284888.1| superoxide dismutase, Mn [Staphylococcus epidermidis SK135]
 gi|293366486|ref|ZP_06613163.1| superoxide dismutase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|81674475|sp|Q5HNZ5|SODM_STAEQ RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|82583696|sp|P0C0Q6|SODM_STAES RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|15825381|gb|AAL09677.1|AF410177_1 superoxide dismutase [Staphylococcus epidermidis]
 gi|27315704|gb|AAO04839.1|AE016748_73 superoxide dismutase SodA [Staphylococcus epidermidis ATCC 12228]
 gi|57637744|gb|AAW54532.1| superoxide dismutase [Staphylococcus epidermidis RP62A]
 gi|242233726|gb|EES36038.1| superoxide dismutase SodA [Staphylococcus epidermidis W23144]
 gi|251805480|gb|EES58137.1| superoxide dismutase SodA [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295046|gb|EFA87573.1| superoxide dismutase, Mn [Staphylococcus epidermidis SK135]
 gi|291319255|gb|EFE59624.1| superoxide dismutase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319400889|gb|EFV89108.1| superoxide dismutase [Mn] [Staphylococcus epidermidis FRI909]
 gi|329725361|gb|EGG61844.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU144]
 gi|329735276|gb|EGG71568.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU045]
 gi|329737118|gb|EGG73372.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU028]
          Length = 199

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 122/200 (61%), Gaps = 10/200 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LPNLPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+  +
Sbjct: 1   MAFELPNLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  SN    + NN   + NH+LFW  +  N + KG+V     D I + +GS ++FK + 
Sbjct: 61  DSVPSNIQTAVRNNGGGHLNHSLFWELLSPNSEEKGEV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNWE V E Y
Sbjct: 177 DYINAFW-NVVNWEKVNELY 195


>gi|306447497|gb|ADM87596.1| manganese superoxide dismutase [Bacillus sp. MHS47]
          Length = 203

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 119/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH LFW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTLFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|93278547|pdb|1ZA5|A Chain A, Q69h-Fesod
 gi|93278548|pdb|1ZA5|B Chain B, Q69h-Fesod
          Length = 192

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 118/194 (60%), Gaps = 8/194 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S 
Sbjct: 1   SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSE 60

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA+  +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA  
Sbjct: 61  G---GVFNNAAHVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAIK 116

Query: 122 QFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            FGSGW WL VKN  GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 NFGSGWTWL-VKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 175

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 176 HFWA-LVNWEFVAK 188


>gi|330818107|ref|YP_004361812.1| Superoxide dismutase [Burkholderia gladioli BSR3]
 gi|327370500|gb|AEA61856.1| Superoxide dismutase [Burkholderia gladioli BSR3]
          Length = 192

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S ET+++H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISAETIQFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPQGG-GAPTGALGDAINAKWGSFDAFKEAFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|310640254|ref|YP_003945012.1| superoxide dismutase [Paenibacillus polymyxa SC2]
 gi|309245204|gb|ADO54771.1| Superoxide dismutase [Paenibacillus polymyxa SC2]
          Length = 204

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 124/204 (60%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY+ D L P+    T+E HHD HH  Y  N    L S  E+   SLE++I  
Sbjct: 1   MAFQLPELPYAKDALEPHFDALTMEIHHDRHHNTYVTNLNAALESAPELQSKSLEDLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+LFW  +  N G G+   A+++AI++  G ++KFK D 
Sbjct: 61  LDSVPESIRTAVRNNGGGHHNHSLFWEVIGPNGG-GQPTGAIAEAINNELGGYDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V K+GKL I+ T N ++PL  G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVGKDGKLAITSTPNQDSPLFEGLTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N++NW+ V +RY  A
Sbjct: 180 PDYIAAFY-NVINWDEVNKRYAAA 202


>gi|51596623|ref|YP_070814.1| superoxide dismutase [Yersinia pseudotuberculosis IP 32953]
 gi|153948255|ref|YP_001400731.1| superoxide dismutase [Yersinia pseudotuberculosis IP 31758]
 gi|186895679|ref|YP_001872791.1| superoxide dismutase [Yersinia pseudotuberculosis PB1/+]
 gi|51589905|emb|CAH21537.1| superoxide dismutase [Fe] [Yersinia pseudotuberculosis IP 32953]
 gi|152959750|gb|ABS47211.1| superoxide dismutase (Fe) [Yersinia pseudotuberculosis IP 31758]
 gi|186698705|gb|ACC89334.1| manganese and iron superoxide dismutase [Yersinia
           pseudotuberculosis PB1/+]
          Length = 192

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 119/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y +N   L  D E    SLEEI+  +
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVNNLNNLIKDTEFAGKSLEEIVKTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    +++AI+ +FGSF +FK+    AA 
Sbjct: 61  NG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKIAEAINKSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW + 
Sbjct: 177 NFWA-LVNWSFA 187


>gi|226310606|ref|YP_002770500.1| superoxide dismutase [Mn] [Brevibacillus brevis NBRC 100599]
 gi|226093554|dbj|BAH41996.1| superoxide dismutase [Mn] [Brevibacillus brevis NBRC 100599]
          Length = 202

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M  +LP LPY+++ L P++  +T+E HH  HH  Y +N    L + A++   S+EE+I  
Sbjct: 1   MAHQLPALPYAHNALEPHIDAQTMEIHHGRHHATYVNNLNAALEAHADLQGKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  M  N G G     L+DAI+  FGSF+ FK++ 
Sbjct: 61  LDALPESIRTAVRNNGGGHANHTLFWEIMSPNGG-GAPTGELADAINAAFGSFDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL+ + GK+ IS T N ++P++ G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 AKAATTRFGSGWAWLTAEGGKVAISSTPNQDSPIMEGKTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V +R+  A
Sbjct: 180 DYIGAFW-NVVNWDEVSKRFAAA 201


>gi|260222816|emb|CBA32762.1| Superoxide dismutase [Fe] [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 193

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 118/196 (60%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P  S+ETLE+HH  HH  Y  N   L    E   +SLEEII KS
Sbjct: 1   MEHTLPPLPYAIDALAPAYSQETLEFHHGKHHNAYVVNLNNLQKGTEFESMSLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK   G G+   AL+ AI+  +GS+  FK   + +A 
Sbjct: 61  SG---GVYNNAAQIWNHTFFWNCMKPQGG-GEPTGALAAAINAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADTALLTVDVWEHAYYIDYRNMRPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F+  LVNW++  + +
Sbjct: 177 TFLDKLVNWDFAAKNF 192


>gi|330825500|ref|YP_004388803.1| Superoxide dismutase [Alicycliphilus denitrificans K601]
 gi|329310872|gb|AEB85287.1| Superoxide dismutase [Alicycliphilus denitrificans K601]
          Length = 193

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 119/192 (61%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  +++LEEI+ KS
Sbjct: 1   MEHKLPALPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+ AI+  +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMTPNGG-GEPGGALAAAINAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|254507783|ref|ZP_05119914.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus 16]
 gi|219549308|gb|EED26302.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus 16]
          Length = 194

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    SLEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDFRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F   LVNW++V E
Sbjct: 177 NAFWA-LVNWDFVAE 190


>gi|120611237|ref|YP_970915.1| superoxide dismutase [Acidovorax citrulli AAC00-1]
 gi|120589701|gb|ABM33141.1| Superoxide dismutase [Acidovorax citrulli AAC00-1]
          Length = 194

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  ++ LEEII KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMPLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+DAI   +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPNGG-GEPSGALADAIKAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|56416924|ref|YP_153998.1| Fe superoxide dismutase [Anaplasma marginale str. St. Maries]
 gi|56388156|gb|AAV86743.1| Fe superoxide dismutase [Anaplasma marginale str. St. Maries]
          Length = 223

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 130/204 (63%), Gaps = 11/204 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAE---MLHLSLEEIIIK 59
           F+LP+LPYS   L PY+S + L+ H++ HHK Y D   KL +  E   M +  LE II+K
Sbjct: 21  FELPSLPYS--SLEPYISDKLLDRHYNGHHKTYVDVLNKLVAGTEFDGMNNSDLEGIIVK 78

Query: 60  SHGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
            HGS+A  G+FNNA+Q +NH+ +W  MKK DG G  P  L+  + ++FG  ++F      
Sbjct: 79  IHGSSATRGIFNNAAQIWNHDFYWRSMKK-DGGGNPPAKLAKMLKESFGGVQEFADAFAA 137

Query: 118 AASTQFGSGWGWLSVKNG--KLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRR 174
           + +  FGSGW WL    G  KL++  T NA++PL+ +G  P+L +DVWEHAYYLD+   R
Sbjct: 138 SGTGHFGSGWAWLLYDRGSNKLQVVSTPNADSPLLTSGYYPLLTMDVWEHAYYLDYLNVR 197

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             Y++ F+ +L+NW++  +R ETA
Sbjct: 198 KKYVDVFLEHLINWDFALQRLETA 221


>gi|224476661|ref|YP_002634267.1| superoxide dismutase [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|75531945|sp|Q9F326|SODM_STACA RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|11121341|emb|CAC14833.1| superoxide dismutase [Staphylococcus carnosus]
 gi|222421268|emb|CAL28082.1| superoxide dismutase [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 201

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 124/204 (60%), Gaps = 11/204 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LPNLPY +D L PY+ KET+E HHD HH  Y           ++ + S+EEI+  +
Sbjct: 1   MAFELPNLPYEFDALEPYIDKETMEIHHDKHHNTYVTKLNAAIEGTDLENKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  S+    + NN   + NH+LFW  +  N + KG V     D I + +GS +KFK + 
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWQLLTPNSEEKGTV----IDKIKEEWGSLDKFKDEF 116

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A+ QFGSGW WL V K+GKLEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R
Sbjct: 117 AKKAAGQFGSGWAWLVVDKDGKLEIVSTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKR 176

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI++F  N+VNW  V E YE A
Sbjct: 177 PDYIDAFW-NVVNWNKVDELYEAA 199


>gi|312837924|gb|ADR01109.1| Fe superoxide dismutase 1 [Brassica rapa]
          Length = 195

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 122/194 (62%), Gaps = 3/194 (1%)

Query: 10  YSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL-- 67
           Y  D L P+MSK+TLE+H   HH+ Y DN  K    +E+    LE II  ++ +   L  
Sbjct: 1   YPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQNTYNNGDLLPP 60

Query: 68  FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGW 127
           FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+GW
Sbjct: 61  FNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYDEFNAAAATQFGAGW 119

Query: 128 GWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVN 187
            WL+  + KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+ NLV+
Sbjct: 120 AWLAYADNKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMNNLVS 179

Query: 188 WEYVCERYETAMLA 201
           WE V  R E A  A
Sbjct: 180 WEAVSSRLEAAKAA 193


>gi|326317447|ref|YP_004235119.1| superoxide dismutase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374283|gb|ADX46552.1| Superoxide dismutase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 194

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/192 (44%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  ++ LEEII KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMPLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+DAI   +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPNGG-GEPSGALADAIKAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|260595953|ref|YP_003208524.1| superoxide dismutase [Cronobacter turicensis z3032]
 gi|260215130|emb|CBA26912.1| Superoxide dismutase [Mn] [Cronobacter turicensis z3032]
          Length = 206

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 127/209 (60%), Gaps = 17/209 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+ +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPELANLPVEELIAK 60

Query: 60  SHGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSD 114
                A     L NNA  + NH+LFW  +KK    G   Q  L  AI+ +FGS EKFK +
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK----GTTLQGDLKAAIERDFGSVEKFKEE 116

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYL 168
              AA+T+FGSGW WL +K  KL +  T N ++PL+  AI      PILG+DVWEHAYYL
Sbjct: 117 FEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGYPILGLDVWEHAYYL 176

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            F+ RR  YI+ F  N+VNW+    R+ +
Sbjct: 177 KFQNRRPDYIKEFW-NVVNWDEAAARFAS 204


>gi|167381526|ref|XP_001735760.1| superoxide dismutase [Fe] [Entamoeba dispar SAW760]
 gi|165902189|gb|EDR28078.1| superoxide dismutase [Fe] [Entamoeba dispar SAW760]
          Length = 190

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+Y+ L P++SKETLE+HHD HH  Y +    L    E  H +LEE+I + 
Sbjct: 1   MSFQLPQLPYAYNALEPHISKETLEFHHDKHHATYVNKLNGLVKGTEQEHKTLEELIKQK 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVP-QALSDAIDDNFGSFEKFKSDLITAA 119
                 ++NNA+Q +NH  +W CM    G G  P + L+  +   FG  E+FK      A
Sbjct: 61  --PTQAIYNNAAQAWNHAFYWKCM---CGCGVKPSEQLTAKLTAAFGGLEEFKKKFTEKA 115

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
              FGSGW WL   +GKLEI  T +A NP+ NG  P+L  DVWEHAYY+D +  RA Y+E
Sbjct: 116 VGHFGSGWCWLVEHDGKLEIIDTHDAINPMTNGMKPLLTCDVWEHAYYIDTRNNRAAYLE 175

Query: 180 SFITNLVNWEYVCER 194
            +  N+VNW++V E+
Sbjct: 176 HWW-NVVNWKFVEEQ 189


>gi|323527164|ref|YP_004229317.1| Superoxide dismutase [Burkholderia sp. CCGE1001]
 gi|323384166|gb|ADX56257.1| Superoxide dismutase [Burkholderia sp. CCGE1001]
          Length = 192

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G     L+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPTGVLADAINAKWGSFDKFKEEFAKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNWE+  + +
Sbjct: 177 AYW-NIVNWEFASKNF 191


>gi|262200005|ref|YP_003271214.1| superoxide dismutase [Haliangium ochraceum DSM 14365]
 gi|262083352|gb|ACY19321.1| Superoxide dismutase [Haliangium ochraceum DSM 14365]
          Length = 197

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 127/198 (64%), Gaps = 7/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++SKET++YH+  HH+ Y +       +     LS++E++ K 
Sbjct: 1   MAFELPKLPYAEDALEPHISKETIQYHYGKHHQGYVNKVNAAVENTPNADLSIDELVRKV 60

Query: 61  HGSNAG---LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
            G +AG   LFN+A+Q +NH  +W C+  N G G+   A+++AI+ +FGSF  FKS    
Sbjct: 61  AG-DAGSKKLFNSAAQVWNHTFYWNCLSPNGG-GEPTGAIAEAINKSFGSFADFKSKFSD 118

Query: 118 AASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           AA+ QFGSGW WL    +G + I  T +AE P+  G   +L IDVWEHAYY+D++  R  
Sbjct: 119 AAAGQFGSGWAWLIKGDDGGVSIVTTSDAETPMAEGKTCVLTIDVWEHAYYVDYRNARPK 178

Query: 177 YIESFITNLVNWEYVCER 194
           YIE+F  N+VNW++V ++
Sbjct: 179 YIEAFW-NIVNWDFVNQQ 195


>gi|153840059|ref|ZP_01992726.1| superoxide dismutase (Mn) [Vibrio parahaemolyticus AQ3810]
 gi|149746355|gb|EDM57404.1| superoxide dismutase (Mn) [Vibrio parahaemolyticus AQ3810]
          Length = 202

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 121/204 (59%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +++   SL+EI    
Sbjct: 1   MSHTFPALPYPYDALEPYIDAKTMEVHYSKHHKTYFDKFVTAVQGSDLETQSLDEIFAAV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM   +G G+   AL+ AI+D FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHILYWNCMSP-EGGGEPQGALAQAINDKFGHFEKFKDEFAQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGDIHITSTSNQDNPLMDVADVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A++
Sbjct: 180 YIDAWW-NVVNWRAVEENYARALV 202


>gi|254181531|ref|ZP_04888128.1| superoxide dismutase [Burkholderia pseudomallei 1655]
 gi|184212069|gb|EDU09112.1| superoxide dismutase [Burkholderia pseudomallei 1655]
          Length = 192

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINVKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|319763305|ref|YP_004127242.1| superoxide dismutase [Alicycliphilus denitrificans BC]
 gi|317117866|gb|ADV00355.1| Superoxide dismutase [Alicycliphilus denitrificans BC]
          Length = 193

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 119/191 (62%), Gaps = 5/191 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  +++LEEI+ KS
Sbjct: 1   MEHKLPALPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+ AI+  +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMTPNGG-GEPGGALAAAINAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEY 190
           +F+  LVNW++
Sbjct: 177 TFLDKLVNWKF 187


>gi|297584608|ref|YP_003700388.1| Superoxide dismutase [Bacillus selenitireducens MLS10]
 gi|297143065|gb|ADH99822.1| Superoxide dismutase [Bacillus selenitireducens MLS10]
          Length = 202

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 127/207 (61%), Gaps = 15/207 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE----EI 56
           M F LP LPY+++ L P++ +ET++ HH  HH  Y     KL +DA   H  LE    E 
Sbjct: 1   MAFTLPELPYAHNALEPHIDEETMKIHHGKHHNTYV---TKL-NDAISGHADLESKSIED 56

Query: 57  IIKSHGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKF 111
           ++K+  S        + NN   + NH +FW  M  N G G     ++ AID+ FGSF+KF
Sbjct: 57  LVKNLNSLPDSVKGPVRNNGGGHLNHTMFWTLMSPN-GGGAPTGDVAAAIDEAFGSFDKF 115

Query: 112 KSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFK 171
           K +   AA T+FGSGW WL V NGKLE++ T N +NP+ +G  PILG+DVWEHAYYL ++
Sbjct: 116 KEEFKNAALTRFGSGWAWLVVNNGKLEVTSTPNQDNPITDGKTPILGVDVWEHAYYLKYQ 175

Query: 172 YRRAHYIESFITNLVNWEYVCERYETA 198
            +R  Y+++F  N+VNW+ V E Y+ A
Sbjct: 176 NKRPDYVDAFF-NVVNWDKVNELYKDA 201


>gi|148260185|ref|YP_001234312.1| superoxide dismutase [Acidiphilium cryptum JF-5]
 gi|146401866|gb|ABQ30393.1| Superoxide dismutase [Acidiphilium cryptum JF-5]
          Length = 201

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 127/199 (63%), Gaps = 9/199 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALK--LASDAEMLHLSLEEII 57
           M F+LP LPY++  L+ + M +ETLE HH  HH+ Y   AL   +  +A++   SLEEI+
Sbjct: 1   MAFELPALPYAHAALAAHGMCQETLELHHGKHHQAYV-TALNGFVEKNADLQGKSLEEIV 59

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             ++     A +FNNA Q++NHNLFW CM   DG GK+P  L   + ++FG   +FK   
Sbjct: 60  AFTYNKADLAPVFNNAGQHWNHNLFWQCMSPTDG-GKLPGRLEAKLAEDFGGVAQFKDAF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLING-AIPILGIDVWEHAYYLDFKYR 173
            TA +TQFGSGW WL +   GKL ++KT N  NP+  G   P+LG+DVWEH+YYLDF+ R
Sbjct: 119 KTAGTTQFGSGWAWLILTPGGKLAVTKTPNGSNPVATGEGKPLLGLDVWEHSYYLDFRNR 178

Query: 174 RAHYIESFITNLVNWEYVC 192
           R  YI++++ NL N+ +  
Sbjct: 179 RPDYIQNWLDNLANYAHAA 197


>gi|332283950|ref|YP_004415861.1| superoxide dismutase [Pusillimonas sp. T7-7]
 gi|330427903|gb|AEC19237.1| superoxide dismutase [Pusillimonas sp. T7-7]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 119/193 (61%), Gaps = 6/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P +SKETLEYH+  HH++Y  N   L +  E    SLEE++ KS
Sbjct: 1   MAFTLPPLPYALDALAPTISKETLEYHYGKHHQSYVTNLNNLVAGTEFESSSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL DAI+  +GS + FK     +A+
Sbjct: 61  SG---GIFNNAAQIWNHTFYWNSLSPNGG-GEPSGALLDAINAKWGSVDGFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL    +P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLDIVNTSNAATPLTTSDVPLLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVC 192
           SF   +VNW++  
Sbjct: 177 SFWA-IVNWDFAA 188


>gi|255534102|ref|YP_003094474.1| Superoxide dismutase [Pedobacter heparinus DSM 2366]
 gi|255347086|gb|ACU06412.1| Superoxide dismutase [Pedobacter heparinus DSM 2366]
          Length = 201

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ K+T+E HH  HH+ Y  N  K          S+EEI+   
Sbjct: 1   MAFELPALPYATDALEPHIDKQTMEIHHGKHHQAYVTNLNKALEGKPEASQSIEEIVKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH+LFW  +  N G G+    L+DAI+  FGSF  FK+    A +
Sbjct: 61  SKFPAAVRNNGGGHFNHSLFWEVIGPNKG-GEPTGELADAINAAFGSFADFKTKFAEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WLSV  + KL +S T N +NPL++ A     PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLSVGADKKLVVSSTPNQDNPLMDIAEVKGTPILGMDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F + +VNW+ V ER++ A
Sbjct: 180 DYIAAFWS-VVNWDAVAERFKKA 201


>gi|91785011|ref|YP_560217.1| superoxide dismutase [Burkholderia xenovorans LB400]
 gi|91688965|gb|ABE32165.1| Superoxide dismutase [Burkholderia xenovorans LB400]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ K+
Sbjct: 1   MEHTLPPLPFAKNALVPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPSGALADAINARWGSFDKFKEEFAKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKPDGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNWE+  + +
Sbjct: 177 AYW-NIVNWEFASKNF 191


>gi|238749427|ref|ZP_04610932.1| Superoxide dismutase [Fe] [Yersinia rohdei ATCC 43380]
 gi|238712082|gb|EEQ04295.1| Superoxide dismutase [Fe] [Yersinia rohdei ATCC 43380]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (60%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    +LEEII  S
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++ I+ +FGSF +FK+    AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSPNGG-GEPTGKVAEVINKSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAATPLTTQDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   LVNW +V
Sbjct: 177 NFWA-LVNWSFV 187


>gi|15241373|ref|NP_199923.1| FSD2 (FE SUPEROXIDE DISMUTASE 2); superoxide dismutase [Arabidopsis
           thaliana]
 gi|8843846|dbj|BAA97372.1| unnamed protein product [Arabidopsis thaliana]
 gi|21537292|gb|AAM61633.1| Fe-superoxide dismutase precursor [Arabidopsis thaliana]
 gi|28393352|gb|AAO42100.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 gi|28827610|gb|AAO50649.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 gi|110737010|dbj|BAF00460.1| hypothetical protein [Arabidopsis thaliana]
 gi|332008651|gb|AED96034.1| Fe superoxide dismutase 2 [Arabidopsis thaliana]
          Length = 305

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/216 (42%), Positives = 127/216 (58%), Gaps = 20/216 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P+MS+ETL+YH   HHK Y +N  K     ++  LSLEE+++ S+ 
Sbjct: 53  FELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVVLLSYN 112

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  ++   G GK    L   I+ +FGSFE+F     +AA+
Sbjct: 113 KGNMLPAFNNAAQAWNHEFFWESIQPGGG-GKPTGELLRLIERDFGSFEEFLERFKSAAA 171

Query: 121 TQFGSGWGWLSVKNGKLEIS-----------------KTQNAENPLINGAIPILGIDVWE 163
           + FGSGW WL+ K  +L+++                 KT NA NPL+    P+L ID WE
Sbjct: 172 SNFGSGWTWLAYKANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWE 231

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           HAYYLDF+ RRA YI +F+  LV+WE V  R E+A+
Sbjct: 232 HAYYLDFENRRAEYINTFMEKLVSWETVSTRLESAI 267


>gi|5880381|gb|AAD54651.1|AF085191_1 manganese superoxide dismutase Mn-SOD [Vibrio parahaemolyticus]
          Length = 200

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 6   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 65

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    AA 
Sbjct: 66  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDAAI 121

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 122 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 181

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 182 NGFWA-LVNWDFVAE 195


>gi|28898892|ref|NP_798497.1| manganese superoxide dismutase Mn-SOD [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28807111|dbj|BAC60381.1| manganese superoxide dismutase Mn-SOD [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 199

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 6   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 65

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    AA 
Sbjct: 66  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDAAI 121

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 122 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 181

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 182 NGFWA-LVNWDFVAE 195


>gi|296157201|ref|ZP_06840037.1| Superoxide dismutase [Burkholderia sp. Ch1-1]
 gi|295892537|gb|EFG72319.1| Superoxide dismutase [Burkholderia sp. Ch1-1]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 122/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ K+
Sbjct: 1   MEHTLPPLPFAKNALVPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPSGALADAINAKWGSFDKFKEEFAKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKPDGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNWE+  + +
Sbjct: 177 AYW-NIVNWEFASKNF 191


>gi|298715494|emb|CBJ28064.1| manganese superoxide dismutase [Ectocarpus siliculosus]
          Length = 300

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 120/201 (59%), Gaps = 13/201 (6%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + LP+LPYSYD L PY+   T+++HHD HH  Y  NA K LA       L L++  IK+ 
Sbjct: 93  YNLPDLPYSYDALEPYIDAATMKFHHDKHHAAYVGNANKALAGKTAPSLLDLQKDAIKT- 151

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
               G+ N    +YNH LFW  +  ++  G     L+ AID+ FGS ++ K+   T A+ 
Sbjct: 152 ----GVRNAGGGHYNHCLFWNTLCNHESSGAPSGTLAKAIDEAFGSMDEMKAQFGTTAAG 207

Query: 122 QFGSGWGWLSV-KNGKLEISKTQNAENPLINGA-----IPILGIDVWEHAYYLDFKYRRA 175
            FGSGW WL    +GKL I+ T N +NPL+ GA     +PILG+DVWEHAYYL ++ RR 
Sbjct: 208 VFGSGWAWLGCTPDGKLAITGTPNQDNPLMEGAAGTAMVPILGLDVWEHAYYLKYQNRRP 267

Query: 176 HYIESFITNLVNWEYVCERYE 196
            YI +F  N+VNW  V E YE
Sbjct: 268 EYISAFW-NVVNWAVVSENYE 287


>gi|295677490|ref|YP_003606014.1| Superoxide dismutase [Burkholderia sp. CCGE1002]
 gi|295437333|gb|ADG16503.1| Superoxide dismutase [Burkholderia sp. CCGE1002]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNSAQVWNHTFFWNSLSPQGG-GAPTGALADAINAKWGSFDKFKEEFAKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNW++  + +
Sbjct: 177 AYW-NIVNWDFAAKNF 191


>gi|300310498|ref|YP_003774590.1| superoxide dismutase [Fe] protein [Herbaspirillum seropedicae SmR1]
 gi|124483466|emb|CAM32606.1| Superoxide dismutase [Fe] protein [Herbaspirillum seropedicae]
 gi|300073283|gb|ADJ62682.1| superoxide dismutase [Fe] protein [Herbaspirillum seropedicae SmR1]
          Length = 192

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L+P +SKETLEYH+  HH+ Y  N   L    E  +LSLEEII KS
Sbjct: 1   MAHTLPALPYDLDALAPTISKETLEYHYGKHHQTYVTNLNNLIPGTEFENLSLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +    G+G    AL+DAI+  +GSF+ FK++      
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNGLTPK-GQGAPSGALADAINAKWGSFDAFKAEFTKQGL 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T  A  PL   + P+L +DVWEHAYY+D++  RA Y+E
Sbjct: 117 ANFGSGWTWLVKKADGTLDIVNTTGAGTPLTTDSKPLLTVDVWEHAYYIDYRNARAKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++   ++NW++V + +
Sbjct: 177 NYW-GIINWDFVAKNF 191


>gi|257455801|ref|ZP_05621027.1| superoxide dismutase [Enhydrobacter aerosaccus SK60]
 gi|257446815|gb|EEV21832.1| superoxide dismutase [Enhydrobacter aerosaccus SK60]
          Length = 208

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 121/196 (61%), Gaps = 5/196 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKSHG 62
           LP+LPY+ + L P++S ETLE+HHD HH  Y +   +L   + +    L+EII       
Sbjct: 6   LPDLPYAKNGLEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKELDEIIKATADDS 65

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S A +FN A+Q +NH  +W C+  N G G+    L   I++ FGS+ KF+ +   AA +Q
Sbjct: 66  SKATIFNQAAQVWNHTFYWNCLTANGG-GEPTGDLKAKIEEAFGSYAKFREEFKNAAVSQ 124

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL   +  GKL I KT NA+ PL +  + +L  DVWEHAYY+D++ RR  Y+++
Sbjct: 125 FGSGWAWLVADSVGGKLSIIKTANADTPLAHNQVAVLTCDVWEHAYYIDYRNRRPDYVDT 184

Query: 181 FITNLVNWEYVCERYE 196
           F+  LVNW+Y   +Y+
Sbjct: 185 FLDKLVNWDYANAKYK 200


>gi|228941439|ref|ZP_04103990.1| Superoxide dismutase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228974370|ref|ZP_04134939.1| Superoxide dismutase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228980963|ref|ZP_04141266.1| Superoxide dismutase [Bacillus thuringiensis Bt407]
 gi|228778754|gb|EEM27018.1| Superoxide dismutase [Bacillus thuringiensis Bt407]
 gi|228785420|gb|EEM33430.1| Superoxide dismutase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228818220|gb|EEM64294.1| Superoxide dismutase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326942057|gb|AEA17953.1| superoxide dismutase (Mn) [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 203

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 119/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P++ KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHLDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|328554238|gb|AEB24730.1| superoxide dismutase [Bacillus amyloliquefaciens TA208]
 gi|328912635|gb|AEB64231.1| Superoxide dismutase [Bacillus amyloliquefaciens LL3]
          Length = 201

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 120/202 (59%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NN   + NH+LFW  +  N G G+    L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGG-GEPTGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F  N+VNW+ V   Y  A
Sbjct: 180 YISAFW-NVVNWDEVARLYSEA 200


>gi|147733225|sp|Q4ULI1|SODF_RICFE RecName: Full=Superoxide dismutase [Mn/Fe]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYDKESFKPHFTPETFDYHHGKHHNAYVQNLNNLLKDKEELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH+ FW  +K   G GK    + + I+ +FGSFE F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHSFFWHSIKPQGG-GKPSGKILEQINKDFGSFEGFCEQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ NG  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLVYHDNRLQIIKTANAGTPIANGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWKFV 203


>gi|150850|gb|AAA25651.1| superoxide dismutase [Porphyromonas gingivalis]
          Length = 191

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 124/197 (62%), Gaps = 8/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L +LPY+   L+P +SKET+E+HH  H K Y DN  KL    E  +  L  I+ KS
Sbjct: 1   MTHELISLPYAVYALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
            G   G+FNNA Q  NHNL++   +   GKG  P+  L +AID  FGSFEKFK +  TA 
Sbjct: 61  EG---GIFNNAGQTLNHNLYFTQFRP--GKGGAPKGKLGEAIDKQFGSFEKFKEEFDTAG 115

Query: 120 STQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +T FGSGW WL S  NGKL I K  NA NP+  G  P+LG DVWEHAYYL ++ RRA ++
Sbjct: 116 TTLFGSGWVWLASDANGKLSIEKEPNAGNPVRKGLNPLLGFDVWEHAYYLTYQNRRADHL 175

Query: 179 ESFITNLVNWEYVCERY 195
           +  + ++V+W+ V  RY
Sbjct: 176 KD-LWSIVDWDIVESRY 191


>gi|21554867|gb|AAM63713.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
          Length = 263

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (59%), Gaps = 8/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + L   PY  D L PYMS+ TLE H   HH+ Y DN  K L  D  +   ++EE+I  ++
Sbjct: 50  YGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATY 109

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            +   L  FNNA+Q YNH+ FW  M+   G G  PQ  + + ID +FGSF  F+     A
Sbjct: 110 NNGNPLPEFNNAAQVYNHDFFWESMQP--GGGDTPQKGVLEQIDKDFGSFTNFREKFTNA 167

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL +K    +LE+ KT NA NPL+   IPI+ +DVWEH+YYLD+K  RA+
Sbjct: 168 ALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAN 227

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F+ +LV+W     R   A
Sbjct: 228 YINTFLNHLVSWNAAMSRMARA 249


>gi|241765693|ref|ZP_04763642.1| Superoxide dismutase [Acidovorax delafieldii 2AN]
 gi|241364441|gb|EER59549.1| Superoxide dismutase [Acidovorax delafieldii 2AN]
          Length = 193

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E   ++LEEI+ KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFESMALEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM    G G+   AL+ AI+  FGS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPQGG-GEPTGALAAAINAKFGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++ +R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNQRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|218887076|ref|YP_002436397.1| superoxide dismutase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|23821350|dbj|BAC20946.1| superoxide dismutase [Desulfovibrio vulgaris]
 gi|218758030|gb|ACL08929.1| Superoxide dismutase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 238

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (59%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F +P LPY  + L P +S  T+ +H+  H   Y  N  K  +   M  + LE++I    G
Sbjct: 41  FPMPPLPYPENGLEPAISARTISFHYGKHTAAYYGNLNKAVAGTPMATMKLEDVIKSVAG 100

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + AGLFNNA+Q +NH  +WA MK   G G  P  ++DA+   FGS +   + L  AA 
Sbjct: 101 DPAKAGLFNNAAQSWNHTFYWAGMKPGGG-GTPPAKVADALSAAFGSVDACVTQLSDAAK 159

Query: 121 TQFGSGWGWLS--VKNGK--LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TQF SGW WL+   +NGK  L++ KT NAE P+  G  PIL IDVWEHAYYLD++ +R  
Sbjct: 160 TQFASGWAWLAKGRENGKDVLKVLKTGNAETPITQGYTPILTIDVWEHAYYLDYQNKRPD 219

Query: 177 YIESFITNLVNWEYVCER 194
           Y+++F   LVNW+ V +R
Sbjct: 220 YVQAFFDKLVNWDEVAKR 237


>gi|67459133|ref|YP_246757.1| superoxide dismutase [Rickettsia felis URRWXCal2]
 gi|67004666|gb|AAY61592.1| Superoxide dismutase [Rickettsia felis URRWXCal2]
          Length = 222

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 27  FILPDLPYDKESFKPHFTPETFDYHHGKHHNAYVQNLNNLLKDKEELQKKDLEEIIEWSS 86

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH+ FW  +K   G GK    + + I+ +FGSFE F       A 
Sbjct: 87  QNSNAAIFNNAAQIWNHSFFWHSIKPQGG-GKPSGKILEQINKDFGSFEGFCEQFKQEAV 145

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ NG  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 146 GQFGSGWAWLVYHDNRLQIIKTANAGTPIANGMKPLLACDVWEHAYYIDYRNKRPDYVDI 205

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 206 FIKHMINWKFV 216


>gi|315641230|ref|ZP_07896307.1| superoxide dismutase [Enterococcus italicus DSM 15952]
 gi|315482997|gb|EFU73516.1| superoxide dismutase [Enterococcus italicus DSM 15952]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M + LP+LPY+YD L PY+  ET+  HHD HH  Y  N    +    E+   S+EE+I  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAVEKHPELAEKSVEELISS 60

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +  N G G+    L  AID+ FGSF+  K++ 
Sbjct: 61  MSTVPEDIQTAVRNNGGGHANHSFFWEILAPNAG-GEPTGDLKAAIDETFGSFDDLKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL + NG L+++ T N ++PL+ G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVLDNGTLKVTSTANQDSPLMEGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YIE+F  NLVNWE   E +  A
Sbjct: 180 DYIEAFW-NLVNWEKANEIFSAA 201


>gi|260363928|ref|ZP_05776672.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus K5030]
 gi|260877711|ref|ZP_05890066.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus AN-5034]
 gi|260900738|ref|ZP_05909133.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus AQ4037]
 gi|308092742|gb|EFO42437.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus AN-5034]
 gi|308109736|gb|EFO47276.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus AQ4037]
 gi|308113539|gb|EFO51079.1| superoxide dismutase (Fe) [Vibrio parahaemolyticus K5030]
 gi|328474551|gb|EGF45356.1| superoxide dismutase [Vibrio parahaemolyticus 10329]
          Length = 194

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    AA 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 177 NGFWA-LVNWDFVAE 190


>gi|239615742|gb|ACR83609.1| superoxide dismutase [Psychromonas arctica]
          Length = 197

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLE+HH  HH  Y      L    ++   SLEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLEFHHGKHHATYVAKLNGLVEGTDLAEKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+ AID  FGSF +F++ L   A 
Sbjct: 61  EG---GVFNNAAQIWNHTFYWNCLAPNAG-GEPSGELAAAIDAKFGSFAEFQAQLNDKAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LE+  T NA  PL   G  P+L +DVWEHAYY+D++  R +Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLELVNTSNAGTPLTEEGTTPLLTVDVWEHAYYIDYRNVRPNYL 176

Query: 179 ESFITNLVNWEYVCERYETAML 200
             F   LVNWE+V + +    L
Sbjct: 177 NGFWA-LVNWEFVAKNFAAVSL 197


>gi|150024270|ref|YP_001295096.1| superoxide dismutase [Flavobacterium psychrophilum JIP02/86]
 gi|149770811|emb|CAL42276.1| Superoxide dismutase [Mn] [Flavobacterium psychrophilum JIP02/86]
          Length = 201

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 120/202 (59%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     +  ++   S+E+I+   
Sbjct: 1   MAFELPQLPYAYDALEPHIDARTMEIHHSKHHNAYTTNLNAAIAGTDLEGKSIEDILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + A + NN   ++NHNLFW  M  N G G     L+ AID NFG+F  FK+    A +
Sbjct: 61  DLTKAAVRNNGGGFFNHNLFWTVMSPNGG-GLPTGELAAAIDANFGTFADFKAAFAKAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           TQFGSGW WL VK GKLE+  T N +N L+     G  PILG+DVWEHAYYL ++ RR  
Sbjct: 120 TQFGSGWAWLCVKEGKLEVCGTPNQDNTLMPGVGCGGTPILGMDVWEHAYYLHYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YIE+F  N++NW  V  R+  A
Sbjct: 180 YIEAFF-NVINWSEVARRFAEA 200


>gi|308445782|ref|XP_003087017.1| CRE-SOD-3 protein [Caenorhabditis remanei]
 gi|308268898|gb|EFP12851.1| CRE-SOD-3 protein [Caenorhabditis remanei]
          Length = 203

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N            LS+EE++ K 
Sbjct: 1   MAYSLPQLPYAYDALEPNIDTKTMEIHHTKHHQTYINNINATVEGTAWEKLSIEELVSKV 60

Query: 61  HGSNAGL----FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +   A L     NN   + NH+LFW  M    G   + Q +++AID + G FEKFK    
Sbjct: 61  NEVPADLKNSVINNGGGHANHSLFWTVMSPQGGGEPIKQ-IAEAIDRDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    K+ +  + N ++PL+NG IP+L +DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKVIVESSANQDSPLMNGNIPVLALDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V  RY  A+
Sbjct: 180 EYIAAFY-NVVNWEEVNRRYLEAI 202


>gi|311030797|ref|ZP_07708887.1| superoxide dismutase [Bacillus sp. m3-13]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 121/204 (59%), Gaps = 9/204 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y       L   AE+   S+EE+I  
Sbjct: 1   MAYELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTGINAALEGQAELQGKSVEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSD 114
                      + N+   + NH+LFW  +    G    P   L+DA+   FGSFE FK +
Sbjct: 61  MDAVPENIKTAVRNHGGGHANHSLFWNILTP--GGATSPNGELADALTSKFGSFENFKDE 118

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              AA+T+FGSGW WL V NG+LEI+ T N ++PL+ G  P+LG+DVWEHAYYL+++ RR
Sbjct: 119 FAKAAATRFGSGWAWLVVNNGELEITSTPNQDSPLMEGKTPVLGLDVWEHAYYLNYQNRR 178

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N++NW+ V + Y  A
Sbjct: 179 PDYINAFF-NVINWDVVGKLYNEA 201


>gi|221310426|ref|ZP_03592273.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221314749|ref|ZP_03596554.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319672|ref|ZP_03600966.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221323949|ref|ZP_03605243.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|255767567|ref|NP_390381.3| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|321311986|ref|YP_004204273.1| superoxide dismutase [Bacillus subtilis BSn5]
 gi|254763458|sp|P54375|SODM_BACSU RecName: Full=Superoxide dismutase [Mn]; AltName: Full=General
           stress protein 24; Short=GSP24
 gi|3355882|dbj|BAA31974.1| superoxide dismutase [Bacillus subtilis]
 gi|225185195|emb|CAB14432.3| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|320018260|gb|ADV93246.1| superoxide dismutase [Bacillus subtilis BSn5]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 125/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|289208132|ref|YP_003460198.1| superoxide dismutase [Thioalkalivibrio sp. K90mix]
 gi|288943763|gb|ADC71462.1| Superoxide dismutase [Thioalkalivibrio sp. K90mix]
          Length = 193

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 125/196 (63%), Gaps = 7/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP+LPY+ + L P++S ETLEYHHD HH  Y      L   +E  + SLE+II K+
Sbjct: 1   MAYELPDLPYAKNALEPHISAETLEYHHDKHHATYVTKLNGLLPGSEFENASLEDIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G+FNN +Q +NH  ++ CM  + G G+    ++DAI+  FGSF+ FK     AA 
Sbjct: 61  PA--GGIFNNGAQVWNHTFYFNCMGPDAG-GEPSGKVADAINSAFGSFDGFKEKFNEAAV 117

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL V+N  G +EI  T NA NP+ +G  P+L  DVWEHAYY+D++  R  Y+
Sbjct: 118 GNFGSGWTWL-VQNSDGSVEIVNTSNAANPMRDGKTPLLTCDVWEHAYYIDYRNARPKYL 176

Query: 179 ESFITNLVNWEYVCER 194
           E+F  N+VNW++V ++
Sbjct: 177 ENFW-NVVNWDFVAQQ 191


>gi|290475496|ref|YP_003468384.1| superoxide dismutase, iron [Xenorhabdus bovienii SS-2004]
 gi|289174817|emb|CBJ81618.1| superoxide dismutase, iron [Xenorhabdus bovienii SS-2004]
          Length = 192

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 116/194 (59%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEII  S
Sbjct: 1   MSFELPALPYAKNALEPHISAETLEYHYGKHHNAYVVNLNNLVKDTEFAGKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+    ++DAI+  FGSF +FK     AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNSLSPNGG-GEPTGKVADAINSAFGSFTEFKQQFTDAAL 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKKADGSVAIVNTSNAATPLTGKDKPVLTVDVWEHAYYIDYRNARPQYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNW++V E
Sbjct: 177 HFWA-LVNWKFVEE 189


>gi|149928089|ref|ZP_01916336.1| superoxide dismutase [Limnobacter sp. MED105]
 gi|149823175|gb|EDM82412.1| superoxide dismutase [Limnobacter sp. MED105]
          Length = 193

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY+ D L+P++SKETLEYH+  HH  Y  N   L    E    SLE+I+ KS
Sbjct: 1   MQHTLPDLPYAMDALAPHISKETLEYHYGKHHAAYVTNLNNLVKGTEFESSSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G     L++AI+  FGS++ FK     +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLSPNGG-GAPSGKLAEAINAKFGSYDAFKEAFTKSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGS W WL  K +G ++I  T NA  PL     P+L  D+WEHAYY+D++  R  YIE
Sbjct: 117 GNFGSSWTWLVKKADGSVDIVNTSNAATPLTTQDKPLLTCDLWEHAYYIDYRNARPKYIE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNWE+  + +E
Sbjct: 177 TFW-NLVNWEFASKNFE 192


>gi|301629302|ref|XP_002943782.1| PREDICTED: superoxide dismutase [Fe]-like [Xenopus (Silurana)
           tropicalis]
          Length = 193

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 119/192 (61%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+PY S+ETLEYH   HH  Y  N   L    E   ++LE+I+ KS
Sbjct: 1   MEHTLPPLPYAIDALAPYYSQETLEYHRGKHHNAYVVNLNNLQKGTEFESMALEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  + G G+   AL+DAI+  +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPHGG-GEPSGALADAINAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKTDGSVDIVNTGAAGTPLTTSDKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F++NLVNW++ 
Sbjct: 177 TFMSNLVNWKFA 188


>gi|206561094|ref|YP_002231859.1| superoxide dismutase SodB [Burkholderia cenocepacia J2315]
 gi|198037136|emb|CAR53057.1| superoxide dismutase SodB [Burkholderia cenocepacia J2315]
          Length = 192

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|157145917|ref|YP_001453236.1| superoxide dismutase [Citrobacter koseri ATCC BAA-895]
 gi|157083122|gb|ABV12800.1| hypothetical protein CKO_01668 [Citrobacter koseri ATCC BAA-895]
          Length = 193

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  +
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTPFEGKSLEEIVRSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  + G G+    L+DAI  +FGS   FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPDAG-GEPTGKLADAIVASFGSVADFKAQFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   LVNW++V + +
Sbjct: 177 HFWA-LVNWDFVAKNF 191


>gi|170024102|ref|YP_001720607.1| superoxide dismutase [Yersinia pseudotuberculosis YPIII]
 gi|169750636|gb|ACA68154.1| Superoxide dismutase [Yersinia pseudotuberculosis YPIII]
          Length = 192

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 119/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y +N   L  D E    SLEEI+  +
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVNNLNNLIKDTEFAGKSLEEIVKTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    +++AI+ +FGSF +FK+    AA 
Sbjct: 61  NG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKIAEAINKSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   +VNW + 
Sbjct: 177 NFWA-VVNWSFA 187


>gi|154686764|ref|YP_001421925.1| hypothetical protein RBAM_023340 [Bacillus amyloliquefaciens FZB42]
 gi|154352615|gb|ABS74694.1| SodA [Bacillus amyloliquefaciens FZB42]
          Length = 201

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 120/202 (59%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NN   + NH+LFW  +  N G G+    L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGG-GEPTGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  P+LG+DVWEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F  N+VNW+ V   Y  A
Sbjct: 180 YISAFW-NVVNWDEVARLYSEA 200


>gi|88812677|ref|ZP_01127924.1| superoxide dismutase, Fe [Nitrococcus mobilis Nb-231]
 gi|88790093|gb|EAR21213.1| superoxide dismutase, Fe [Nitrococcus mobilis Nb-231]
          Length = 195

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/200 (44%), Positives = 123/200 (61%), Gaps = 10/200 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L PY+S+ETLEYHH  HHK Y D   +L    E  ++ LE II K+
Sbjct: 1   MKIELPELPYALNALEPYISQETLEYHHGKHHKAYVDKTNQLIEGTEYANMELEAIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFN ++Q +NH  +W  M  N G G     ++DAI  +FGSFE+F+       +
Sbjct: 61  AG---GLFNQSAQIWNHTFYWNSMAPNAG-GDPKGPIADAIRQSFGSFEEFRKQFNEKTA 116

Query: 121 TQFGSGWGWLSVKN---GKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSGWGWL VKN   G L I +T +A+  L +   +P++  DVWEHAYY+D++  R  
Sbjct: 117 ANFGSGWGWL-VKNKSDGTLAIVETDDAQTALTDESVVPLMTCDVWEHAYYIDYRNARPK 175

Query: 177 YIESFITNLVNWEYVCERYE 196
           Y+E+F  NLVNW++V   +E
Sbjct: 176 YLEAFW-NLVNWDFVNRNFE 194


>gi|15237281|ref|NP_197722.1| FSD3 (FE SUPEROXIDE DISMUTASE 3); superoxide dismutase [Arabidopsis
           thaliana]
 gi|10177820|dbj|BAB11186.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
 gi|17529344|gb|AAL38899.1| putative iron superoxide dismutase 3 [Arabidopsis thaliana]
 gi|20259615|gb|AAM14164.1| putative iron superoxide dismutase 3 [Arabidopsis thaliana]
 gi|332005767|gb|AED93150.1| Fe superoxide dismutase 3 [Arabidopsis thaliana]
          Length = 263

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 120/202 (59%), Gaps = 8/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + L   PY  D L PYMS+ TLE H   HH+ Y DN  K L  D  +   ++EE+I  ++
Sbjct: 50  YGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATY 109

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            +   L  FNNA+Q YNH+ FW  M+   G G  PQ  + + ID +FGSF  F+     A
Sbjct: 110 NNGNPLPEFNNAAQVYNHDFFWESMQP--GGGDTPQKGVLEQIDKDFGSFTNFREKFTNA 167

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL +K    +LE+ KT NA NPL+   IPI+ +DVWEH+YYLD+K  RA 
Sbjct: 168 ALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAK 227

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F+ +LV+W     R   A
Sbjct: 228 YINTFLNHLVSWNAAMSRMARA 249


>gi|311695242|gb|ADP98115.1| superoxide dismutase, Fe [marine bacterium HP15]
          Length = 192

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S+ETLEYH+  HH  Y      L    +  + SLE+II  +
Sbjct: 1   MAFELPALPYEKNALEPHISQETLEYHYGKHHNTYVTKLNGLIEGTDNANKSLEDIIKSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    LFNNA+Q +NH  +W C+  N G G+   A  +AI+  FGSFE FK +    A+
Sbjct: 61  SGP---LFNNAAQVWNHTFYWHCLSPNGG-GEPTGAAKEAIEKAFGSFEDFKKEFNDKAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + I+ T NAE PL     P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 NNFGSGWTWLVKKADGSVAIANTSNAETPLTGADKPVLTVDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F  NLVNW++V E
Sbjct: 177 AFW-NLVNWDFVNE 189


>gi|332974765|gb|EGK11681.1| superoxide dismutase [Desmospora sp. 8437]
          Length = 206

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 123/203 (60%), Gaps = 9/203 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYAD--NALKLASDAEMLHLSLEEIIIK- 59
           ++LP LPY+ D L P+  KET+E HH  HHK Y D  N       A +  +S+E+++   
Sbjct: 4   YELPALPYASDALEPHFDKETMEIHHGRHHKTYVDKLNGALEGQAAALQEMSVEDLMKNI 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G G+    L+ AID  FGSFEKFK +  
Sbjct: 64  DQVPESIRTAVRNNGGGHANHSLFWKILSPNGG-GQPTGELATAIDSAFGSFEKFKEEFT 122

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA  +FGSGW WL + K+G L I+ T N ++PL+ G  PILG+DVWEHAYYL ++ +R 
Sbjct: 123 NAAVGRFGSGWAWLVLGKDGSLAITTTPNQDSPLMEGLQPILGLDVWEHAYYLKYQNKRP 182

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N+VNW+ V +RYE A
Sbjct: 183 DYIKAFW-NVVNWDEVGKRYEEA 204


>gi|90020532|ref|YP_526359.1| SecE subunit of protein translocation complex [Saccharophagus
           degradans 2-40]
 gi|89950132|gb|ABD80147.1| Superoxide dismutase [Saccharophagus degradans 2-40]
          Length = 193

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 124/197 (62%), Gaps = 7/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S+ETLE+H+  HH+ Y D    L   +E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALAPHISEETLEFHYGKHHQTYVDKLNGLVPGSEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A+ +AI   FGSFEKFK +   +A 
Sbjct: 61  SG---GVFNNAAQIWNHTFYWNCLSPNGG-GEATGAVGEAIVAAFGSFEKFKEEFTNSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G + I  T NA  PL + ++ P+L +DVWEHAYY+D++  R +Y+
Sbjct: 117 NNFGSAWTWLVKKADGTVAIVNTSNAATPLTDSSVTPLLTVDVWEHAYYIDYRNSRPNYL 176

Query: 179 ESFITNLVNWEYVCERY 195
            +F   LVNW++  + +
Sbjct: 177 GAFW-KLVNWDFANQNF 192


>gi|115352642|ref|YP_774481.1| superoxide dismutase [Burkholderia ambifaria AMMD]
 gi|172061503|ref|YP_001809155.1| superoxide dismutase [Burkholderia ambifaria MC40-6]
 gi|115282630|gb|ABI88147.1| Superoxide dismutase [Burkholderia ambifaria AMMD]
 gi|171994020|gb|ACB64939.1| Superoxide dismutase [Burkholderia ambifaria MC40-6]
          Length = 192

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPSGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|328472241|gb|EGF43111.1| superoxide dismutase [Vibrio parahaemolyticus 10329]
          Length = 202

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +++   SL+EI    
Sbjct: 1   MSHTFPALPYPYDALEPYIDAKTMEVHYSKHHKTYFDKFVTAVQGSDLETQSLDEIFAAV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM   +G G+   AL+ AI+D FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHILYWNCMSP-EGGGEPQGALAQAINDKFGHFEKFKDEFAQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGDIHITSTSNQDNPLMDVADVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI ++  N+VNW  V E Y  A++
Sbjct: 180 YINAWW-NVVNWRAVEENYARALV 202


>gi|3273757|gb|AAC24834.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
          Length = 262

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 120/202 (59%), Gaps = 8/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + L   PY  D L PYMS+ TLE H   HH+ Y DN  K L  D  +   ++EE+I  ++
Sbjct: 50  YGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATY 109

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            +   L  FNNA+Q YNH+ FW  M+   G G  PQ  + + ID +FGSF  F+     A
Sbjct: 110 NNGNPLPEFNNAAQVYNHDFFWESMQP--GGGDTPQKGVLEQIDKDFGSFTNFREKFTNA 167

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL +K    +LE+ KT NA NPL+   IPI+ +DVWEH+YYLD+K  RA 
Sbjct: 168 ALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAK 227

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F+ +LV+W     R   A
Sbjct: 228 YINTFLNHLVSWNAAMSRMARA 249


>gi|73535546|pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus
           Anthracis At 1.8a Resolution.
 gi|73535547|pdb|1XUQ|B Chain B, Crystal Structure Of Soda-1 (Ba4499) From Bacillus
           Anthracis At 1.8a Resolution
          Length = 212

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 14  ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 73

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 74  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 132

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 133 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 192

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 193 GAFW-NVVDWNAAEKRYQEA 211


>gi|308174292|ref|YP_003920997.1| superoxide dismutase [Bacillus amyloliquefaciens DSM 7]
 gi|307607156|emb|CBI43527.1| superoxide dismutase [Bacillus amyloliquefaciens DSM 7]
          Length = 201

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 120/202 (59%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NN   + NH+LFW  +  N G G+    L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGG-GEPTGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+D+WEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDIWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F  N+VNW+ V   Y  A
Sbjct: 180 YISAFW-NVVNWDEVARLYSEA 200


>gi|291484948|dbj|BAI86023.1| superoxide dismutase [Bacillus subtilis subsp. natto BEST195]
          Length = 202

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 124/203 (61%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL++ I   FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGALAEEISSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V   Y  A
Sbjct: 180 DYISAFW-NVVNWDEVARLYSEA 201


>gi|242309076|ref|ZP_04808231.1| superoxide dismutase [Helicobacter pullorum MIT 98-5489]
 gi|239524500|gb|EEQ64366.1| superoxide dismutase [Helicobacter pullorum MIT 98-5489]
          Length = 208

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 128/198 (64%), Gaps = 10/198 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           FKL  LP+  +++  ++SKET E+H+  HH+ Y +N   L    E  + SL EI+ KS G
Sbjct: 2   FKLRELPF--NEIQDFISKETCEFHYGKHHQTYVNNLNNLIKGTEFENSSLFEIVTKSQG 59

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q YNH+ +W C+   +    +   L +AI+D+FGSFEKFK   + AA+T 
Sbjct: 60  ---GIFNNAAQVYNHDFYWDCIAPKETP--LSAELQEAINDSFGSFEKFKESYLQAATTL 114

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW W+  +  + KLEI++T NA+ P+  G IP+L +DVWEHAYY+D++  R  Y+E 
Sbjct: 115 FGSGWCWVVYNPNSKKLEITQTSNAQTPITQGLIPVLVVDVWEHAYYVDYRNARPSYLEK 174

Query: 181 FITNLVNWEYVCERYETA 198
           F  N ++W++V +  E A
Sbjct: 175 FF-NHIHWDFVSKSLEWA 191


>gi|209522451|ref|ZP_03271052.1| Superoxide dismutase [Burkholderia sp. H160]
 gi|209497113|gb|EDZ97367.1| Superoxide dismutase [Burkholderia sp. H160]
          Length = 192

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNSAQIWNHTFFWNSLSPQGG-GAPTGALADAINAKWGSFDKFKEEFAKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+VNW++  + +
Sbjct: 177 AYW-NIVNWDFAAKNF 191


>gi|297808333|ref|XP_002872050.1| hypothetical protein ARALYDRAFT_489192 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297317887|gb|EFH48309.1| hypothetical protein ARALYDRAFT_489192 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 263

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 121/202 (59%), Gaps = 8/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + L   PY  D L PYMS+ TLE H   HH+ Y DN  K L  D  +   ++EE+I  ++
Sbjct: 50  YGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATY 109

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            +   L  FNNA+Q YNH+ FW  M+   G G +P+  + + ID +FGSF  F+     A
Sbjct: 110 NNGNPLPEFNNAAQVYNHDFFWESMQP--GGGDMPKKGVLEQIDKDFGSFTNFREKFTNA 167

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL +K    +LE+ KT NA NPL+   IPI+ +DVWEH+YYLD+K  RA 
Sbjct: 168 ALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIISLDVWEHSYYLDYKNDRAR 227

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F+ +LV+W     R   A
Sbjct: 228 YINTFLNHLVSWNAAMSRMARA 249


>gi|228902798|ref|ZP_04066943.1| Superoxide dismutase [Bacillus thuringiensis IBL 4222]
 gi|228856807|gb|EEN01322.1| Superoxide dismutase [Bacillus thuringiensis IBL 4222]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQQA 202


>gi|298207220|ref|YP_003715399.1| superoxide dismutase [Croceibacter atlanticus HTCC2559]
 gi|83849856|gb|EAP87724.1| superoxide dismutase [Croceibacter atlanticus HTCC2559]
          Length = 202

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 120/200 (60%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++ ++T+  HH  HH+ Y +         ++   ++E I+   
Sbjct: 1   MSFELPKLKYAHDALEPHIDEKTMTIHHGKHHQGYTNKLNAAIEGTDLEGKTIENILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   ++NH LFW  M   DG GK    L++AID  FGSFE FK +  + A 
Sbjct: 61  EMSNTAVRNNGGGFFNHRLFWEVMSP-DGGGKPTGELAEAIDAKFGSFEAFKDEFSSQAG 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V+  GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVQEGGKVEVCSTANQDNPLMPGIGCGGYPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ +F  N+++W  V +RY
Sbjct: 180 DYVNAFF-NVIDWTEVSKRY 198


>gi|229086844|ref|ZP_04219006.1| Superoxide dismutase [Bacillus cereus Rock3-44]
 gi|228696488|gb|EEL49311.1| Superoxide dismutase [Bacillus cereus Rock3-44]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK++   A
Sbjct: 65  VPEAIRTAVRNNGGGHVNHTFFWTILSPNGGGQPVGE-LAAAIEAKFGSFDAFKAEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL ++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|228476019|ref|ZP_04060727.1| superoxide dismutase [Staphylococcus hominis SK119]
 gi|314936326|ref|ZP_07843673.1| superoxide dismutase, Mn [Staphylococcus hominis subsp. hominis
           C80]
 gi|228269842|gb|EEK11322.1| superoxide dismutase [Staphylococcus hominis SK119]
 gi|313654945|gb|EFS18690.1| superoxide dismutase, Mn [Staphylococcus hominis subsp. hominis
           C80]
          Length = 200

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 117/203 (57%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY+ D L P++ KET+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYAADALEPHIDKETMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   + NH+LFW  +  N + KG V     D I + +GS ++FK + 
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NGKLEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGKLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y  A
Sbjct: 177 DYISAFW-NVVNWEKVDELYNAA 198


>gi|283787416|ref|YP_003367281.1| superoxide dismutase [Citrobacter rodentium ICC168]
 gi|282950870|emb|CBG90547.1| superoxide dismutase [Citrobacter rodentium ICC168]
          Length = 206

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 124/207 (59%), Gaps = 17/207 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLPVEELITK 60

Query: 60  SHGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSD 114
                A     L NNA  + NH+LFW  +KK    G   Q  L  AI+ +FGS EKFK +
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK----GTTLQGDLKAAIERDFGSVEKFKEE 116

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYL 168
              AA+T+FGSGW WL +K  KL +  T N ++PL+  AI      PILG+DVWEHAYYL
Sbjct: 117 FEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYL 176

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERY 195
            F+ RR  YI+ F  N+VNW+    R+
Sbjct: 177 KFQNRRPDYIKEFW-NVVNWDEAAARF 202


>gi|238895038|ref|YP_002919772.1| superoxide dismutase [Klebsiella pneumoniae NTUH-K2044]
 gi|238547354|dbj|BAH63705.1| superoxide dismutase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 193

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 118/194 (60%), Gaps = 8/194 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+ AI  +FGSF  FK+    AA+
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPEGELAAAIAKSFGSFTDFKAKFTDAAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FG+GW WL VKN  G L I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGAGWTWL-VKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYL 175

Query: 179 ESFITNLVNWEYVC 192
           + F   LVNW++V 
Sbjct: 176 DHFWA-LVNWKFVA 188


>gi|152970546|ref|YP_001335655.1| superoxide dismutase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955395|gb|ABR77425.1| superoxide dismutase, iron [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 193

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 118/194 (60%), Gaps = 8/194 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTTFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+ AI  +FGSF  FK+    AA+
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPEGELAAAIAKSFGSFADFKAKFTDAAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FG+GW WL VKN  G L I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGAGWTWL-VKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYL 175

Query: 179 ESFITNLVNWEYVC 192
           + F   LVNW++V 
Sbjct: 176 DHFWA-LVNWKFVA 188


>gi|223043219|ref|ZP_03613266.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus capitis SK14]
 gi|242373858|ref|ZP_04819432.1| superoxide dismutase [Staphylococcus epidermidis M23864:W1]
 gi|222443430|gb|EEE49528.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus capitis SK14]
 gi|242348412|gb|EES40014.1| superoxide dismutase [Staphylococcus epidermidis M23864:W1]
          Length = 199

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 123/203 (60%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+  +
Sbjct: 1   MAFELPKLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  S+    + NN   + NH+LFW  +  N + KG+V     D I + +GS ++FK + 
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLSPNSEEKGEV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y+ A
Sbjct: 177 DYISAFW-NVVNWEKVDELYKAA 198


>gi|3719455|gb|AAC63378.1| iron superoxide dismutase [Zantedeschia aethiopica]
          Length = 309

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           ++ K P  PYS + L PYMS+ETLE+H   HH+ Y D   +     E+  LSLEEI+IKS
Sbjct: 46  LELKPP--PYSLNALEPYMSQETLEFHWGKHHRGYVDGLNRQILGTELAGLSLEEIVIKS 103

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +  G     FNNA+Q +NH+ FW  MK  DG GK    L + I+ +FGSFE   +    A
Sbjct: 104 YNEGDLLPTFNNAAQIWNHDFFWQSMKP-DGGGKPFGVLMELIERDFGSFEGMMAQFKNA 162

Query: 119 ASTQFGSGWGWLSVKNGKLE-----------------ISKTQNAENPLINGAIPILGIDV 161
           A TQFGSGW WL  K  +L+                 I KT NA NPLI    PIL +DV
Sbjct: 163 ALTQFGSGWAWLVYKANRLDVGNAVNPCPTEKDYKLIIEKTPNAVNPLIWDYNPILVVDV 222

Query: 162 WEHAYYLDFKYRRAHYIESFITNLVNWEYVCER 194
           WEHAYYLD++ RR  ++ +F+  L++WE    R
Sbjct: 223 WEHAYYLDYQNRRPDFVSTFMDKLISWEAASAR 255


>gi|157737810|ref|YP_001490494.1| superoxide dismutase [Arcobacter butzleri RM4018]
 gi|157699664|gb|ABV67824.1| superoxide dismutase [Arcobacter butzleri RM4018]
          Length = 191

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 123/195 (63%), Gaps = 9/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L  LPY+ D L+P MS+ETLE+HH  HH+ Y +N   L    E  +LSLE+I+ KS
Sbjct: 1   MKHELMKLPYAIDALAPCMSQETLEFHHGKHHQTYVNNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH+ F++ +  N  +G +P ++  A+   FGS EKFK +    A 
Sbjct: 61  SG---GIFNNAAQVFNHDFFFSGLTPN--QGAIPASVEAALTKAFGSVEKFKEEFTAKAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            QFGSGW WL VK+  G L+I  T NA  P+  G  P+L  DVWEHAYY+D +  R  ++
Sbjct: 116 GQFGSGWAWL-VKDASGDLKIVTTSNAGCPITEGLTPVLTCDVWEHAYYIDVRNARPKFL 174

Query: 179 ESFITNLVNWEYVCE 193
           E+F   LVNW++V +
Sbjct: 175 ENFW-QLVNWDFVAK 188


>gi|268592612|ref|ZP_06126833.1| superoxide dismutase [Providencia rettgeri DSM 1131]
 gi|291311750|gb|EFE52203.1| superoxide dismutase [Providencia rettgeri DSM 1131]
          Length = 192

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L PY+S ETLEYH+  HH  Y  N   L         SLEEII   
Sbjct: 1   MSFELPALPYAKDALEPYISAETLEYHYGKHHNTYVVNLNNLIKGTNFEGKSLEEII--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S AG+FNNA+Q +NH  +W C+  N G G+    +++AI+  FGSF +FK+    AA+
Sbjct: 58  KTSEAGVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAINKAFGSFAEFKAQFTDAAT 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  P+     P+L +D+WEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGNLAIVNTSNAATPISGDDKPVLTVDIWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW++V E
Sbjct: 177 NFWA-LVNWKFVEE 189


>gi|206578167|ref|YP_002238184.1| superoxide dismutase (Fe) [Klebsiella pneumoniae 342]
 gi|288935173|ref|YP_003439232.1| superoxide dismutase [Klebsiella variicola At-22]
 gi|290509231|ref|ZP_06548602.1| Fe-superoxide dismutase [Klebsiella sp. 1_1_55]
 gi|330015587|ref|ZP_08308208.1| superoxide dismutase [Klebsiella sp. MS 92-3]
 gi|206567225|gb|ACI09001.1| superoxide dismutase (Fe) [Klebsiella pneumoniae 342]
 gi|288889882|gb|ADC58200.1| Superoxide dismutase [Klebsiella variicola At-22]
 gi|289778625|gb|EFD86622.1| Fe-superoxide dismutase [Klebsiella sp. 1_1_55]
 gi|328531447|gb|EGF58288.1| superoxide dismutase [Klebsiella sp. MS 92-3]
          Length = 193

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 118/194 (60%), Gaps = 8/194 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    L+ AI  +FGSF  FK+    AA+
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPEGELAAAIAKSFGSFADFKAKFTDAAA 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FG+GW WL VKN  G L I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+
Sbjct: 117 KNFGAGWTWL-VKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYL 175

Query: 179 ESFITNLVNWEYVC 192
           + F   LVNW++V 
Sbjct: 176 DHFWA-LVNWKFVA 188


>gi|254721868|ref|ZP_05183657.1| superoxide dismutase, Mn [Bacillus anthracis str. A1055]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNATLEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|30264347|ref|NP_846724.1| superoxide dismutase, Mn [Bacillus anthracis str. Ames]
 gi|42783401|ref|NP_980648.1| superoxide dismutase, Mn [Bacillus cereus ATCC 10987]
 gi|47529794|ref|YP_021143.1| superoxide dismutase, Mn [Bacillus anthracis str. 'Ames Ancestor']
 gi|47567837|ref|ZP_00238545.1| superoxide dismutase [Bacillus cereus G9241]
 gi|49187174|ref|YP_030426.1| superoxide dismutase, Mn [Bacillus anthracis str. Sterne]
 gi|49481287|ref|YP_038334.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|118479448|ref|YP_896599.1| superoxide dismutase, Mn [Bacillus thuringiensis str. Al Hakam]
 gi|165872090|ref|ZP_02216730.1| superoxide dismutase, Mn [Bacillus anthracis str. A0488]
 gi|167634664|ref|ZP_02392984.1| superoxide dismutase, Mn [Bacillus anthracis str. A0442]
 gi|167638653|ref|ZP_02396929.1| superoxide dismutase, Mn [Bacillus anthracis str. A0193]
 gi|170687376|ref|ZP_02878593.1| superoxide dismutase, Mn [Bacillus anthracis str. A0465]
 gi|170707468|ref|ZP_02897922.1| superoxide dismutase, Mn [Bacillus anthracis str. A0389]
 gi|177655047|ref|ZP_02936713.1| superoxide dismutase, Mn [Bacillus anthracis str. A0174]
 gi|190565979|ref|ZP_03018898.1| superoxide dismutase, Mn [Bacillus anthracis Tsiankovskii-I]
 gi|196034823|ref|ZP_03102230.1| superoxide dismutase, Mn [Bacillus cereus W]
 gi|196041617|ref|ZP_03108909.1| superoxide dismutase, Mn [Bacillus cereus NVH0597-99]
 gi|196046380|ref|ZP_03113606.1| superoxide dismutase, Mn [Bacillus cereus 03BB108]
 gi|206971213|ref|ZP_03232164.1| superoxide dismutase, Mn [Bacillus cereus AH1134]
 gi|206977997|ref|ZP_03238883.1| superoxide dismutase, Mn [Bacillus cereus H3081.97]
 gi|217961766|ref|YP_002340336.1| superoxide dismutase, Mn [Bacillus cereus AH187]
 gi|218235635|ref|YP_002369082.1| superoxide dismutase, Mn [Bacillus cereus B4264]
 gi|218899441|ref|YP_002447852.1| superoxide dismutase, Mn [Bacillus cereus G9842]
 gi|218905411|ref|YP_002453245.1| superoxide dismutase, Mn [Bacillus cereus AH820]
 gi|222097720|ref|YP_002531777.1| superoxide dismutase, mn [Bacillus cereus Q1]
 gi|225866257|ref|YP_002751635.1| superoxide dismutase, Mn [Bacillus cereus 03BB102]
 gi|227817051|ref|YP_002817060.1| superoxide dismutase, Mn [Bacillus anthracis str. CDC 684]
 gi|228910108|ref|ZP_04073928.1| Superoxide dismutase [Bacillus thuringiensis IBL 200]
 gi|228916908|ref|ZP_04080470.1| Superoxide dismutase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228923026|ref|ZP_04086319.1| Superoxide dismutase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228929319|ref|ZP_04092344.1| Superoxide dismutase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935595|ref|ZP_04098411.1| Superoxide dismutase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228947988|ref|ZP_04110274.1| Superoxide dismutase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228954558|ref|ZP_04116583.1| Superoxide dismutase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228960540|ref|ZP_04122189.1| Superoxide dismutase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228967342|ref|ZP_04128377.1| Superoxide dismutase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228987523|ref|ZP_04147642.1| Superoxide dismutase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229047992|ref|ZP_04193568.1| Superoxide dismutase [Bacillus cereus AH676]
 gi|229071777|ref|ZP_04204992.1| Superoxide dismutase [Bacillus cereus F65185]
 gi|229081533|ref|ZP_04214032.1| Superoxide dismutase [Bacillus cereus Rock4-2]
 gi|229098748|ref|ZP_04229686.1| Superoxide dismutase [Bacillus cereus Rock3-29]
 gi|229104906|ref|ZP_04235563.1| Superoxide dismutase [Bacillus cereus Rock3-28]
 gi|229111748|ref|ZP_04241296.1| Superoxide dismutase [Bacillus cereus Rock1-15]
 gi|229117773|ref|ZP_04247140.1| Superoxide dismutase [Bacillus cereus Rock1-3]
 gi|229123813|ref|ZP_04253007.1| Superoxide dismutase [Bacillus cereus 95/8201]
 gi|229129553|ref|ZP_04258524.1| Superoxide dismutase [Bacillus cereus BDRD-Cer4]
 gi|229141012|ref|ZP_04269555.1| Superoxide dismutase [Bacillus cereus BDRD-ST26]
 gi|229146860|ref|ZP_04275225.1| Superoxide dismutase [Bacillus cereus BDRD-ST24]
 gi|229152475|ref|ZP_04280667.1| Superoxide dismutase [Bacillus cereus m1550]
 gi|229157888|ref|ZP_04285962.1| Superoxide dismutase [Bacillus cereus ATCC 4342]
 gi|229186516|ref|ZP_04313678.1| Superoxide dismutase [Bacillus cereus BGSC 6E1]
 gi|229192484|ref|ZP_04319447.1| Superoxide dismutase [Bacillus cereus ATCC 10876]
 gi|229198402|ref|ZP_04325108.1| Superoxide dismutase [Bacillus cereus m1293]
 gi|229603736|ref|YP_002868565.1| superoxide dismutase, Mn [Bacillus anthracis str. A0248]
 gi|254684034|ref|ZP_05147894.1| superoxide dismutase, Mn [Bacillus anthracis str. CNEVA-9066]
 gi|254736383|ref|ZP_05194089.1| superoxide dismutase, Mn [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741420|ref|ZP_05199107.1| superoxide dismutase, Mn [Bacillus anthracis str. Kruger B]
 gi|254753943|ref|ZP_05205978.1| superoxide dismutase, Mn [Bacillus anthracis str. Vollum]
 gi|254757815|ref|ZP_05209842.1| superoxide dismutase, Mn [Bacillus anthracis str. Australia 94]
 gi|296504771|ref|YP_003666471.1| superoxide dismutase [Bacillus thuringiensis BMB171]
 gi|34395848|sp|Q81LW0|SODM1_BACAN RecName: Full=Superoxide dismutase [Mn] 1
 gi|30259005|gb|AAP28210.1| superoxide dismutase, Mn [Bacillus anthracis str. Ames]
 gi|42739330|gb|AAS43256.1| superoxide dismutase, Mn [Bacillus cereus ATCC 10987]
 gi|47504942|gb|AAT33618.1| superoxide dismutase, Mn [Bacillus anthracis str. 'Ames Ancestor']
 gi|47555514|gb|EAL13857.1| superoxide dismutase [Bacillus cereus G9241]
 gi|49181101|gb|AAT56477.1| superoxide dismutase, Mn [Bacillus anthracis str. Sterne]
 gi|49332843|gb|AAT63489.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|118418673|gb|ABK87092.1| superoxide dismutase, Mn [Bacillus thuringiensis str. Al Hakam]
 gi|164712221|gb|EDR17758.1| superoxide dismutase, Mn [Bacillus anthracis str. A0488]
 gi|167513501|gb|EDR88871.1| superoxide dismutase, Mn [Bacillus anthracis str. A0193]
 gi|167530116|gb|EDR92851.1| superoxide dismutase, Mn [Bacillus anthracis str. A0442]
 gi|170127712|gb|EDS96585.1| superoxide dismutase, Mn [Bacillus anthracis str. A0389]
 gi|170668571|gb|EDT19317.1| superoxide dismutase, Mn [Bacillus anthracis str. A0465]
 gi|172080308|gb|EDT65397.1| superoxide dismutase, Mn [Bacillus anthracis str. A0174]
 gi|190562898|gb|EDV16864.1| superoxide dismutase, Mn [Bacillus anthracis Tsiankovskii-I]
 gi|195992362|gb|EDX56323.1| superoxide dismutase, Mn [Bacillus cereus W]
 gi|196022850|gb|EDX61531.1| superoxide dismutase, Mn [Bacillus cereus 03BB108]
 gi|196027605|gb|EDX66220.1| superoxide dismutase, Mn [Bacillus cereus NVH0597-99]
 gi|206733985|gb|EDZ51156.1| superoxide dismutase, Mn [Bacillus cereus AH1134]
 gi|206743797|gb|EDZ55218.1| superoxide dismutase, Mn [Bacillus cereus H3081.97]
 gi|217063336|gb|ACJ77586.1| superoxide dismutase, Mn [Bacillus cereus AH187]
 gi|218163592|gb|ACK63584.1| superoxide dismutase, Mn [Bacillus cereus B4264]
 gi|218539777|gb|ACK92175.1| superoxide dismutase, Mn [Bacillus cereus AH820]
 gi|218542716|gb|ACK95110.1| superoxide dismutase, Mn [Bacillus cereus G9842]
 gi|221241778|gb|ACM14488.1| superoxide dismutase, Mn [Bacillus cereus Q1]
 gi|225789714|gb|ACO29931.1| superoxide dismutase, Mn [Bacillus cereus 03BB102]
 gi|227005397|gb|ACP15140.1| superoxide dismutase, Mn [Bacillus anthracis str. CDC 684]
 gi|228585102|gb|EEK43214.1| Superoxide dismutase [Bacillus cereus m1293]
 gi|228591061|gb|EEK48917.1| Superoxide dismutase [Bacillus cereus ATCC 10876]
 gi|228596947|gb|EEK54605.1| Superoxide dismutase [Bacillus cereus BGSC 6E1]
 gi|228625547|gb|EEK82300.1| Superoxide dismutase [Bacillus cereus ATCC 4342]
 gi|228631083|gb|EEK87720.1| Superoxide dismutase [Bacillus cereus m1550]
 gi|228636688|gb|EEK93153.1| Superoxide dismutase [Bacillus cereus BDRD-ST24]
 gi|228642445|gb|EEK98733.1| Superoxide dismutase [Bacillus cereus BDRD-ST26]
 gi|228654158|gb|EEL10025.1| Superoxide dismutase [Bacillus cereus BDRD-Cer4]
 gi|228659634|gb|EEL15280.1| Superoxide dismutase [Bacillus cereus 95/8201]
 gi|228665671|gb|EEL21146.1| Superoxide dismutase [Bacillus cereus Rock1-3]
 gi|228671742|gb|EEL27038.1| Superoxide dismutase [Bacillus cereus Rock1-15]
 gi|228678480|gb|EEL32700.1| Superoxide dismutase [Bacillus cereus Rock3-28]
 gi|228684592|gb|EEL38532.1| Superoxide dismutase [Bacillus cereus Rock3-29]
 gi|228701840|gb|EEL54327.1| Superoxide dismutase [Bacillus cereus Rock4-2]
 gi|228711372|gb|EEL63332.1| Superoxide dismutase [Bacillus cereus F65185]
 gi|228723449|gb|EEL74818.1| Superoxide dismutase [Bacillus cereus AH676]
 gi|228772255|gb|EEM20702.1| Superoxide dismutase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228792377|gb|EEM39944.1| Superoxide dismutase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228799140|gb|EEM46108.1| Superoxide dismutase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228805215|gb|EEM51809.1| Superoxide dismutase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228811678|gb|EEM58013.1| Superoxide dismutase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228824133|gb|EEM69949.1| Superoxide dismutase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228830333|gb|EEM75945.1| Superoxide dismutase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228836659|gb|EEM82007.1| Superoxide dismutase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228842732|gb|EEM87818.1| Superoxide dismutase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228849625|gb|EEM94459.1| Superoxide dismutase [Bacillus thuringiensis IBL 200]
 gi|229268144|gb|ACQ49781.1| superoxide dismutase, Mn [Bacillus anthracis str. A0248]
 gi|296325823|gb|ADH08751.1| superoxide dismutase (Mn) [Bacillus thuringiensis BMB171]
 gi|324328181|gb|ADY23441.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|269962480|ref|ZP_06176829.1| Superoxide dismutase [Vibrio harveyi 1DA3]
 gi|269832776|gb|EEZ86886.1| Superoxide dismutase [Vibrio harveyi 1DA3]
          Length = 202

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPYSYD L PY+  +T+E H+  HHK Y D  +  A  + +   SL++I    
Sbjct: 1   MSHIFPELPYSYDALEPYIDAKTMEVHYSKHHKTYYDKFMAAAKGSALETQSLDDIFASI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH ++W CM  N G G+   A++ AI++ FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHIIYWNCMSPN-GGGEPQGAIAQAINEKFGDFEKFKDEFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G++ I+ T N +NPL++ A     P+L +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGEIHITSTSNQDNPLMDVATVQGEPVLALDVWEHAYYISYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI+++  N+VNW  V E Y  A+
Sbjct: 180 YIDAW-WNVVNWRAVEENYARAL 201


>gi|228993019|ref|ZP_04152942.1| Superoxide dismutase [Bacillus pseudomycoides DSM 12442]
 gi|228999069|ref|ZP_04158651.1| Superoxide dismutase [Bacillus mycoides Rock3-17]
 gi|229006617|ref|ZP_04164252.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
 gi|228754666|gb|EEM04076.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
 gi|228760686|gb|EEM09650.1| Superoxide dismutase [Bacillus mycoides Rock3-17]
 gi|228766667|gb|EEM15307.1| Superoxide dismutase [Bacillus pseudomycoides DSM 12442]
          Length = 203

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK++   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSSNGGGQPVGE-LAAAIEAKFGSFDAFKTEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL ++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|255539971|ref|XP_002511050.1| superoxide dismutase [fe], putative [Ricinus communis]
 gi|223550165|gb|EEF51652.1| superoxide dismutase [fe], putative [Ricinus communis]
          Length = 305

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 122/215 (56%), Gaps = 20/215 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P MSK+TLEYH   HH+ Y DN  K     E+  +SLE++++ ++ 
Sbjct: 50  FELKPPPYPLDALEPLMSKDTLEYHWGKHHRAYVDNLNKQIVGTELDGMSLEDVVLVTYN 109

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH  FW CMK   G     + L   I+ +FGSFE+F  +   AA+
Sbjct: 110 KGDMLPAFNNAAQAWNHEFFWGCMKPGGGGKPSGELLQ-LIERDFGSFERFVEEFKAAAA 168

Query: 121 TQFGSGWGWLSVKNGKLEIS-----------------KTQNAENPLINGAIPILGIDVWE 163
           TQFGSGW WL+ K  +L++                  K+ NA  PL+    P+L IDVWE
Sbjct: 169 TQFGSGWAWLAYKANRLDVENALNPCPSEEDKKLVVVKSPNAVIPLVWDYYPLLTIDVWE 228

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           HAYYLDF+ RR  YI +F+  LV+WE V  R E A
Sbjct: 229 HAYYLDFQNRRPDYISTFLEKLVSWEAVSARLEAA 263


>gi|229597962|pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella
           Tularensis Subsp. Tularensis Schu S4
 gi|229597963|pdb|3H1S|B Chain B, Crystal Structure Of Superoxide Dismutase From Francisella
           Tularensis Subsp. Tularensis Schu S4
          Length = 195

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L   +SKET+EYH+  HH+ Y  N   L    E    +LEEI+  S
Sbjct: 4   MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTS 63

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 64  NG---GIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 118

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+
Sbjct: 119 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYV 177

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW++V E++
Sbjct: 178 EA-LWDIVNWQFVSEQF 193


>gi|315637599|ref|ZP_07892805.1| superoxide dismutase [Arcobacter butzleri JV22]
 gi|315478053|gb|EFU68780.1| superoxide dismutase [Arcobacter butzleri JV22]
          Length = 191

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 123/195 (63%), Gaps = 9/195 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +L  LPY+ D L+P MS+ETLE+HH  HH+ Y +N   L    E  +LSLE+I+ KS
Sbjct: 1   MKHELMKLPYAIDALAPCMSQETLEFHHGKHHQTYVNNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH+ F++ +  N  +G +P ++  A+   FGS EKFK +    A 
Sbjct: 61  SG---GVFNNAAQVFNHDFFFSGLTPN--QGAIPASVEAALTKAFGSVEKFKEEFTAKAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            QFGSGW WL VK+  G L+I  T NA  P+  G  P+L  DVWEHAYY+D +  R  ++
Sbjct: 116 GQFGSGWAWL-VKDASGDLKIVTTSNAGCPITEGLTPVLTCDVWEHAYYIDVRNARPKFL 174

Query: 179 ESFITNLVNWEYVCE 193
           E+F   LVNW++V +
Sbjct: 175 ENFW-QLVNWDFVAK 188


>gi|56707247|ref|YP_169143.1| superoxide dismutase (Fe) [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89257054|ref|YP_514416.1| superoxide dismutase [Francisella tularensis subsp. holarctica LVS]
 gi|110669717|ref|YP_666274.1| superoxide dismutase [Francisella tularensis subsp. tularensis
           FSC198]
 gi|115315410|ref|YP_764133.1| superoxide dismutase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134301282|ref|YP_001121250.1| superoxide dismutase (Fe) [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156503264|ref|YP_001429329.1| Fe/Mn family superoxide dismutase [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009441|ref|ZP_02274372.1| superoxide dismutase (Fe) [Francisella tularensis subsp. holarctica
           FSC200]
 gi|187931024|ref|YP_001891008.1| iron/manganese superoxide dismutase family protein [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|224456305|ref|ZP_03664778.1| iron/manganese superoxide dismutase family protein [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|254368293|ref|ZP_04984312.1| superoxide dismutase (Fe) [Francisella tularensis subsp. holarctica
           257]
 gi|254369891|ref|ZP_04985900.1| hypothetical protein FTAG_01652 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254369932|ref|ZP_04985940.1| superoxide dismutase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874084|ref|ZP_05246794.1| superoxide dismutase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|290953663|ref|ZP_06558284.1| superoxide dismutase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312980|ref|ZP_06803689.1| superoxide dismutase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|50428818|gb|AAT77115.1| superoxide dismutase [Francisella tularensis subsp. tularensis]
 gi|54113655|gb|AAV29461.1| NT02FT1776 [synthetic construct]
 gi|56603739|emb|CAG44701.1| superoxide dismutase [Fe] [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89144885|emb|CAJ80230.1| superoxide dismutase [Fe] [Francisella tularensis subsp. holarctica
           LVS]
 gi|110320050|emb|CAL08084.1| superoxide dismutase [Fe] [Francisella tularensis subsp. tularensis
           FSC198]
 gi|115130309|gb|ABI83496.1| superoxide dismutase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134049059|gb|ABO46130.1| superoxide dismutase (Fe) [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134254102|gb|EBA53196.1| superoxide dismutase (Fe) [Francisella tularensis subsp. holarctica
           257]
 gi|151568178|gb|EDN33832.1| superoxide dismutase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|156253867|gb|ABU62373.1| superoxide dismutase, Mn/Fe family [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157122861|gb|EDO66978.1| hypothetical protein FTAG_01652 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187711933|gb|ACD30230.1| iron/manganese superoxide dismutase family protein [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|254840083|gb|EET18519.1| superoxide dismutase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158356|gb|ADA77747.1| superoxide dismutase (Fe) [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 192

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 118/197 (59%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L   +SKET+EYH+  HH+ Y  N   L    E    +LEEI+   
Sbjct: 1   MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIV--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 58  KTSNGGIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 115

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+
Sbjct: 116 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYV 174

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW++V E++
Sbjct: 175 EA-LWDIVNWQFVSEQF 190


>gi|255067652|ref|ZP_05319507.1| superoxide dismutase [Neisseria sicca ATCC 29256]
 gi|255048126|gb|EET43590.1| superoxide dismutase [Neisseria sicca ATCC 29256]
          Length = 193

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTPK-GQGKPSGELAAAIDAKWGSFEKFQEAFSACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G+L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGELDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|229031924|ref|ZP_04187911.1| Superoxide dismutase [Bacillus cereus AH1271]
 gi|229174949|ref|ZP_04302469.1| Superoxide dismutase [Bacillus cereus MM3]
 gi|228608617|gb|EEK65919.1| Superoxide dismutase [Bacillus cereus MM3]
 gi|228729388|gb|EEL80378.1| Superoxide dismutase [Bacillus cereus AH1271]
          Length = 203

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVVGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|154250643|ref|YP_001411467.1| superoxide dismutase [Parvibaculum lavamentivorans DS-1]
 gi|154154593|gb|ABS61810.1| Superoxide dismutase [Parvibaculum lavamentivorans DS-1]
          Length = 204

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 121/201 (60%), Gaps = 4/201 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
            +LP LPY+ D L+P++S ETL +H+  HHK+Y + A  L    E+  L L  +I K  G
Sbjct: 2   LELPPLPYAEDALAPHVSAETLSFHYGKHHKSYVEKANGLIEGTELAGLELVPLIRKVAG 61

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S   LFNNA+Q +NH+ +W  M    G G+   AL++ ID + G +EKF       A 
Sbjct: 62  DASQKSLFNNAAQVWNHDFYWNSMSPKGG-GRPKGALAERIDADLGGYEKFAETFKKTAM 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHYIE 179
            QFGSG+ WL +  GKL+I  T NAE P+     +PIL  DVWEH YYLD++ +R  Y++
Sbjct: 121 GQFGSGYCWLVLSGGKLKIYSTANAETPIAGKKDVPILTTDVWEHTYYLDYQNKRQDYLD 180

Query: 180 SFITNLVNWEYVCERYETAML 200
           +F+ +LVNWE+    +E A L
Sbjct: 181 AFLDHLVNWEFAAANFEKADL 201


>gi|67465285|ref|XP_648827.1| Iron-containing superoxide dismutase [Entamoeba histolytica
           HM-1:IMSS]
 gi|464774|sp|P34107|SODF_ENTHI RecName: Full=Superoxide dismutase [Fe]
 gi|312772|emb|CAA50204.1| superoxide dismutase [Entamoeba histolytica]
 gi|56465110|gb|EAL43440.1| Iron-containing superoxide dismutase [Entamoeba histolytica
           HM-1:IMSS]
          Length = 190

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 117/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+Y+ L P++SKETLE+HHD HH  Y +    L    E  H +LEE+I + 
Sbjct: 1   MSFQLPQLPYAYNALEPHISKETLEFHHDKHHATYVNKLNGLVKGTEQEHKTLEELIKQK 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVP-QALSDAIDDNFGSFEKFKSDLITAA 119
                 ++NNA+Q +NH  +W CM    G G  P + L   +   FG  E+FK      A
Sbjct: 61  --PTQAIYNNAAQAWNHAFYWKCM---CGCGVKPSEQLIAKLTAAFGGLEEFKKKFTEKA 115

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
              FGSGW WL   +GKLEI  T +A NP+ NG  P+L  DVWEHAYY+D +  RA Y+E
Sbjct: 116 VGHFGSGWCWLVEHDGKLEIIDTHDAVNPMTNGMKPLLTCDVWEHAYYIDTRNNRAAYLE 175

Query: 180 SFITNLVNWEYVCER 194
            +  N+VNW++V E+
Sbjct: 176 HWW-NVVNWKFVEEQ 189


>gi|257869654|ref|ZP_05649307.1| manganese superoxide dismutase [Enterococcus gallinarum EG2]
 gi|257803818|gb|EEV32640.1| manganese superoxide dismutase [Enterococcus gallinarum EG2]
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   S+EE++  
Sbjct: 1   MSYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEELLAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +  N G G+   A+ +AI++ FGSF  FK + 
Sbjct: 61  FDSVPEDIKTAVRNNGGGHANHSFFWEILAPNAG-GEPTGAIKEAIEETFGSFADFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL +K+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVIKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F + +VNW+ V + Y  A
Sbjct: 180 DYINAFWS-VVNWDKVNDFYAKA 201


>gi|34580412|ref|ZP_00141892.1| superoxide dismutase [Rickettsia sibirica 246]
 gi|28261797|gb|EAA25301.1| superoxide dismutase [Rickettsia sibirica 246]
          Length = 209

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYEKESFKPHFTLETFDYHHGKHHNTYVQNLNNLLKDKEELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K   G GK    + + I+ +FGSFE+F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHTFFWHSIKPQSG-GKPSGKILEQINKDFGSFEEFCEQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ +G  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLIYHDNRLQIIKTANAGTPIAHGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWKFV 203


>gi|168988704|pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988705|pdb|2RCV|B Chain B, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988706|pdb|2RCV|C Chain C, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988707|pdb|2RCV|D Chain D, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988708|pdb|2RCV|E Chain E, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988709|pdb|2RCV|F Chain F, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988710|pdb|2RCV|G Chain G, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988711|pdb|2RCV|H Chain H, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNW+ V   Y
Sbjct: 180 DYISAFW-NVVNWDEVARLY 198


>gi|212712067|ref|ZP_03320195.1| hypothetical protein PROVALCAL_03144 [Providencia alcalifaciens DSM
           30120]
 gi|212685589|gb|EEB45117.1| hypothetical protein PROVALCAL_03144 [Providencia alcalifaciens DSM
           30120]
          Length = 192

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y  N   L    +   LSLEEII   
Sbjct: 1   MSFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTKFEGLSLEEII--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S+AG+FNNA+Q +NH  +W C+  N G G+    +++AI+  FGSF +FK     AA 
Sbjct: 58  KTSDAGVFNNAAQVWNHTFYWHCLAPNAG-GEPTGKVAEAINKAFGSFAQFKEQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  P+     P+L +D+WEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGSLAIVNTSNAATPISGDDKPVLTVDIWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW++V E
Sbjct: 177 NFWA-LVNWKFVEE 189


>gi|269965975|ref|ZP_06180067.1| superoxide dismutase, Fe [Vibrio alginolyticus 40B]
 gi|269829371|gb|EEZ83613.1| superoxide dismutase, Fe [Vibrio alginolyticus 40B]
          Length = 199

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 6   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 65

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 66  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 121

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 122 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 181

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 182 NGFWA-LVNWDFVAE 195


>gi|238650234|ref|YP_002916085.1| superoxide dismutase [Rickettsia peacockii str. Rustic]
 gi|238624332|gb|ACR47038.1| superoxide dismutase [Rickettsia peacockii str. Rustic]
          Length = 209

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYEKESFKPHFTLETFDYHHGKHHNTYVQNLNNLLKDKEELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K   G GK    + + I+ +FGSFE+F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHTFFWHSIKPQGG-GKPSGKILEQINKDFGSFEEFCEQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ +G  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLVYHDNRLQIIKTANAGTPIAHGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWKFV 203


>gi|257899007|ref|ZP_05678660.1| manganese superoxide dismutase [Enterococcus faecium Com15]
 gi|257836919|gb|EEV61993.1| manganese superoxide dismutase [Enterococcus faecium Com15]
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTIEELLSD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G G+   A+ +AI++ FG F  FK + 
Sbjct: 61  MDAVPTDIKTAVRNNGGGHANHSFFWEIMAPNAG-GEPTGAIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVLENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +R+E A
Sbjct: 180 DYIAAFW-NVINWDEVNKRFEAA 201


>gi|326402873|ref|YP_004282954.1| superoxide dismutase [Acidiphilium multivorum AIU301]
 gi|325049734|dbj|BAJ80072.1| superoxide dismutase [Acidiphilium multivorum AIU301]
          Length = 201

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 126/198 (63%), Gaps = 9/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALK--LASDAEMLHLSLEEII 57
           M F+LP LPY++  L+ + M +ETLE HH  HH+ Y   AL   +  +A++   SLEEI+
Sbjct: 1   MAFELPALPYAHAALAAHGMCQETLELHHGKHHQAYV-TALNGFVEKNADLQGKSLEEIV 59

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             ++     A +FNNA Q++NHNLFW CM   DG GK+P  L   I ++FG   +FK   
Sbjct: 60  AFTYNKADLAPVFNNAGQHWNHNLFWQCMSPTDG-GKLPGRLEAKIAEDFGGVAQFKDAF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLING-AIPILGIDVWEHAYYLDFKYR 173
            TA +TQFGSGW WL +   GKL ++KT N  NP+  G   P+LG+DVWEH+YYLDF+ R
Sbjct: 119 KTAGTTQFGSGWAWLILTPGGKLAVTKTPNGSNPVATGEGKPLLGLDVWEHSYYLDFRNR 178

Query: 174 RAHYIESFITNLVNWEYV 191
           R  YI++++  L N+ + 
Sbjct: 179 RPDYIQNWLDKLANYAHA 196


>gi|157849698|gb|ABV89632.1| superoxide dismutase [Brassica rapa]
          Length = 212

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 122/195 (62%), Gaps = 3/195 (1%)

Query: 9   PYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL- 67
           PY  D L P+MSK+TLE+H   HH+ Y DN  K    +E+    LE II  ++ +   L 
Sbjct: 17  PYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQNTYNNGDLLP 76

Query: 68  -FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSG 126
            FNNA+Q +NH  FW  MK   G     + L+  ++ +F S+EKF  +   AA+TQFG+G
Sbjct: 77  PFNNAAQAWNHEFFWESMKPGGGGKPSGELLA-LLERDFTSYEKFYDEFNAAAATQFGAG 135

Query: 127 WGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLV 186
           W WL+  + KL++ KT NA NPL+ G+ P+L IDVWEHAYYLDF+ RR  YI++F+ NLV
Sbjct: 136 WAWLAYADNKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMNNLV 195

Query: 187 NWEYVCERYETAMLA 201
           + E V  R E A  A
Sbjct: 196 SCEAVSSRLEAAKAA 210


>gi|189500399|ref|YP_001959869.1| Superoxide dismutase [Chlorobium phaeobacteroides BS1]
 gi|189495840|gb|ACE04388.1| Superoxide dismutase [Chlorobium phaeobacteroides BS1]
          Length = 201

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 123/202 (60%), Gaps = 3/202 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +  P LPY+ + L+P++S ET+ +H+  HH  Y      + +       ++E++I+ +
Sbjct: 1   MAYTQPALPYAENALAPHISAETIGFHYGKHHATYISKYNGMVAGTPFDDQTIEDVIVAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                 AGLFNN +Q +NH+ +W  +   DG G     + + I+ +FG ++KF+ +L  A
Sbjct: 61  ANDPEKAGLFNNGAQAWNHSFYWNSLSP-DGGGAPGGQIGEKINADFGGYDKFREELANA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +  G+L+I KT NA+ PL NG  PIL IDVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDKGQLKIVKTANAQTPLTNGMFPILTIDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETAML 200
            + I  L+NW +    +E A +
Sbjct: 180 SAVIGELLNWNFAASNFEAAQV 201


>gi|51473717|ref|YP_067474.1| superoxide dismutase [Rickettsia typhi str. Wilmington]
 gi|81692290|sp|Q68WK0|SODF_RICTY RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|51460029|gb|AAU03992.1| superoxide dismutase [Rickettsia typhi str. Wilmington]
          Length = 209

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 117/191 (61%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--S 60
           F LP+LPY+ +   P+ + ET +YHH  HH +Y  N   L  D E L     E IIK  S
Sbjct: 14  FILPDLPYAKESFKPHFTCETFDYHHGKHHNSYVQNLNNLLKDREELQKKDLEGIIKWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S   +FNNASQ +NH  FW  +K + G GK    + + I  +FGSFE+F       A 
Sbjct: 74  KNSEVTVFNNASQIWNHTFFWYSIKPHGG-GKPSGKVFEQISQDFGSFEQFCEQFKQEAL 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+   N KL+I KT NA+ P++N   PIL  DVWEHAYY+D++ +R+ YI+ 
Sbjct: 133 GQFGSGWVWVVYNNNKLQIIKTSNADTPIVNLMKPILVCDVWEHAYYIDYRNKRSDYIDI 192

Query: 181 FITNLVNWEYV 191
           FI++++NW++V
Sbjct: 193 FISHMINWKFV 203


>gi|170698600|ref|ZP_02889668.1| Superoxide dismutase [Burkholderia ambifaria IOP40-10]
 gi|170136453|gb|EDT04713.1| Superoxide dismutase [Burkholderia ambifaria IOP40-10]
          Length = 192

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPSGALGDAINAKWGSYDAFKEAFSKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|227550529|ref|ZP_03980578.1| superoxide dismutase [Enterococcus faecium TX1330]
 gi|257888556|ref|ZP_05668209.1| manganese superoxide dismutase [Enterococcus faecium 1,141,733]
 gi|257897069|ref|ZP_05676722.1| manganese superoxide dismutase [Enterococcus faecium Com12]
 gi|293378757|ref|ZP_06624915.1| superoxide dismutase, Mn [Enterococcus faecium PC4.1]
 gi|227180430|gb|EEI61402.1| superoxide dismutase [Enterococcus faecium TX1330]
 gi|257824610|gb|EEV51542.1| manganese superoxide dismutase [Enterococcus faecium 1,141,733]
 gi|257833634|gb|EEV60055.1| manganese superoxide dismutase [Enterococcus faecium Com12]
 gi|292642685|gb|EFF60837.1| superoxide dismutase, Mn [Enterococcus faecium PC4.1]
          Length = 202

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTVEELLSD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G G+   A+ +AI++ FG F  FK + 
Sbjct: 61  MDAVPTDIKTAVRNNGGGHANHSFFWEIMAPNAG-GEPTGAIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +R+E A
Sbjct: 180 DYIAAFW-NVINWDEVNKRFEAA 201


>gi|82749846|ref|YP_415587.1| manganese/iron superoxide dismutase [Staphylococcus aureus RF122]
 gi|123768525|sp|Q2YUU9|SODM2_STAAB RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|82655377|emb|CAI79760.1| superoxide dismutase [Mn/Fe] [Staphylococcus aureus RF122]
          Length = 199

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLPNLPY+YD L PY+ + T+E+HHD HH  Y           E+ H SL ++I   
Sbjct: 1   MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   ++NH+LFW  +  N + KG V     D I   +G+ ++FK++ 
Sbjct: 61  DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGV----IDDIKAQWGTLDEFKNEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+T FGSGW WL V NGKLEI  T N +NPL  G  PIL  DVWEHAYYL ++ +R 
Sbjct: 117 ANKATTLFGSGWTWLVVNNGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+ +F  N+VNW+ V E Y+ A
Sbjct: 177 DYMTAFW-NIVNWKKVDELYQAA 198


>gi|8918742|dbj|BAA97805.1| manganese superoxide dismutase [Vibrio parahaemolyticus]
          Length = 202

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     + +   SL+EI    
Sbjct: 1   MSHTFPALPYPYDALEPYIDAKTMEVHYSKHHKTYFDKFVTAVQGSVLETQSLDEIFAAI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM   +G G+   AL+ AI+D FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHILYWNCMSP-EGGGEPQGALAQAINDKFGHFEKFKDEFAQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGDIHITSTSNQDNPLMDVADVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A++
Sbjct: 180 YIDAW-WNVVNWRAVEENYARALV 202


>gi|293396310|ref|ZP_06640588.1| superoxide dismutase [Serratia odorifera DSM 4582]
 gi|291421099|gb|EFE94350.1| superoxide dismutase [Serratia odorifera DSM 4582]
          Length = 192

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 117/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P++S ETLEYH+  HH  Y  N   L   +E    SLEEI+  +
Sbjct: 1   MSFTLPALPYAKDALEPHISAETLEYHYGKHHNAYVVNLNALIDGSEFQEKSLEEIVKTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+    G G+    L++AI+  FGSF+KFK     +A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHCLSP-QGGGEPNGKLAEAINRAFGSFDKFKQAFTQSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 GNFGAGWTWLVKKSDGSLAIVNTSNAATPLTGEDKPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW +V E
Sbjct: 177 NFWA-LVNWAFVAE 189


>gi|15892701|ref|NP_360415.1| superoxide dismutase [Rickettsia conorii str. Malish 7]
 gi|229586773|ref|YP_002845274.1| Superoxide dismutase [Rickettsia africae ESF-5]
 gi|20140113|sp|Q92HJ3|SODF_RICCN RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|15619875|gb|AAL03316.1| superoxide dismutase [Rickettsia conorii str. Malish 7]
 gi|228021823|gb|ACP53531.1| Superoxide dismutase [Rickettsia africae ESF-5]
          Length = 209

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYEKESFKPHFTLETFDYHHGKHHNTYVQNLNNLLKDKEELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K   G GK    + + I+ +FGSFE+F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHTFFWHSIKPQGG-GKPSGKILEQINKDFGSFEEFCEQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ +G  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLIYHDNRLQIIKTANAGTPIAHGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWKFV 203


>gi|262393707|ref|YP_003285561.1| superoxide dismutase (Fe) [Vibrio sp. Ex25]
 gi|262337301|gb|ACY51096.1| superoxide dismutase (Fe) [Vibrio sp. Ex25]
          Length = 194

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 177 NGFWA-LVNWDFVAE 190


>gi|261343973|ref|ZP_05971618.1| superoxide dismutase [Providencia rustigianii DSM 4541]
 gi|282568363|gb|EFB73898.1| superoxide dismutase [Providencia rustigianii DSM 4541]
          Length = 192

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y  N   L    +   LSLEEII   
Sbjct: 1   MSFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTKFEGLSLEEII--- 57

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S AG+FNNA+Q +NH  +W C+  N G G+    +++AI+  FGSF +FK     AA 
Sbjct: 58  KTSEAGVFNNAAQVWNHTFYWHCLAPNAG-GEPTGKVAEAINKAFGSFAQFKEQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  P+     PIL +D+WEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGSLAIVNTSNAATPISGDDKPILTVDIWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW++V E
Sbjct: 177 NFWA-LVNWKFVEE 189


>gi|125616872|gb|ABN46889.1| manganese superoxide dismutase [Bacillus subtilis subsp. natto]
          Length = 202

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL++ I   FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGALAEEISSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNW+ V   Y
Sbjct: 180 DYISAFW-NVVNWDEVARLY 198


>gi|52081038|ref|YP_079829.1| superoxide dismutase [Bacillus licheniformis ATCC 14580]
 gi|52786415|ref|YP_092244.1| hypothetical protein BLi02679 [Bacillus licheniformis ATCC 14580]
 gi|319645004|ref|ZP_07999237.1| manganese superoxide dismutase [Bacillus sp. BT1B_CT2]
 gi|52004249|gb|AAU24191.1| superoxide dismutase [Bacillus licheniformis ATCC 14580]
 gi|52348917|gb|AAU41551.1| SodA [Bacillus licheniformis ATCC 14580]
 gi|114848848|gb|ABI83624.1| Mn-superoxide dismutase [Bacillus sp. 110-2]
 gi|317392813|gb|EFV73607.1| manganese superoxide dismutase [Bacillus sp. BT1B_CT2]
          Length = 202

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y     + +A   ++   S+EE++  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G     L++AI+  FGSF++FK D 
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGG-GAPTGELAEAINSKFGSFDQFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N+VNW+ V   Y  A
Sbjct: 180 DYIKAFW-NVVNWDEVARLYSEA 201


>gi|296314553|ref|ZP_06864494.1| superoxide dismutase [Neisseria polysaccharea ATCC 43768]
 gi|296838726|gb|EFH22664.1| superoxide dismutase [Neisseria polysaccharea ATCC 43768]
          Length = 193

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W     + G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGF-TSKGQGKPSGELAAAIDTKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|311745178|ref|ZP_07718963.1| superoxide dismutase, Mn [Algoriphagus sp. PR1]
 gi|126577700|gb|EAZ81920.1| superoxide dismutase, Mn [Algoriphagus sp. PR1]
          Length = 201

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 125/203 (61%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L P +  +T+E HH  HH  Y  N  K     ++   SLEE ++K 
Sbjct: 1   MAFELPSLPYAYDALEPNIDAKTMEIHHSKHHNGYVTNLNKAVEGTDLEGKSLEE-LLKI 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            GSN  + NN   ++NH+LFW+ +   DG G+    L+D+I   FGSF  FK     AA+
Sbjct: 60  AGSNTAVRNNGGGHFNHSLFWSILSP-DGGGEPTGELADSISAKFGSFAAFKETFNKAAA 118

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL +   K L +  + N +NPL++ A     PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCIDTKKELCVCSSPNQDNPLMDVAECPGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+++W+ V +RY  A
Sbjct: 179 DYINAFW-NVIDWDAVSKRYAAA 200


>gi|319787055|ref|YP_004146530.1| superoxide dismutase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465567|gb|ADV27299.1| Manganese/iron superoxide dismutase-like protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 203

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P++  ET++ HH  HH+ Y +N        E   L +EE++ K+
Sbjct: 1   MAYTLPELPYAYDALEPHIDTETMKIHHTKHHQTYINNVNAALEGTEYADLPVEELVKKT 60

Query: 61  HGSNAGL----FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                 L     NN   + NH+LFW  M  N G G     ++ AI+ + G FEKFK    
Sbjct: 61  KSLPENLQGVVRNNGGGHANHSLFWTVMAPNAG-GAPKGDIAKAIEQDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV  + K+ +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKVVVESSANQDSPLMDGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V  RY+ A+
Sbjct: 180 EYIGAFF-NVVNWDEVERRYQEAV 202


>gi|241896766|dbj|BAH79725.1| alcohol oxidase [Paenibacillus sp. AIU 311]
          Length = 205

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 123/202 (60%), Gaps = 8/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M F+LP LPY  D L P++  +T+E HHD HH  Y  N    L +  E+ + SLEE+I  
Sbjct: 1   MAFQLPPLPYPNDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQNKSLEELISN 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH+LFW  +    G  K    L+ AID   G  +KFK + 
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHSLFWEIIAPKGGD-KPNGLLAQAIDSELGGLDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V KNGKL ++ T N +NPL+ G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVDKNGKLAVTSTPNQDNPLMEGQTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYE 196
             YI +F  N++NW+ V +RY+
Sbjct: 180 PDYIAAFW-NVLNWDVVSKRYQ 200


>gi|59711528|ref|YP_204304.1| superoxide dismutase, Fe [Vibrio fischeri ES114]
 gi|197334805|ref|YP_002155684.1| superoxide dismutase (Fe) [Vibrio fischeri MJ11]
 gi|59479629|gb|AAW85416.1| superoxide dismutase, Fe [Vibrio fischeri ES114]
 gi|197316295|gb|ACH65742.1| superoxide dismutase (Fe) [Vibrio fischeri MJ11]
          Length = 194

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MSFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A+++AI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVAEAINAAFGSFEEFKAQFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDFRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F  NLVNW +V E
Sbjct: 177 GAFW-NLVNWSFVEE 190


>gi|167753269|ref|ZP_02425396.1| hypothetical protein ALIPUT_01541 [Alistipes putredinis DSM 17216]
 gi|167659200|gb|EDS03330.1| hypothetical protein ALIPUT_01541 [Alistipes putredinis DSM 17216]
          Length = 422

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 124/195 (63%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  K+P LPYS + L+P MSKET EYH+  H + Y DN  +L        +SL+EI+ K+
Sbjct: 177 MVHKMPELPYSTEALAPKMSKETFEYHYGKHLQTYVDNLNRLIPGTPYESMSLQEIVKKA 236

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  F+  +  +  +  +PQ L+D I  +FGS E FK +   AA+
Sbjct: 237 DGP---IFNNAAQAWNHTFFFLMLTPD--QKPMPQKLADRIARDFGSVEAFKEEFSKAAT 291

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL+  K+GKL+I    NA NP+  G  P++ IDVWEHAYY+D++ RRA +I+
Sbjct: 292 GLFGSGWTWLAADKDGKLQIISESNAGNPMTKGLKPVMTIDVWEHAYYIDYRNRRADFIK 351

Query: 180 SFITNLVNWEYVCER 194
           S+   L++W+ V +R
Sbjct: 352 SY-WELIDWDKVADR 365


>gi|86131066|ref|ZP_01049665.1| Superoxide dismutase [Dokdonia donghaensis MED134]
 gi|85818477|gb|EAQ39637.1| Superoxide dismutase [Dokdonia donghaensis MED134]
          Length = 202

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P +  +T+E HH  HH  Y +         ++   ++E I+I  
Sbjct: 1   MSFTLPELPYAKDALEPNIDAKTMEIHHGKHHAGYTNKLNNAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH LFW  M   DG G+    L++AI+  +G+FE FK    +AA 
Sbjct: 61  DMSNTAVRNNGGGFYNHRLFWEVMSP-DGGGEPTGELAEAINAAYGNFESFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V + GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPKVGCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ +F  N++NWE V   Y
Sbjct: 180 DYVNAFF-NVINWEKVSALY 198


>gi|332291751|ref|YP_004430360.1| Superoxide dismutase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169837|gb|AEE19092.1| Superoxide dismutase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 202

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 116/200 (58%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P +  +T+E HH  HH  Y           ++   ++E I+I  
Sbjct: 1   MSFTLPELPYAKDALEPNIDTKTMEIHHGKHHAGYTSKLNTAIEGTDLSGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH LFW  M   DG G+    L++AI+  +G+FE FK    +AA 
Sbjct: 61  DMSNTAVRNNGGGFYNHRLFWEVMSP-DGGGEPTGELAEAINAAYGNFESFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V + GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPKVGCGGFPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ +F  N++NWE V   Y
Sbjct: 180 DYVNAFF-NVINWEKVSALY 198


>gi|261392763|emb|CAX50339.1| superoxide dismutase [Fe] [Neisseria meningitidis 8013]
          Length = 195

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTPK-GQGKPAGELAAAIDAKWGSFEKFQEAFSACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|3790114|emb|CAA05291.1| manganese superoxide dismutase [Bacillus licheniformis]
          Length = 202

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y     + +A   ++   S+EE++  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G     L++AI+  FGSF++FK D 
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGG-GAPTGELAEAINSKFGSFDQFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAARFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N+VNW+ V   Y  A
Sbjct: 180 DYIKAFW-NVVNWDEVAPLYSEA 201


>gi|1303851|dbj|BAA12507.1| YqgD [Bacillus subtilis]
          Length = 226

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K +  +  + + S+EE++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH LFW  +  N G G+   AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGG-GEPTGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNW+ V   Y
Sbjct: 180 DYISAFW-NVVNWDEVARLY 198


>gi|149178189|ref|ZP_01856783.1| superoxide dismutase, Mn family protein [Planctomyces maris DSM
           8797]
 gi|148842971|gb|EDL57340.1| superoxide dismutase, Mn family protein [Planctomyces maris DSM
           8797]
          Length = 203

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNY---ADNALKLASD--AEMLHLSLEE 55
           M + LP+LPY+YD L P++  +T+E HH  HH+ Y   A+ AL+  SD  A+ +   + +
Sbjct: 1   MSYSLPDLPYAYDALEPHIDAKTMEIHHTKHHQAYISKANAALEGHSDLAAKSIEDLMSD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH+LFW  M  + G G     L+  ID  FGSF+ FK   
Sbjct: 61  LSAVPEDIRGAIRNNGGGHANHSLFWTVMSPS-GGGAPSGDLAADIDSTFGSFDAFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WLSV  GKL +  T N + PL  G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 SNAAATRFGSGWAWLSVDGGKLVVESTPNQDTPLSEGHTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +RY  A
Sbjct: 180 DYISAFF-NVINWDEVAKRYAAA 201


>gi|187925168|ref|YP_001896810.1| superoxide dismutase [Burkholderia phytofirmans PsJN]
 gi|187716362|gb|ACD17586.1| Superoxide dismutase [Burkholderia phytofirmans PsJN]
          Length = 192

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 121/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L P+MS+ETLEYH+  HH+ Y  N   L    E  +LSLEEI+ K+
Sbjct: 1   MEHTLPPLPFAKNALVPHMSEETLEYHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G G    AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNAAQVWNHTFFWNSLSPQGG-GAPTGALADAINAKWGSFDKFKEEFAKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           ++  N+ NW++  + +
Sbjct: 177 AYW-NIANWDFASKNF 191


>gi|52141224|ref|YP_085605.1| superoxide dismutase, Mn [Bacillus cereus E33L]
 gi|51974693|gb|AAU16243.1| superoxide dismutase, Mn [Bacillus cereus E33L]
          Length = 203

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGYAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|218767996|ref|YP_002342508.1| putative superoxide dismutase [Neisseria meningitidis Z2491]
 gi|121052004|emb|CAM08313.1| putative superoxide dismutase [Neisseria meningitidis Z2491]
          Length = 195

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTPK-GQGKPSGELAAAIDAKWGSFEKFQEAFSACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|21243120|ref|NP_642702.1| superoxidase dismutase [Xanthomonas axonopodis pv. citri str. 306]
 gi|325928097|ref|ZP_08189310.1| superoxide dismutase [Xanthomonas perforans 91-118]
 gi|21108638|gb|AAM37238.1| superoxidase dismutase [Xanthomonas axonopodis pv. citri str. 306]
 gi|325541595|gb|EGD13124.1| superoxide dismutase [Xanthomonas perforans 91-118]
          Length = 203

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|262274556|ref|ZP_06052367.1| superoxide dismutase [Fe] [Grimontia hollisae CIP 101886]
 gi|262221119|gb|EEY72433.1| superoxide dismutase [Fe] [Grimontia hollisae CIP 101886]
          Length = 194

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 120/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S+ETLE+HH  HH  Y      L    E+ + SLEEII  S
Sbjct: 1   MAFQLPALPYEKNALEPHISQETLEFHHGKHHNTYVVKLNGLIEGTELENKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI  +FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLSPNGG-GEPTGDVADAIAKSFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L+I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLDIVNTSNAGTPLTEEGVTPLLTVDLWEHAYYIDFRNLRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F   LVNWE+V +
Sbjct: 177 NAFWA-LVNWEFVAQ 190


>gi|161869817|ref|YP_001598986.1| superoxide dismutase [Neisseria meningitidis 053442]
 gi|161595370|gb|ABX73030.1| superoxide dismutase [Neisseria meningitidis 053442]
          Length = 195

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W     + G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGF-TSKGQGKPAGKLAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|196052752|gb|ABY48757.4| iron-superoxide dismutase [Dimocarpus longan]
 gi|210112069|gb|ACJ07160.1| chloroplast iron superoxide dismutase [Dimocarpus longan]
          Length = 275

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 125/215 (58%), Gaps = 20/215 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+L   PY  + L P+MS++TLEYH   HH+ Y +N  K  +  E+  +SLEE+++ S+ 
Sbjct: 19  FELKPPPYPLNALEPHMSRDTLEYHWGKHHRTYVENLNKQTAGTELDGMSLEEVVVVSYN 78

Query: 63  SNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               L  FNNA+Q +NH+ FW  MK   G     + L   I+ +FGSFE+F S+  +AA+
Sbjct: 79  RGYFLPSFNNAAQAWNHDFFWESMKPGGGGKPSGELLQ-MIERDFGSFERFLSEFKSAAA 137

Query: 121 TQFGSGWGWLSVKNGKLEIS-----------------KTQNAENPLINGAIPILGIDVWE 163
           TQFGSGW WL  K  +L++                  K+ NA NPL+    P+L IDVWE
Sbjct: 138 TQFGSGWAWLCYKANRLDVDNAINPLPSDEDKKLVVVKSPNAVNPLVWDYSPLLTIDVWE 197

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           HAYYLDF+ RR  YI  F+  LV+WE V  R E A
Sbjct: 198 HAYYLDFQNRRPDYISVFMDKLVSWEAVSRRLEIA 232


>gi|294624423|ref|ZP_06703112.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292601272|gb|EFF45320.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 203

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVDRRYHAAI 202


>gi|149378286|ref|ZP_01895996.1| superoxide dismutase, Fe [Marinobacter algicola DG893]
 gi|149357420|gb|EDM45932.1| superoxide dismutase, Fe [Marinobacter algicola DG893]
          Length = 192

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S+ETLEYH+  HH  Y      L    +  + SLE+II  +
Sbjct: 1   MAFELPALPYEKNALEPHISQETLEYHYGKHHNTYVTKLNGLVEGTDNANKSLEDIIKSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    LFNNA+Q +NH  +W C+  N G G+   A  DAI+  FGSFE FK +    A+
Sbjct: 61  SGP---LFNNAAQIWNHTFYWHCLSPNGG-GEPTGAAKDAIEKAFGSFEDFKKEFNDKAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G + I  T NAE PL     P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 NNFGSGWTWLVKKADGSVAIVNTSNAETPLTTADKPVLTVDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW++V E
Sbjct: 177 AFW-KLVNWDFVNE 189


>gi|58582335|ref|YP_201351.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624214|ref|YP_451586.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576182|ref|YP_001913111.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|1150790|gb|AAB47971.1| superoxide dismutase [Xanthomonas campestris]
 gi|58426929|gb|AAW75966.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368154|dbj|BAE69312.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520634|gb|ACD58579.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 203

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|222110755|ref|YP_002553019.1| superoxide dismutase [Acidovorax ebreus TPSY]
 gi|221730199|gb|ACM33019.1| Superoxide dismutase [Acidovorax ebreus TPSY]
          Length = 193

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  +++LEEI+ KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+ AI   +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPNGG-GEPSGALAQAIHAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGTVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|22125843|ref|NP_669266.1| superoxide dismutase [Yersinia pestis KIM 10]
 gi|45441964|ref|NP_993503.1| superoxide dismutase [Yersinia pestis biovar Microtus str. 91001]
 gi|21958774|gb|AAM85517.1|AE013798_4 superoxide dismutase, iron [Yersinia pestis KIM 10]
 gi|45436827|gb|AAS62380.1| superoxide dismutase (Fe) [Yersinia pestis biovar Microtus str.
           91001]
          Length = 206

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEI+  +
Sbjct: 15  MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDTEFAGKSLEEIVKTA 74

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    +++AI+ +FGSF +FK+    AA 
Sbjct: 75  NG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKIAEAINKSFGSFAEFKAQFTDAAV 130

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 131 KNFGAGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLE 190

Query: 180 SFITNLVNWEYV 191
           +F   +VNW + 
Sbjct: 191 NFWA-VVNWSFA 201


>gi|294140655|ref|YP_003556633.1| superoxide dismutase, Fe [Shewanella violacea DSS12]
 gi|293327124|dbj|BAJ01855.1| superoxide dismutase, Fe [Shewanella violacea DSS12]
          Length = 193

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 123/198 (62%), Gaps = 9/198 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S+ET+E+H+  HH  Y      L    E+   SLEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISQETIEFHYGKHHNTYVVKLNGLVDGTELAEKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G    A++ AIDD FGSFE+FK+    +A 
Sbjct: 61  TG---GIFNNAAQIWNHTFYWNCLSPN-GGGVATGAVAKAIDDAFGSFEEFKAKFTDSAV 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHY 177
             FGS W WL VKN  G + I  T NA  PL + ++ PI+ +DVWEHAYY+D++  R +Y
Sbjct: 117 NNFGSAWTWL-VKNADGSVAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPNY 175

Query: 178 IESFITNLVNWEYVCERY 195
           +  +   LVNW++V + +
Sbjct: 176 LAHYW-ELVNWDFVNKNF 192


>gi|314933725|ref|ZP_07841090.1| superoxide dismutase, Mn [Staphylococcus caprae C87]
 gi|313653875|gb|EFS17632.1| superoxide dismutase, Mn [Staphylococcus caprae C87]
          Length = 199

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 123/203 (60%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+  +
Sbjct: 1   MAFELPKLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  S+    + NN   + NH+LFW  +  N + KG+V     D I + +GS ++FK + 
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLSPNSEEKGEV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y+ +
Sbjct: 177 DYISAFW-NVVNWEKVDELYKAS 198


>gi|254786969|ref|YP_003074398.1| superoxide dismutase [Teredinibacter turnerae T7901]
 gi|237685134|gb|ACR12398.1| superoxide dismutase [Teredinibacter turnerae T7901]
          Length = 193

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 7/193 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY    L+P++S+ETL++H+  HHK Y D    L    E    +LEE++  S
Sbjct: 1   MAFELPELPYERGALAPHISEETLDFHYGKHHKTYVDKLNGLVPGTEFEGKTLEEVVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH+ +W C+  N G G+   A++DAI+  FGSF  FK    T+A 
Sbjct: 61  SG---GVFNNAAQIWNHSFYWNCLSPN-GGGEPTGAIADAINSAFGSFADFKEKFTTSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G +EI  T NA  PL +  + P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSVEIVNTSNAATPLTDDTLTPLLTVDLWEHAYYIDYRNARPSYM 176

Query: 179 ESFITNLVNWEYV 191
           ++F  NLVNW++V
Sbjct: 177 DAFW-NLVNWDFV 188


>gi|15676780|ref|NP_273925.1| superoxide dismutase [Neisseria meningitidis MC58]
 gi|121634659|ref|YP_974904.1| superoxide dismutase [Neisseria meningitidis FAM18]
 gi|7226122|gb|AAF41295.1| superoxide dismutase [Neisseria meningitidis MC58]
 gi|120866365|emb|CAM10108.1| putative superoxide dismutase [Neisseria meningitidis FAM18]
 gi|254671776|emb|CBA09629.1| Superoxide dismutase [Neisseria meningitidis alpha153]
 gi|316985779|gb|EFV64723.1| superoxide dismutase [Fe] [Neisseria meningitidis H44/76]
 gi|325128035|gb|EGC50933.1| superoxide dismutase Mn/Fe [Neisseria meningitidis N1568]
 gi|325132298|gb|EGC54991.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M6190]
 gi|325137731|gb|EGC60306.1| superoxide dismutase Mn/Fe [Neisseria meningitidis ES14902]
 gi|325139962|gb|EGC62491.1| superoxide dismutase Mn/Fe [Neisseria meningitidis CU385]
 gi|325142143|gb|EGC64567.1| superoxide dismutase Mn/Fe [Neisseria meningitidis 961-5945]
 gi|325198086|gb|ADY93542.1| superoxide dismutase Mn/Fe [Neisseria meningitidis G2136]
 gi|325200430|gb|ADY95885.1| superoxide dismutase Mn/Fe [Neisseria meningitidis H44/76]
          Length = 195

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W     + G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGF-TSKGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|157964570|ref|YP_001499394.1| superoxide dismutase [Rickettsia massiliae MTU5]
 gi|157844346|gb|ABV84847.1| Superoxide dismutase [Rickettsia massiliae MTU5]
          Length = 218

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 114/191 (59%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + E  +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 23  FILPDLPYEKESFKPHFTLEAFDYHHGKHHNAYVQNLNNLLKDKEELQKKDLEEIIEWSS 82

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K   G GK    + + I+ +FGSFE+F       A 
Sbjct: 83  QNSNAAIFNNAAQIWNHTFFWHSIKPQGG-GKPSGKILEQINKDFGSFEEFCEQFKQEAV 141

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ NG  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 142 GQFGSGWAWLVYHDNRLQIIKTANAGTPIANGMKPLLACDVWEHAYYIDYRNKRPDYVDI 201

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 202 FIKHMINWKFV 212


>gi|239637635|ref|ZP_04678607.1| superoxide dismutase [Staphylococcus warneri L37603]
 gi|239596853|gb|EEQ79378.1| superoxide dismutase [Staphylococcus warneri L37603]
 gi|330685990|gb|EGG97613.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU121]
          Length = 199

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 122/203 (60%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPY++D L P++ KET+E HHD HH  Y           ++   S+EEI+  +
Sbjct: 1   MAFELPKLPYAFDALEPHIDKETMEIHHDKHHNTYVTKLNAAVEGTDLEAKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  S+    + NN   + NH+LFW  +  N + KG+V     D I + +GS ++FK + 
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLTPNSEEKGEV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y  A
Sbjct: 177 DYISAFW-NVVNWEKVDELYNAA 198


>gi|108807726|ref|YP_651642.1| superoxide dismutase [Yersinia pestis Antiqua]
 gi|108812002|ref|YP_647769.1| superoxide dismutase [Yersinia pestis Nepal516]
 gi|145598064|ref|YP_001162140.1| superoxide dismutase [Yersinia pestis Pestoides F]
 gi|149365703|ref|ZP_01887738.1| superoxide dismutase [Fe] [Yersinia pestis CA88-4125]
 gi|162419501|ref|YP_001606982.1| superoxide dismutase [Yersinia pestis Angola]
 gi|165926515|ref|ZP_02222347.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938593|ref|ZP_02227149.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010776|ref|ZP_02231674.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211053|ref|ZP_02237088.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400927|ref|ZP_02306433.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422106|ref|ZP_02313859.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424847|ref|ZP_02316600.1| superoxide dismutase [Fe] [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167469394|ref|ZP_02334098.1| superoxide dismutase [Yersinia pestis FV-1]
 gi|218929477|ref|YP_002347352.1| superoxide dismutase [Yersinia pestis CO92]
 gi|229837911|ref|ZP_04458070.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229895072|ref|ZP_04510249.1| superoxide dismutase [Fe] [Yersinia pestis Pestoides A]
 gi|229898474|ref|ZP_04513620.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902314|ref|ZP_04517434.1| superoxide dismutase [Fe] [Yersinia pestis Nepal516]
 gi|270490508|ref|ZP_06207582.1| superoxide dismutase (Fe) [Yersinia pestis KIM D27]
 gi|294503609|ref|YP_003567671.1| superoxide dismutase [Yersinia pestis Z176003]
 gi|108775650|gb|ABG18169.1| superoxide dismutase (Fe) [Yersinia pestis Nepal516]
 gi|108779639|gb|ABG13697.1| superoxide dismutase (Fe) [Yersinia pestis Antiqua]
 gi|115348088|emb|CAL21014.1| superoxide dismutase [Fe] [Yersinia pestis CO92]
 gi|145209760|gb|ABP39167.1| superoxide dismutase (Fe) [Yersinia pestis Pestoides F]
 gi|149292116|gb|EDM42190.1| superoxide dismutase [Fe] [Yersinia pestis CA88-4125]
 gi|162352316|gb|ABX86264.1| superoxide dismutase (Fe) [Yersinia pestis Angola]
 gi|165913467|gb|EDR32088.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921736|gb|EDR38933.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990478|gb|EDR42779.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208233|gb|EDR52713.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958918|gb|EDR55939.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049780|gb|EDR61188.1| superoxide dismutase [Fe] [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056034|gb|EDR65812.1| superoxide dismutase [Fe] [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229680649|gb|EEO76745.1| superoxide dismutase [Fe] [Yersinia pestis Nepal516]
 gi|229688518|gb|EEO80588.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229694277|gb|EEO84324.1| superoxide dismutase [Fe] [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229701960|gb|EEO89982.1| superoxide dismutase [Fe] [Yersinia pestis Pestoides A]
 gi|262361652|gb|ACY58373.1| superoxide dismutase [Yersinia pestis D106004]
 gi|262365608|gb|ACY62165.1| superoxide dismutase [Yersinia pestis D182038]
 gi|270339012|gb|EFA49789.1| superoxide dismutase (Fe) [Yersinia pestis KIM D27]
 gi|294354068|gb|ADE64409.1| superoxide dismutase [Yersinia pestis Z176003]
 gi|320015041|gb|ADV98612.1| Fe-superoxide dismutase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 192

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S ETLEYH+  HH  Y  N   L  D E    SLEEI+  +
Sbjct: 1   MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDTEFAGKSLEEIVKTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G   G+FNNA+Q +NH  +W C+  N G G+    +++AI+ +FGSF +FK+    AA 
Sbjct: 61  NG---GVFNNAAQVWNHTFYWHCLSPNGG-GEPTGKIAEAINKSFGSFAEFKAQFTDAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGAGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYV 191
           +F   +VNW + 
Sbjct: 177 NFWA-VVNWSFA 187


>gi|78048139|ref|YP_364314.1| superoxidase dismutase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|78036569|emb|CAJ24260.1| superoxidase dismutase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 203

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDVGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|291277491|ref|YP_003517263.1| superoxide dismutase (Fe) [Helicobacter mustelae 12198]
 gi|290964685|emb|CBG40540.1| superoxide dismutase (Fe) [Helicobacter mustelae 12198]
          Length = 212

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 118/199 (59%), Gaps = 8/199 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+L  LPY  D    ++S  T ++HH  HH+ Y +N   L  D++  +  L EII KS G
Sbjct: 2   FELRKLPYPKDSFGDFLSPTTFDFHHGKHHQTYINNLNNLIKDSQFANSCLFEIITKSSG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q YNH+ +W C+     K  + Q L  AI+  FG    FK   +T+A+T 
Sbjct: 62  ---GIFNNAAQVYNHDFYWDCITPE--KTSISQELKTAIEKEFGCTNTFKEKFLTSATTL 116

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW WL   V N KLEI +T NA  P+    +P+L +DVWEHAYY+D K  R  Y+E 
Sbjct: 117 FGSGWCWLVYDVANRKLEIVQTSNAATPVTQNKVPLLVVDVWEHAYYVDHKNARPVYLEK 176

Query: 181 FITNLVNWEYVCERYETAM 199
           F  + +NWE+V + YE A+
Sbjct: 177 FYEH-INWEFVSKSYEWAL 194


>gi|152976708|ref|YP_001376225.1| superoxide dismutase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152025460|gb|ABS23230.1| Superoxide dismutase [Bacillus cytotoxicus NVH 391-98]
          Length = 203

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 119/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH+ FW  +  N G   V + L+ AI+  FGSF+ FK++   A
Sbjct: 65  VPEEIRTAVRNNGGGHANHSFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKAEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +++FGSGW WL V NG+LE++ T N ++PL  G  PI+G+DVWEHAYYL ++ RR  YI
Sbjct: 124 GASRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPIIGLDVWEHAYYLHYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 SAFW-NVVDWNAAEKRYQEA 202


>gi|313668651|ref|YP_004048935.1| superoxide dismutase [Neisseria lactamica ST-640]
 gi|313006113|emb|CBN87574.1| putative superoxide dismutase [Neisseria lactamica 020-06]
          Length = 193

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPSGGLAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|90410846|ref|ZP_01218861.1| putative superoxide dismutase [Photobacterium profundum 3TCK]
 gi|90328477|gb|EAS44775.1| putative superoxide dismutase [Photobacterium profundum 3TCK]
          Length = 194

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 90/196 (45%), Positives = 120/196 (61%), Gaps = 9/196 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P++S+ETLEYHH  HH  Y      L    ++   SLEEII  S
Sbjct: 1   MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVKLNGLVEGTDLAEKSLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    ++DAI   FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLSPNAG-GEPTGEVADAIAKAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHY 177
             FGS W WL VKN  G L I  T NA  P+   G  P+L +D+WEHAYY+DF+  R  Y
Sbjct: 117 NNFGSSWTWL-VKNADGSLAIVNTSNAGTPITEEGVTPLLTVDLWEHAYYIDFRNVRPDY 175

Query: 178 IESFITNLVNWEYVCE 193
           + +F + LVNWE+V +
Sbjct: 176 MAAFWS-LVNWEFVAK 190


>gi|260903304|ref|ZP_05911699.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus AQ4037]
 gi|308109543|gb|EFO47083.1| superoxide dismutase [Mn] [Vibrio parahaemolyticus AQ4037]
          Length = 202

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +E+   SL+EI    
Sbjct: 1   MSHTFPALPYPYDALEPYIDAKTMEVHYSKHHKTYFDKFVTAVQGSELETQSLDEIFAAV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM   +G G+   AL+ AI+D FG FEKFK +   AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHILYWNCMSP-EGGGEPQGALAQAINDKFGHFEKFKDEFAQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++  R  
Sbjct: 120 NTFGSGFAWLVVKDGDIHITSTSNQDNPLMDVADVRGEPILALDVWEHAYYISYQNCRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A++
Sbjct: 180 YIDAWW-NVVNWSAVEENYARALV 202


>gi|57339742|gb|AAW49858.1| hypothetical protein FTT0068 [synthetic construct]
          Length = 227

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 118/197 (59%), Gaps = 9/197 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L   +SKET+EYH+  HH+ Y  N   L    E    +LEEI+   
Sbjct: 27  MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIV--- 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 84  KTSNGGIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 141

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGSGW WL VKN  GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+
Sbjct: 142 ATFGSGWAWL-VKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYV 200

Query: 179 ESFITNLVNWEYVCERY 195
           E+ + ++VNW++V E++
Sbjct: 201 EA-LWDIVNWQFVSEQF 216


>gi|241761958|ref|ZP_04760043.1| Superoxide dismutase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373638|gb|EER63210.1| Superoxide dismutase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 208

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LP+   DL P+MS ETLEYHH  HHK+Y D       + ++  LSL E+I K+
Sbjct: 1   MAFALPALPFGAKDLEPHMSAETLEYHHGKHHKSYVDKVNSWVDEKKLAGLSLVEVINKA 60

Query: 61  -HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITA 118
               + GLFNNA+Q +NHN FW  + K    G+ P   L+  I+++FGS E     L   
Sbjct: 61  VETKDKGLFNNAAQAWNHNFFWLGLAK---AGQKPSGKLASLIEESFGSTEALLEKLAAE 117

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHY 177
           A   FGSGW WL +K+GKL I+   + + P+ +  I P+L +DVWEHAYY+D++  R  Y
Sbjct: 118 AVGHFGSGWAWLVLKDGKLAITSYHDGDTPVAHKEIKPLLTLDVWEHAYYIDYRNARPKY 177

Query: 178 IESFITNLVNWEYVCE 193
            +  ++N++NWE+V +
Sbjct: 178 AKDVLSNIINWEFVAK 193


>gi|121594643|ref|YP_986539.1| superoxide dismutase [Acidovorax sp. JS42]
 gi|120606723|gb|ABM42463.1| Superoxide dismutase [Acidovorax sp. JS42]
          Length = 193

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 117/192 (60%), Gaps = 5/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E  +++LEEI+ KS
Sbjct: 1   MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CM  N G G+   AL+ AI   +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMAPNGG-GEPGGALAQAIHAKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGTVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRPKFVE 176

Query: 180 SFITNLVNWEYV 191
           +F+  LVNW++ 
Sbjct: 177 TFLDKLVNWKFA 188


>gi|307725821|ref|YP_003909034.1| Superoxide dismutase [Burkholderia sp. CCGE1003]
 gi|307586346|gb|ADN59743.1| Superoxide dismutase [Burkholderia sp. CCGE1003]
          Length = 257

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 111/190 (58%), Gaps = 2/190 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSN 64
           LP LPY+ D L P +S  T+  H+  HH+ Y DN  KL +   +   +LE+II++SH   
Sbjct: 62  LPPLPYAQDALEPTISARTIGIHYGKHHRAYFDNLHKLLAGTPLEQATLEQIIMQSHDQP 121

Query: 65  A--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           A   +FNNA+Q +NHN +W  +            L  AI+  FGS E     L+  +++Q
Sbjct: 122 ALADVFNNAAQAWNHNFYWNSLSPASAATAPSAKLQAAIERKFGSVEALSKALVATSASQ 181

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGWGWL V  G+L + KT NAE P   G  P+L +DVWEHAYYLD++ RR  Y+ + +
Sbjct: 182 FGSGWGWLVVDRGELAVVKTSNAETPFTRGLAPLLTVDVWEHAYYLDYQNRRPDYLVAAV 241

Query: 183 TNLVNWEYVC 192
            + +NW +  
Sbjct: 242 AHHLNWAFAS 251


>gi|297537393|ref|YP_003673162.1| Superoxide dismutase [Methylotenera sp. 301]
 gi|297256740|gb|ADI28585.1| Superoxide dismutase [Methylotenera sp. 301]
          Length = 194

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 120/198 (60%), Gaps = 5/198 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+   L P++S+ETLE+H+  HH+ Y  N   L    E  + SLEEII KS
Sbjct: 1   MEHTLPALPYAKTALVPHISEETLEFHYGKHHQTYVTNLNNLIKGTEFENASLEEIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NN++Q +NH  FW+ MK N G G    AL+DAI+  +GSF+ FK     +A 
Sbjct: 61  SG---GVYNNSAQIWNHTFFWSSMKPNGG-GAPTGALADAINAKWGSFDDFKKAFQASAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G   +L IDVWEHAYY+D++  RA ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLTIDVWEHAYYIDYRNARAKFVE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F+ +L NW++    + +
Sbjct: 177 VFLASLANWDFAAANFAS 194


>gi|75529095|sp|Q8VQ15|SODM_STAEP RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|18378721|gb|AAL68691.1|AF462457_1 superoxide dismutase [Staphylococcus epidermidis]
          Length = 199

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 123/203 (60%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPY++D L P++ KET+E HHD HH  Y      +    ++   S+EEI+  +
Sbjct: 1   MAFELPKLPYAFDALEPHIDKETMEIHHDKHHNTYVTKLNAVVEGTDLEAKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  S+    + NN   + NH+LFW  +  N + KG+V     + I + +GS ++FK + 
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLTPNSEEKGEV----VEKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y  A
Sbjct: 177 DYISAFW-NVVNWEKVDELYNAA 198


>gi|46450235|gb|AAS96883.1| superoxide dismutase, Fe [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 196

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 116/196 (59%), Gaps = 7/196 (3%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           +P LPY    L P +S  T+ +H+  H   Y  N  K  +   M  + LE+++    G  
Sbjct: 1   MPPLPYPDTALEPAISARTISFHYGKHTAAYYANLNKAVAGTPMATMRLEDVVKSVAGDP 60

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           + AGLFNNA+Q +NH  +WA MK   G G  P  ++DA+  +FGS E     L  AA TQ
Sbjct: 61  AKAGLFNNAAQSWNHTFYWAGMKPGGG-GTPPAKVADALKASFGSVEACMEQLSEAAKTQ 119

Query: 123 FGSGWGWLS--VKNGK--LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           F SGW WL+   +NGK  L++ KT NA+NP+  G  P+L IDVWEHAYYLD++ +R  Y+
Sbjct: 120 FASGWAWLAKGTENGKPVLKVMKTGNADNPMTQGLTPVLTIDVWEHAYYLDYQNKRPDYV 179

Query: 179 ESFITNLVNWEYVCER 194
           ++F   LVNW+ V  R
Sbjct: 180 KAFFEKLVNWDEVATR 195


>gi|254672025|emb|CBA04565.1| Superoxide dismutase [Neisseria meningitidis alpha275]
 gi|308389056|gb|ADO31376.1| putative superoxide dismutase [Neisseria meningitidis alpha710]
 gi|325133977|gb|EGC56632.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M13399]
          Length = 195

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPSGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|262392991|ref|YP_003284845.1| manganese superoxide dismutase [Vibrio sp. Ex25]
 gi|262336585|gb|ACY50380.1| manganese superoxide dismutase [Vibrio sp. Ex25]
          Length = 202

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +E+   SL+EI    
Sbjct: 1   MSHTFPALPYPYDSLEPYIDAKTMEVHYSKHHKTYFDKFVSAVEGSELETQSLDEIFDNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH ++W CM  N G G+   AL+ AI+D FGSF +FK     AA 
Sbjct: 61  SKLSPAVRNNGGGYYNHIIYWNCMSPN-GGGEPQGALAQAINDKFGSFAQFKEAFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G++ I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLIVKDGEIHITSTSNQDNPLMDVVDVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A+L
Sbjct: 180 YIDAW-WNVVNWRAVEENYAHALL 202


>gi|315179545|gb|ADT86459.1| superoxide dismutase, Fe [Vibrio furnissii NCTC 11218]
          Length = 194

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 117/194 (60%), Gaps = 7/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL+YHH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLSPNGG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L I+ T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVC 192
             F   LVNWE+V 
Sbjct: 177 NGFWA-LVNWEFVA 189


>gi|294664935|ref|ZP_06730250.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605305|gb|EFF48641.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 203

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + +L +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKRLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|229163220|ref|ZP_04291175.1| Superoxide dismutase [Bacillus cereus R309803]
 gi|228620283|gb|EEK77154.1| Superoxide dismutase [Bacillus cereus R309803]
          Length = 203

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG++E++ T N ++PL  G  P++G+DVWEHAYYL ++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGEIEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQAA 202


>gi|312883686|ref|ZP_07743410.1| superoxide dismutase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368659|gb|EFP96187.1| superoxide dismutase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 194

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P+++ ETL++HH  HH  Y      L    E  + SLE+II  S
Sbjct: 1   MAFELPALPYAKNALEPHITAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEDIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GIFNNAAQIWNHTFYWHCLAPNAG-GQPTGAVADAINSAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIINTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F + LVNWE+V E
Sbjct: 177 NGFWS-LVNWEFVAE 190


>gi|325203958|gb|ADY99411.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M01-240355]
          Length = 195

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W     + G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGF-TSKGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW  V +R+
Sbjct: 177 GFW-EIVNWNEVAKRF 191


>gi|70728291|ref|YP_258040.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf-5]
 gi|68342590|gb|AAY90196.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf-5]
          Length = 203

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MSFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEWAGWEVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFWA M    G G    AL  AI+   G FE FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWAVMTPAGG-GHPQGALGQAIEQQLGGFESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW  V +RY+ AM
Sbjct: 180 EYINAFY-NVINWPEVAQRYQAAM 202


>gi|188025958|ref|ZP_02960364.2| hypothetical protein PROSTU_02306 [Providencia stuartii ATCC 25827]
 gi|188021079|gb|EDU59119.1| hypothetical protein PROSTU_02306 [Providencia stuartii ATCC 25827]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 119/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L PY+S+ETLEYH+  HH  Y  N   L         SLEEII   
Sbjct: 18  MSFELPALPYAKNALEPYISEETLEYHYGKHHNTYVVNLNNLVKGTAFEGKSLEEII--- 74

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             S+AG+FNNA+Q +NH  +W C+  N G G+    +++AI+  FGSF +FK     AA+
Sbjct: 75  KTSDAGIFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAINKAFGSFAEFKQQFTDAAT 133

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FG+GW WL  K +G L I  T NA  P+     P+L +D+WEHAYY+D++  R  Y+E
Sbjct: 134 KNFGAGWTWLVKKTDGSLAIVNTSNAGTPISGDDKPLLTVDIWEHAYYIDYRNARPKYLE 193

Query: 180 SFITNLVNWEYVCE 193
           +F   LVNW++V E
Sbjct: 194 NFWA-LVNWKFVEE 206


>gi|78067343|ref|YP_370112.1| superoxide dismutase [Burkholderia sp. 383]
 gi|77968088|gb|ABB09468.1| Superoxide dismutase [Burkholderia sp. 383]
          Length = 192

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +S ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISLETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G G    AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGG-GAPTGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  N+VNW++  + +
Sbjct: 177 AFW-NIVNWDFAAKNF 191


>gi|290894106|ref|ZP_06557079.1| superoxide dismutase [Listeria monocytogenes FSL J2-071]
 gi|290556361|gb|EFD89902.1| superoxide dismutase [Listeria monocytogenes FSL J2-071]
          Length = 202

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     + +A   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G G     L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGG-GAPTGDLKSAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NW+   +R++TA
Sbjct: 180 EYIDTFW-NVINWDEANKRFDTA 201


>gi|269962102|ref|ZP_06176456.1| superoxide dismutase, Fe [Vibrio harveyi 1DA3]
 gi|269833186|gb|EEZ87291.1| superoxide dismutase, Fe [Vibrio harveyi 1DA3]
          Length = 194

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 177 NGFWA-LVNWDFVAE 190


>gi|91228463|ref|ZP_01262387.1| superoxide dismutase, Mn [Vibrio alginolyticus 12G01]
 gi|269966825|ref|ZP_06180898.1| Superoxide dismutase [Vibrio alginolyticus 40B]
 gi|91187998|gb|EAS74306.1| superoxide dismutase, Mn [Vibrio alginolyticus 12G01]
 gi|269828492|gb|EEZ82753.1| Superoxide dismutase [Vibrio alginolyticus 40B]
          Length = 202

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY YD L PY+  +T+E H+  HHK Y D  +     +E+   SL+EI    
Sbjct: 1   MSHTFPALPYPYDSLEPYIDAKTMEVHYSKHHKTYFDKFVNAVEGSELETQSLDEIFDNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH ++W CM  N G G+   AL+ AI+D FGSF +FK     AA 
Sbjct: 61  SKLSPAVRNNGGGYYNHIIYWNCMSPN-GGGEPQGALAQAINDKFGSFAQFKEAFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G++ I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLIVKDGEIHITSTSNQDNPLMDVVDVRGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI+++  N+VNW  V E Y  A+L
Sbjct: 180 YIDAW-WNVVNWRAVEENYAHALL 202


>gi|254804749|ref|YP_003082970.1| Superoxide dismutase [Neisseria meningitidis alpha14]
 gi|254668291|emb|CBA05214.1| Superoxide dismutase [Neisseria meningitidis alpha14]
          Length = 195

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E   L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFEKLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTPK-GQGKPSGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|323498224|ref|ZP_08103226.1| superoxide dismutase [Vibrio sinaloensis DSM 21326]
 gi|323316652|gb|EGA69661.1| superoxide dismutase [Vibrio sinaloensis DSM 21326]
          Length = 194

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    SLE+II  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEDIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A+++AI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVAEAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDFRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F   LVNW++V E
Sbjct: 177 NAFWA-LVNWDFVAE 190


>gi|156975285|ref|YP_001446192.1| superoxide dismutase [Vibrio harveyi ATCC BAA-1116]
 gi|156526879|gb|ABU71965.1| hypothetical protein VIBHAR_03014 [Vibrio harveyi ATCC BAA-1116]
          Length = 199

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    +LEEII  S
Sbjct: 6   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 65

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A+++AI+  FGSFE+FK+    AA 
Sbjct: 66  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVAEAINAAFGSFEEFKAKFTDAAI 121

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 122 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 181

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 182 NGFWA-LVNWDFVAE 195


>gi|309379445|emb|CBX22012.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 193

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GIFNNAAQTWNHTFYWLGFTP-KGQGKPSGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|163786809|ref|ZP_02181257.1| hypothetical protein FBALC1_16527 [Flavobacteriales bacterium
           ALC-1]
 gi|159878669|gb|EDP72725.1| hypothetical protein FBALC1_16527 [Flavobacteriales bacterium
           ALC-1]
          Length = 202

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +   T+E HH  HH  Y +         ++   S+E I+   
Sbjct: 1   MAFELPKLKYAYDALEPNIDARTMEIHHSKHHNGYTNKLNAAIEGTDLEGKSIESILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N G+ NN   +YNH+LFW  M   D +G +   L DAI+  FGS + F      AA+
Sbjct: 61  DMNNKGVRNNGGGFYNHSLFWEVMNPED-RGYLSGELKDAIEAEFGSKDAFIEAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW  V  RY  A
Sbjct: 180 DYINAFF-NVINWNEVERRYAEA 201


>gi|301055769|ref|YP_003793980.1| Mn containing superoxide dismutase [Bacillus anthracis CI]
 gi|300377938|gb|ADK06842.1| Mn containing superoxide dismutase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 211

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIKS-- 60
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE+  KS  
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELADKSVE 64

Query: 61  ----------HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEK 110
                           + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ 
Sbjct: 65  ELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDA 123

Query: 111 FKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDF 170
           FK +   A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL++
Sbjct: 124 FKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNY 183

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETA 198
           + RR  YI +F  N+V+W    +RY+ A
Sbjct: 184 QNRRPDYIGAFW-NVVDWNAAEKRYQEA 210


>gi|161505433|ref|YP_001572545.1| superoxide dismutase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866780|gb|ABX23403.1| hypothetical protein SARI_03588 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 210

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 126/207 (60%), Gaps = 17/207 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E  +L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 64

Query: 60  SHGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSD 114
                A     L NNA  + NH+LFW  +KK    G   Q  L  AI+ +FGS EKFK +
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK----GTTLQGDLKAAIERDFGSVEKFKEE 120

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPL----INGA--IPILGIDVWEHAYYL 168
              AA+++FGSGW WL +K  KL +  T N ++PL    I+GA   PILG+DVWEHAYYL
Sbjct: 121 FEKAAASRFGSGWAWLVLKGDKLSVVSTANQDSPLMGEVISGASGFPILGLDVWEHAYYL 180

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERY 195
            F+ RR  YI+ F  N+VNW+    R+
Sbjct: 181 KFQNRRPDYIKEFW-NVVNWDEAAARF 206


>gi|56551956|ref|YP_162795.1| superoxide dismutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260752497|ref|YP_003225390.1| superoxide dismutase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56543530|gb|AAV89684.1| Superoxide dismutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551860|gb|ACV74806.1| Superoxide dismutase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 208

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LP+   DL P+MS ETLEYHH  HHK+Y D       + ++  LSL E+I K+
Sbjct: 1   MAFALPALPFGAKDLEPHMSAETLEYHHGKHHKSYVDKVNSWVDEKKLAGLSLVEVINKA 60

Query: 61  -HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITA 118
               + GLFNNA+Q +NHN FW  + K    G+ P   L+  I+++FGS E     L   
Sbjct: 61  VETKDKGLFNNAAQAWNHNFFWLGLAK---AGQKPSGKLASLIEESFGSTEALLEKLAAE 117

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI-PILGIDVWEHAYYLDFKYRRAHY 177
           A   FGSGW WL +K+GKL I+   + + P+ +  + P+L +DVWEHAYY+D++  R  Y
Sbjct: 118 AVGHFGSGWAWLVLKDGKLAITSYHDGDTPVAHKEVKPLLTLDVWEHAYYIDYRNARPKY 177

Query: 178 IESFITNLVNWEYVCE 193
            +  ++N++NWE+V +
Sbjct: 178 AKDVLSNIINWEFVAK 193


>gi|325136792|gb|EGC59390.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M0579]
 gi|325144323|gb|EGC66628.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M01-240013]
 gi|325202326|gb|ADY97780.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M01-240149]
 gi|325206281|gb|ADZ01734.1| superoxide dismutase Mn/Fe [Neisseria meningitidis M04-240196]
 gi|325207921|gb|ADZ03373.1| superoxide dismutase Mn/Fe [Neisseria meningitidis NZ-05/33]
          Length = 195

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPSGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|15604392|ref|NP_220908.1| superoxide dismutase (sodB) [Rickettsia prowazekii str. Madrid E]
 gi|7674342|sp|Q9ZD15|SODF_RICPR RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|3861084|emb|CAA14984.1| SUPEROXIDE DISMUTASE (sodB) [Rickettsia prowazekii]
 gi|292572149|gb|ADE30064.1| Superoxide dismutase [Rickettsia prowazekii Rp22]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 116/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ ++ET +YHH  HH +Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYDKESFKPHFTRETFDYHHGKHHNSYVQNLNNLIKDREELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +   + NNASQ +NH  FW  +K + G GK    + + I  +FGSFE+F +     A 
Sbjct: 74  QNAEVAILNNASQIWNHTFFWYSIKPHGG-GKPSGKVFEQISKDFGSFEQFCAQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+   + KL+I KT NA  P++N   PIL  DVWEHAYY+D++ +R+ YI+ 
Sbjct: 133 GQFGSGWTWVVYHDNKLQIIKTSNAGTPIVNFMKPILACDVWEHAYYIDYRNKRSDYIDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIRHMINWKFV 203


>gi|73662512|ref|YP_301293.1| superoxide dismutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123775360|sp|Q49XZ6|SODM_STAS1 RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|72495027|dbj|BAE18348.1| superoxide dismutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 199

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 115/203 (56%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY +D L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYGFDALEPHIDKQTMEIHHDKHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   + NH+LFW  +  N + KG V     D I + +GS + FK + 
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTV----VDKIKEQWGSLDAFKEEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGNLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y  A
Sbjct: 177 DYISAFW-NVVNWEKVDELYNAA 198


>gi|27364653|ref|NP_760181.1| Manganese superoxide dismutase [Vibrio vulnificus CMCP6]
 gi|320155048|ref|YP_004187427.1| manganese superoxide dismutase [Vibrio vulnificus MO6-24/O]
 gi|8918746|dbj|BAA97807.1| manganese superoxide dismutase [Vibrio vulnificus]
 gi|27360798|gb|AAO09708.1| Manganese superoxide dismutase [Vibrio vulnificus CMCP6]
 gi|319930360|gb|ADV85224.1| manganese superoxide dismutase [Vibrio vulnificus MO6-24/O]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 118/203 (58%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPYSYD L PY+  +T+E H+  HHK Y D  L     +E+ H +L EI    
Sbjct: 1   MSHTFPELPYSYDALEPYIDAKTMEVHYSKHHKTYYDKFLAAIQGSELEHQTLTEIFSSI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM  N G G+   AL+ AI + FG+F  FK     AA 
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWQCMSPNGG-GQPQGALAHAIQEKFGTFAAFKEAFSQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKEGDIHITSTSNQDNPLMDIASVRGEPILALDVWEHAYYIRYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI+++  N+V+W+ V + Y  A+
Sbjct: 180 YIDAWW-NVVDWQVVEQNYAQAI 201


>gi|257432233|ref|ZP_05608596.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus E1410]
 gi|257283112|gb|EEV13244.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus E1410]
          Length = 199

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLPNLPY+YD L PY+ + T+E+HHD HH  Y           E+ H SL ++I   
Sbjct: 1   MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNTTVEGTELEHQSLADMIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   ++NH+LFW  +  N + KG V     D I   +G+ ++FK++ 
Sbjct: 61  DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGV----IDDIKAQWGTLDEFKNEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+T FGSGW WL V +GKLEI  T N +NPL  G  PIL  DVWEHAYYL ++ +R 
Sbjct: 117 ANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+ +F  N+VNW+ V E Y+ A
Sbjct: 177 DYMTAFW-NIVNWKKVDELYQAA 198


>gi|260774702|ref|ZP_05883606.1| manganese superoxide dismutase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609358|gb|EEX35509.1| manganese superoxide dismutase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 205

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 118/204 (57%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D  +      E+   SL +I    
Sbjct: 1   MSHTFPELPYAYDSLEPYIDAKTMEVHYSKHHRTYFDKFVAAVKGTELEDASLSDIFANI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
              +  + NN   YYNH L+W CM    G G  P+  L+  ID  FG FE+FKS    AA
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWNCMAP--GAGGEPEGELAKEIDATFGGFEQFKSLFAEAA 118

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRA 175
              FGSG+ WL VK+GKL I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR 
Sbjct: 119 INTFGSGFAWLVVKDGKLHIASTSNQDNPLMDVASVQGEPILALDVWEHAYYISYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI+++  N+VNW+ V E Y  A+
Sbjct: 179 EYIDAW-WNVVNWDVVSENYAVAL 201


>gi|189462182|ref|ZP_03010967.1| hypothetical protein BACCOP_02864 [Bacteroides coprocola DSM 17136]
 gi|189431085|gb|EDV00070.1| hypothetical protein BACCOP_02864 [Bacteroides coprocola DSM 17136]
          Length = 190

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   +P L Y  D LSPYMSKETLE+H+  H + Y DN  KL        + LEEI+ K+
Sbjct: 1   MTHVMPQLAYGLDALSPYMSKETLEFHYGKHLQTYVDNLNKLIPGTPYEDMPLEEILKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  F+  +    G+  +P  L +A+ ++FGS + FK     AA 
Sbjct: 61  EG---GIFNNAAQAWNHTFFFQSL--TPGQSDMPAKLVEALTESFGSVDTFKELFTKAAL 115

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL + K  KL I +  NA NPL  G  P++ IDVWEHAYY+D++ RRA YIE
Sbjct: 116 GLFGSGWVWLVMDKEHKLSIVQESNAGNPLTEGLTPVMVIDVWEHAYYIDYRNRRAAYIE 175

Query: 180 SFITNLVNWEYVCER 194
           +F   +V+W  V ER
Sbjct: 176 AF-WKVVDWNVVAER 189


>gi|86134594|ref|ZP_01053176.1| iron/manganese superoxide dismutase [Polaribacter sp. MED152]
 gi|85821457|gb|EAQ42604.1| iron/manganese superoxide dismutase [Polaribacter sp. MED152]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y           ++   S+E+I+   
Sbjct: 1   MAFELPELGYAHDALEPHIDAKTMEIHHGKHHNGYTTKLNNAIEGTDLEGKSIEDILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+ + NN   +YNH+LFW  M   D +G +   L DAI+  FGS E F      AA+
Sbjct: 61  DMSNSAVRNNGGGFYNHSLFWTVMNPED-RGYLSGELKDAIEAEFGSKEAFMDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F   ++NW  V  RY  A
Sbjct: 180 DYIDAFF-KVINWNEVERRYAEA 201


>gi|37681299|ref|NP_935908.1| superoxide dismutase [Vibrio vulnificus YJ016]
 gi|37200050|dbj|BAC95879.1| superoxide dismutase [Vibrio vulnificus YJ016]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 118/203 (58%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPYSYD L PY+  +T+E H+  HHK Y D  L     +E+ H +L EI    
Sbjct: 1   MSHTFPELPYSYDALEPYIDAKTMEVHYSKHHKTYYDKFLAAIQGSELEHQTLTEIFTNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM  N G G+   AL+ AI + FG+F  FK     AA 
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWQCMSPNGG-GEPQGALAHAIQEKFGTFAAFKEAFSQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYLDFKYRRAH 176
           + FGSG+ WL VK G + I+ T N +NPL++ A     PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 STFGSGFTWLVVKEGDIHITSTSNQDNPLMDIASVRGEPILALDVWEHAYYIRYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI+++  N+V+W  V + Y  A+
Sbjct: 180 YIDAWW-NVVDWRVVEQNYTQAI 201


>gi|260584214|ref|ZP_05851962.1| superoxide dismutase, Mn [Granulicatella elegans ATCC 700633]
 gi|260158840|gb|EEW93908.1| superoxide dismutase, Mn [Granulicatella elegans ATCC 700633]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 116/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M ++LP L Y +  L P++   T+E HHD HH  Y  N    +     +   S+EE++  
Sbjct: 1   MTYELPKLAYEFSALEPHVDALTMEIHHDKHHNAYVTNLNAAVEKHPALFEKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G G+    L+ AID  FG F+ FK   
Sbjct: 61  LASVPEDIRGAVRNNGGGHANHSLFWTVISPNGG-GQPTGELAAAIDTKFGGFDAFKQAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE+  T N +NPL +G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 SQAAATRFGSGWAWLVVSNGELEVVSTPNQDNPLTDGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+V+W  V  RYE A
Sbjct: 180 DYIAAFW-NVVDWNEVARRYEAA 201


>gi|323493157|ref|ZP_08098288.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
 gi|323312628|gb|EGA65761.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
          Length = 194

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    +LEEI+  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G LEI  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 177 NGFWA-LVNWDFVAE 190


>gi|241758787|ref|ZP_04756900.1| superoxide dismutase [Neisseria flavescens SK114]
 gi|261380206|ref|ZP_05984779.1| superoxide dismutase [Neisseria subflava NJ9703]
 gi|319638414|ref|ZP_07993176.1| superoxide dismutase [Neisseria mucosa C102]
 gi|241320995|gb|EER57208.1| superoxide dismutase [Neisseria flavescens SK114]
 gi|284797057|gb|EFC52404.1| superoxide dismutase [Neisseria subflava NJ9703]
 gi|317400163|gb|EFV80822.1| superoxide dismutase [Neisseria mucosa C102]
          Length = 193

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP+++KETLE+H+  HH+ Y  N        E   + LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLTKETLEFHYGKHHQTYITNLNNQIKGTEFEEMPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GMFNNAAQTWNHTFYWLGFTPK-GQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G+L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGELDLVSTSNAGTPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|194098197|ref|YP_002001245.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae NCCP11945]
 gi|239998649|ref|ZP_04718573.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae 35/02]
 gi|240123145|ref|ZP_04736101.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae PID332]
 gi|268594502|ref|ZP_06128669.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae 35/02]
 gi|268681773|ref|ZP_06148635.1| superoxide dismutase [Neisseria gonorrhoeae PID332]
 gi|193933487|gb|ACF29311.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae NCCP11945]
 gi|268547891|gb|EEZ43309.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae 35/02]
 gi|268622057|gb|EEZ54457.1| superoxide dismutase [Neisseria gonorrhoeae PID332]
 gi|317163919|gb|ADV07460.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 193

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYGPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y+E
Sbjct: 117 GTFGSGWAWLVKTPVGGLDLISTFNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|332686030|ref|YP_004455804.1| manganese superoxide dismutase [Melissococcus plutonius ATCC 35311]
 gi|332370039|dbj|BAK20995.1| manganese superoxide dismutase [Melissococcus plutonius ATCC 35311]
          Length = 203

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 120/204 (58%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+  ET+  HHD HH  Y     + +    E+ + S+EE+I  
Sbjct: 1   MTYILPDLPYAYDALEPYIDTETMHLHHDKHHNTYVTKLNEAIEKHPELGNQSVEELITN 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            +         + NN   + NH+ FW  M  N G G+   A+ +AI+  FGSFEK K   
Sbjct: 61  MNAIPEDIRLAVRNNGGGHVNHSFFWKVMGPNAG-GEPTGAVKEAINQTFGSFEKMKEQF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+++FGSGW WL V KN KL I  T N ++PL+ G  PILG+DVWEHAYYL +K  R
Sbjct: 120 NAAAASRFGSGWAWLVVDKNKKLSILSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N+VNWE V   YE A
Sbjct: 180 PDYIAAFW-NVVNWEQVNRNYEAA 202


>gi|15923123|ref|NP_370657.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15925837|ref|NP_373370.1| superoxide dismutase [Staphylococcus aureus subsp. aureus N315]
 gi|21281836|ref|NP_644922.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MW2]
 gi|49482376|ref|YP_039600.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49485011|ref|YP_042232.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57652481|ref|YP_185022.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|87161851|ref|YP_492852.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88193908|ref|YP_498694.1| superoxide dismutase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148266559|ref|YP_001245502.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|150392598|ref|YP_001315273.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|151220289|ref|YP_001331112.1| superoxide dismutase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156978463|ref|YP_001440722.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161508402|ref|YP_001574061.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221142231|ref|ZP_03566724.1| superoxide dismutase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253316253|ref|ZP_04839466.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253730486|ref|ZP_04864651.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733765|ref|ZP_04867930.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|255004930|ref|ZP_05143531.2| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424272|ref|ZP_05600701.1| superoxide dismutase  2 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426948|ref|ZP_05603350.1| superoxide dismutase  2 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429586|ref|ZP_05605973.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257435192|ref|ZP_05611243.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus M876]
 gi|257794482|ref|ZP_05643461.1| superoxide dismutase (Mn/Fe) 2 [Staphylococcus aureus A9781]
 gi|258407557|ref|ZP_05680693.1| superoxide dismutase (Mn/Fe) 2 [Staphylococcus aureus A9763]
 gi|258419830|ref|ZP_05682792.1| superoxide dismutase 2 [Staphylococcus aureus A9719]
 gi|258424248|ref|ZP_05687129.1| superoxide dismutase 2 [Staphylococcus aureus A9635]
 gi|258438655|ref|ZP_05689878.1| superoxide dismutase2 [Staphylococcus aureus A9299]
 gi|258443887|ref|ZP_05692225.1| superoxide dismutase [Staphylococcus aureus A8115]
 gi|258445087|ref|ZP_05693324.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|258447691|ref|ZP_05695830.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|258452280|ref|ZP_05700294.1| superoxide dismutase 2 [Staphylococcus aureus A5948]
 gi|258455685|ref|ZP_05703640.1| superoxide dismutase 2 [Staphylococcus aureus A5937]
 gi|262049770|ref|ZP_06022635.1| superoxide dismutase [Staphylococcus aureus D30]
 gi|262052066|ref|ZP_06024276.1| superoxide dismutase [Staphylococcus aureus 930918-3]
 gi|269201785|ref|YP_003281054.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|282894356|ref|ZP_06302586.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A8117]
 gi|282902724|ref|ZP_06310617.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus C160]
 gi|282907125|ref|ZP_06314973.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282907468|ref|ZP_06315310.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282912371|ref|ZP_06320167.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282912990|ref|ZP_06320782.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282915466|ref|ZP_06323238.1| superoxide dismutase, Fe-Mn family protein [Staphylococcus aureus
           subsp. aureus D139]
 gi|282921406|ref|ZP_06329124.1| superoxide dismutase, Fe-Mn family protein [Staphylococcus aureus
           subsp. aureus C427]
 gi|282922617|ref|ZP_06330307.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282923796|ref|ZP_06331473.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus A9765]
 gi|282928386|ref|ZP_06335989.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A10102]
 gi|283767877|ref|ZP_06340792.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283959581|ref|ZP_06377022.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284023143|ref|ZP_06377541.1| superoxide dismutase [Staphylococcus aureus subsp. aureus 132]
 gi|293498044|ref|ZP_06665898.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511633|ref|ZP_06670327.1| superoxide dismutase [Staphylococcus aureus subsp. aureus M809]
 gi|293550243|ref|ZP_06672915.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294849068|ref|ZP_06789812.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A9754]
 gi|295405403|ref|ZP_06815213.1| superoxide dismutase 2 [Staphylococcus aureus A8819]
 gi|295426678|ref|ZP_06819317.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296275951|ref|ZP_06858458.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MR1]
 gi|297209366|ref|ZP_06925764.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297244740|ref|ZP_06928620.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A8796]
 gi|297589121|ref|ZP_06947762.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300911365|ref|ZP_07128814.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304380094|ref|ZP_07362815.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039613|sp|P66831|SODM2_STAAN RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|54039614|sp|P66832|SODM2_STAAW RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|54042219|sp|P66830|SODM2_STAAM RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|60390905|sp|Q6GCZ1|SODM2_STAAS RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|60390910|sp|Q6GKH2|SODM2_STAAR RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|81695534|sp|Q5HJN5|SODM2_STAAC RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|123003520|sp|Q2G261|SODM2_STAA8 RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|123736026|sp|Q2FKC6|SODM2_STAA3 RecName: Full=Superoxide dismutase [Mn/Fe] 2
 gi|13700049|dbj|BAB41348.1| superoxide dismutase [Staphylococcus aureus subsp. aureus N315]
 gi|14245900|dbj|BAB56295.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21203271|dbj|BAB93972.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MW2]
 gi|49240505|emb|CAG39162.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49243454|emb|CAG41875.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57286667|gb|AAW38761.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|87127825|gb|ABD22339.1| Superoxide dismutase (Mn/Fe family) [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87201466|gb|ABD29276.1| superoxide dismutase, putative [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147739628|gb|ABQ47926.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|149945050|gb|ABR50986.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|150373089|dbj|BAF66349.1| superoxide dismutase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156720598|dbj|BAF77015.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367211|gb|ABX28182.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253725779|gb|EES94508.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728232|gb|EES96961.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|257273290|gb|EEV05392.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276579|gb|EEV08030.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257280067|gb|EEV10654.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257285788|gb|EEV15904.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus M876]
 gi|257788454|gb|EEV26794.1| superoxide dismutase (Mn/Fe) 2 [Staphylococcus aureus A9781]
 gi|257840782|gb|EEV65239.1| superoxide dismutase (Mn/Fe) 2 [Staphylococcus aureus A9763]
 gi|257844112|gb|EEV68499.1| superoxide dismutase 2 [Staphylococcus aureus A9719]
 gi|257845514|gb|EEV69547.1| superoxide dismutase  2 [Staphylococcus aureus A9635]
 gi|257848214|gb|EEV72206.1| superoxide dismutase2 [Staphylococcus aureus A9299]
 gi|257850771|gb|EEV74715.1| superoxide dismutase [Staphylococcus aureus A8115]
 gi|257855995|gb|EEV78914.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|257858973|gb|EEV81837.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|257860117|gb|EEV82951.1| superoxide dismutase  2 [Staphylococcus aureus A5948]
 gi|257861897|gb|EEV84670.1| superoxide dismutase  2 [Staphylococcus aureus A5937]
 gi|259160044|gb|EEW45078.1| superoxide dismutase [Staphylococcus aureus 930918-3]
 gi|259162160|gb|EEW46737.1| superoxide dismutase [Staphylococcus aureus D30]
 gi|262074075|gb|ACY10048.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|269939660|emb|CBI48028.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TW20]
 gi|282314838|gb|EFB45224.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282315821|gb|EFB46205.1| superoxide dismutase, Fe-Mn family protein [Staphylococcus aureus
           subsp. aureus C427]
 gi|282320569|gb|EFB50907.1| superoxide dismutase, Fe-Mn family protein [Staphylococcus aureus
           subsp. aureus D139]
 gi|282323090|gb|EFB53409.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282324067|gb|EFB54383.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328373|gb|EFB58644.1| superoxide dismutase 2 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330024|gb|EFB59545.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589970|gb|EFB95053.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A10102]
 gi|282593038|gb|EFB98039.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus A9765]
 gi|282597183|gb|EFC02142.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus C160]
 gi|282763401|gb|EFC03531.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A8117]
 gi|283461756|gb|EFC08840.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283469374|emb|CAQ48585.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ST398]
 gi|283789173|gb|EFC28000.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285815858|gb|ADC36345.1| Manganese superoxide dismutase; Superoxide dismutase (Fe)
           [Staphylococcus aureus 04-02981]
 gi|290919290|gb|EFD96366.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096975|gb|EFE27233.1| superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291465591|gb|EFF08123.1| superoxide dismutase [Staphylococcus aureus subsp. aureus M809]
 gi|294823960|gb|EFG40385.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A9754]
 gi|294969478|gb|EFG45497.1| superoxide dismutase 2 [Staphylococcus aureus A8819]
 gi|295129130|gb|EFG58757.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296885827|gb|EFH24762.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178257|gb|EFH37504.1| Fe-Mn family superoxide dismutase [Staphylococcus aureus A8796]
 gi|297577632|gb|EFH96345.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300887544|gb|EFK82740.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|302331881|gb|ADL22074.1| Superoxide dismutase (Mn/Fe family) [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302750014|gb|ADL64191.1| Superoxide dismutase (Mn/Fe family) [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304341330|gb|EFM07248.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312436756|gb|ADQ75827.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH60]
 gi|312828650|emb|CBX33492.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129114|gb|EFT85110.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS03]
 gi|315194589|gb|EFU24978.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS00]
 gi|315196449|gb|EFU26799.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS01]
 gi|320139554|gb|EFW31425.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142129|gb|EFW33948.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440337|gb|EGA98050.1| manganese/iron superoxide dismutase [Staphylococcus aureus O11]
 gi|323443180|gb|EGB00799.1| manganese/iron superoxide dismutase [Staphylococcus aureus O46]
 gi|329312832|gb|AEB87245.1| Superoxide dismutase [Mn/Fe] 2 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329725833|gb|EGG62312.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21172]
 gi|329731777|gb|EGG68137.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21189]
 gi|329732289|gb|EGG68639.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21193]
          Length = 199

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLPNLPY+YD L PY+ + T+E+HHD HH  Y           E+ H SL ++I   
Sbjct: 1   MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   ++NH+LFW  +  N + KG V     D I   +G+ ++FK++ 
Sbjct: 61  DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGV----IDDIKAQWGTLDEFKNEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+T FGSGW WL V +GKLEI  T N +NPL  G  PIL  DVWEHAYYL ++ +R 
Sbjct: 117 ANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+ +F  N+VNW+ V E Y+ A
Sbjct: 177 DYMTAFW-NIVNWKKVDELYQAA 198


>gi|302384230|ref|YP_003820053.1| superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194858|gb|ADL02430.1| Superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 204

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 127/205 (61%), Gaps = 10/205 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F LP LPY+YD L P +  ET+ +HHD HH+ Y D   + +A+DA +   S+E+++  
Sbjct: 1   MAFTLPPLPYAYDALEPAIDSETMTFHHDKHHQAYVDKLNEAVAADASLADHSIEDLLKG 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITA 118
                  + NN   ++NH+LFW  +    G+G  P A L+ AID + G  EKFK+D   A
Sbjct: 61  VSKLPKAVRNNGGGHWNHSLFWELLAPV-GQGGEPSAELAAAIDRDLGGLEKFKTDFNAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN-----GAIPILGIDVWEHAYYLDFKYR 173
            + QFGSGW WL V++GKL+I+ T N +NPL++     GA+ +LG DVWEHAYYL ++ R
Sbjct: 120 GAGQFGSGWAWLIVQDGKLKITSTPNQDNPLMDVADEKGAV-VLGADVWEHAYYLKYQNR 178

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R  Y+++F T +VNW    E Y  A
Sbjct: 179 RPDYLKAFWT-VVNWNKANELYAAA 202


>gi|229135100|ref|ZP_04263902.1| Superoxide dismutase [Bacillus cereus BDRD-ST196]
 gi|228648329|gb|EEL04362.1| Superoxide dismutase [Bacillus cereus BDRD-ST196]
          Length = 203

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK++   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKAEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTSNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    + Y+ A
Sbjct: 184 GAFW-NVVDWNVAEKLYQEA 202


>gi|325106235|ref|YP_004275889.1| Manganese/iron superoxide dismutase [Pedobacter saltans DSM 12145]
 gi|324975083|gb|ADY54067.1| Manganese/iron superoxide dismutase [Pedobacter saltans DSM 12145]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 121/204 (59%), Gaps = 9/204 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ ++T+E HH  HH  Y  N  K     E    SLEEI    
Sbjct: 1   MAFELPALPYASDALEPHIDQQTMEIHHGKHHAAYVTNLNKALEGKEGADSSLEEINKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
                 + NN   +YNH+LFW  +  N   G  PQ  L++AI+  FGSFE FK+    A 
Sbjct: 61  SKYPVAVRNNGGGHYNHSLFWTVIGPNG--GGAPQGELAEAINAAFGSFEDFKTKFAEAG 118

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRR 174
           +T+FGSGW WL V  +GKL ++ T N +NPL++ A     PILG+DVWEHAYYL ++ RR
Sbjct: 119 ATRFGSGWAWLIVGADGKLAVTSTPNQDNPLMDVAEVQGTPILGMDVWEHAYYLKYQNRR 178

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N+++W  V ER+  A
Sbjct: 179 PDYISAFW-NVIDWNAVAERFAQA 201


>gi|313608781|gb|EFR84591.1| superoxide dismutase, Mn [Listeria monocytogenes FSL F2-208]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     + +A   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G G     L  AI+  FGSF++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGG-GAPTGELKSAIESEFGSFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NW+   +R++ A
Sbjct: 180 EYIDTFW-NVINWDEANKRFDAA 201


>gi|16329169|gb|AAG44813.2|AF273269_1 superoxide dismutase [Staphylococcus aureus]
          Length = 199

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLPNLPY+YD L PY+ + T+E+HHD HH  Y           E+ H SL ++I   
Sbjct: 1   MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   ++NH+LFW  +  N + KG V     D I   +G+ ++FK++ 
Sbjct: 61  GKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGV----IDDIKAQWGTLDEFKNEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+T FGSGW WL V +GKLEI  T N +NPL  G  PIL  DVWEHAYYL ++ +R 
Sbjct: 117 ANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+ +F  N+VNW+ V E Y+ A
Sbjct: 177 DYMTAFW-NIVNWKKVDELYQAA 198


>gi|71908825|ref|YP_286412.1| manganese and iron superoxide dismutase [Dechloromonas aromatica
           RCB]
 gi|71848446|gb|AAZ47942.1| Manganese and iron superoxide dismutase [Dechloromonas aromatica
           RCB]
          Length = 194

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 118/192 (61%), Gaps = 4/192 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ +LP LPY+ D L+P+MS ET +YH+  HH+ Y  N   L    E  +L LE I+ K+
Sbjct: 1   MEHQLPQLPYAKDALAPHMSAETFDYHYSKHHQAYVTNLNNLIKGTEYENLDLEAIVKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G++NNA+Q +NH+ FW CMK N G G     L+ AI+  +GS + FK+   T+A 
Sbjct: 61  PA--GGVYNNAAQVWNHSFFWNCMKPNGG-GAPAGTLAAAINAKWGSLDAFKTAFQTSAV 117

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I     A  PL  G   +L +DVWEHAYY+D++  R  ++E
Sbjct: 118 GNFGSGWTWLVKKADGSLDIVNMGAAGTPLTTGDKALLCVDVWEHAYYIDYRNMRPKFVE 177

Query: 180 SFITNLVNWEYV 191
           +F+ +LVNW +V
Sbjct: 178 TFLASLVNWSFV 189


>gi|240080353|ref|ZP_04724896.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae FA19]
 gi|268596498|ref|ZP_06130665.1| superoxide dismutase [Neisseria gonorrhoeae FA19]
 gi|268550286|gb|EEZ45305.1| superoxide dismutase [Neisseria gonorrhoeae FA19]
          Length = 193

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYGPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPAGELAAAIDAEWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L +  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLALVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|229093344|ref|ZP_04224453.1| Superoxide dismutase [Bacillus cereus Rock3-42]
 gi|228690068|gb|EEL43867.1| Superoxide dismutase [Bacillus cereus Rock3-42]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LP LPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPKLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    +RY+ A
Sbjct: 184 GAFW-NVVDWNAAEKRYQEA 202


>gi|240016210|ref|ZP_04722750.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae FA6140]
 gi|240117590|ref|ZP_04731652.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae PID1]
 gi|240127849|ref|ZP_04740510.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae SK-93-1035]
 gi|268603294|ref|ZP_06137461.1| superoxide dismutase [Neisseria gonorrhoeae PID1]
 gi|268686246|ref|ZP_06153108.1| superoxide dismutase [Neisseria gonorrhoeae SK-93-1035]
 gi|268587425|gb|EEZ52101.1| superoxide dismutase [Neisseria gonorrhoeae PID1]
 gi|268626530|gb|EEZ58930.1| superoxide dismutase [Neisseria gonorrhoeae SK-93-1035]
          Length = 193

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y+E
Sbjct: 117 GTFGSGWAWLVKTPVGGLDLISTFNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|293399404|ref|ZP_06643557.1| Fe-Mn family superoxide dismutase [Neisseria gonorrhoeae F62]
 gi|291609973|gb|EFF39095.1| Fe-Mn family superoxide dismutase [Neisseria gonorrhoeae F62]
          Length = 193

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP+ SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHPSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y+E
Sbjct: 117 GTFGSGWAWLVKTPVGGLDLISTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLE 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|152112297|sp|Q4L6Q3|SODM_STAHJ RecName: Full=Superoxide dismutase [Mn/Fe]
          Length = 199

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 116/200 (58%), Gaps = 10/200 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY+ D L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYATDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   + NH+LFW  +  N + KG V     D I + +GS ++FK + 
Sbjct: 61  DSVPEDIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTV----VDKIKEQWGSLDEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNWE V E Y
Sbjct: 177 DYISAFW-NVVNWEKVDELY 195


>gi|304387796|ref|ZP_07369972.1| superoxide dismutase [Neisseria meningitidis ATCC 13091]
 gi|304338178|gb|EFM04312.1| superoxide dismutase [Neisseria meningitidis ATCC 13091]
          Length = 195

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPVGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|332519382|ref|ZP_08395849.1| Manganese/iron superoxide dismutase-like protein [Lacinutrix
           algicola 5H-3-7-4]
 gi|332045230|gb|EGI81423.1| Manganese/iron superoxide dismutase-like protein [Lacinutrix
           algicola 5H-3-7-4]
          Length = 202

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 116/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +   T+E HH  HH  Y           E+   ++E I++  
Sbjct: 1   MAFELPKLKYAYDALEPNIDARTMEIHHTKHHNGYTTKLNNAIEGTELEGKTIENILLNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH+LFW  M   D KG++   L DAI+  F S + FK     AA+
Sbjct: 61  DMENKAVRNNGGGFYNHSLFWDVMNPED-KGRLSGELKDAIEAEFESVDAFKDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F   ++NW  V  RY  A
Sbjct: 180 DYIDAFF-KVINWNEVERRYAEA 201


>gi|6840824|gb|AAF28773.1|AF077224_1 iron-superoxide dismutase precursor [Vigna unguiculata]
          Length = 245

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 124/216 (57%), Gaps = 21/216 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  + L P MS++TLE+H   HH+ Y +N  K     E+   SLEEII+ ++ 
Sbjct: 26  FELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYN 85

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH+ FW CMK   G     + L + I+ +FGSFEKF  +   AA+
Sbjct: 86  KGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELL-ELIERDFGSFEKFLDEFKAAAA 144

Query: 121 TQFGSGWGWLSVKNGKLE-----------------ISKTQNAENPLI-NGAIPILGIDVW 162
           TQFGSGW WL+ K  KL+                 + K+ NA NPL+  G  P+L IDVW
Sbjct: 145 TQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVW 204

Query: 163 EHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           EHAYYLDF+ RR  YI  F+  LV+W+ V  R E A
Sbjct: 205 EHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQA 240


>gi|326386347|ref|ZP_08207970.1| superoxide dismutase, Fe [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209008|gb|EGD59802.1| superoxide dismutase, Fe [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 232

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 116/193 (60%), Gaps = 7/193 (3%)

Query: 6   PNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSN- 64
           P LPY+ D L+P +S  T+++H++ HHK Y  N  KL +   +   SLEE+++ S G   
Sbjct: 44  PPLPYAPDALAPAISARTVDFHYNKHHKGYFTNLAKLVTGTPLASASLEEVVLASAGKAE 103

Query: 65  -AGLFNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITAASTQ 122
              +FNNA+Q  NHNL+W  +     KG  P  AL+ AI  +FGS    + +L  AA  Q
Sbjct: 104 MKAVFNNAAQALNHNLYWQSLTP---KGSAPSDALAAAIIRDFGSKAALEGELTKAAVGQ 160

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL+   GKL++  T NA+ PL  G  P+L IDVWEHAYYLD + RRA Y+ + I
Sbjct: 161 FGSGWAWLAADAGKLKVLATMNADTPLTQGMTPLLVIDVWEHAYYLDEQNRRADYLTA-I 219

Query: 183 TNLVNWEYVCERY 195
             L++W     R+
Sbjct: 220 LPLLDWAGASLRF 232


>gi|325130043|gb|EGC52834.1| superoxide dismutase Mn/Fe [Neisseria meningitidis OX99.30304]
          Length = 195

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPSGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW  V +R+
Sbjct: 177 GFW-EIVNWNEVAKRF 191


>gi|163942034|ref|YP_001646918.1| superoxide dismutase [Bacillus weihenstephanensis KBAB4]
 gi|229013495|ref|ZP_04170631.1| Superoxide dismutase [Bacillus mycoides DSM 2048]
 gi|229061970|ref|ZP_04199296.1| Superoxide dismutase [Bacillus cereus AH603]
 gi|229169023|ref|ZP_04296739.1| Superoxide dismutase [Bacillus cereus AH621]
 gi|163864231|gb|ABY45290.1| Superoxide dismutase [Bacillus weihenstephanensis KBAB4]
 gi|228614432|gb|EEK71541.1| Superoxide dismutase [Bacillus cereus AH621]
 gi|228717279|gb|EEL68952.1| Superoxide dismutase [Bacillus cereus AH603]
 gi|228747796|gb|EEL97663.1| Superoxide dismutase [Bacillus mycoides DSM 2048]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK++   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKAEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    + Y+ A
Sbjct: 184 GAFW-NVVDWNVAEKLYQEA 202


>gi|294507750|ref|YP_003571808.1| Superoxide dismutase [Salinibacter ruber M8]
 gi|294344078|emb|CBH24856.1| Superoxide dismutase [Salinibacter ruber M8]
          Length = 205

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 123/209 (58%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYA---DNALKLASDAEMLHLSLEEII 57
           M F LP LPY YD L P++ ++T+  HHD HH  Y    +NAL+   D  +   S+EE++
Sbjct: 1   MAFDLPELPYDYDALEPHIDEQTMRIHHDKHHAGYTRKLNNALEGHDD--LQEHSIEELL 58

Query: 58  IK----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
                        +  N   +YNH LFW  M   DG G     L+DAI D FGS+E FK 
Sbjct: 59  AGLDTLPTDVQTPVRQNGGGFYNHRLFWNVMSP-DGGGTPDGDLADAIHDAFGSYEDFKD 117

Query: 114 DLITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKY 172
             + AA+ QFGSGWGWL  + NG + ++ T N +NPL+ G  PILGIDVWEH+YYL+++ 
Sbjct: 118 AFVDAATGQFGSGWGWLVAQPNGDVTVTSTPNQDNPLLEGHTPILGIDVWEHSYYLNYQN 177

Query: 173 RRAHYIESFITNLVNWEYVCERYETAMLA 201
            R  Y++ +  N+V+W+ V E Y+  + A
Sbjct: 178 ERGTYVDEWW-NVVDWDTVGENYDEIVAA 205


>gi|21231716|ref|NP_637633.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66768158|ref|YP_242920.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188991295|ref|YP_001903305.1| superoxidase dismutase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|76364224|sp|P0C0F9|SODM_XANC8 RecName: Full=Superoxide dismutase [Mn]
 gi|110287676|sp|P0C0F8|SODM_XANCP RecName: Full=Superoxide dismutase [Mn]
 gi|21113418|gb|AAM41557.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66573490|gb|AAY48900.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167733055|emb|CAP51253.1| superoxidase dismutase [Xanthomonas campestris pv. campestris]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  M  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVMSPNGG-GEPKGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + K+ +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALSRFGSGWAWLSVTPDKKVVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V  RY  A+
Sbjct: 180 DYIGAFY-NVVNWDEVERRYHAAI 202


>gi|261377664|ref|ZP_05982237.1| superoxide dismutase [Neisseria cinerea ATCC 14685]
 gi|269145931|gb|EEZ72349.1| superoxide dismutase [Neisseria cinerea ATCC 14685]
          Length = 193

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTPK-GQGKPSGELAAAIDAKWGSFEKFQEAFSACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G+L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGELDLVSTSNAATPLTTENKPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   ++NW+ V +R+
Sbjct: 177 GFW-EIINWDEVGKRF 191


>gi|258544437|ref|ZP_05704671.1| Mn superoxide dismutase [Cardiobacterium hominis ATCC 15826]
 gi|258520326|gb|EEV89185.1| Mn superoxide dismutase [Cardiobacterium hominis ATCC 15826]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M++    LPY  D L P + K T+E HH  HHK Y DN +    D  + + +LE I    
Sbjct: 1   MNYTFAPLPYPADALEPVIDKTTMEIHHGRHHKAYFDNFIAAIKDTPLANETLEAIFAGI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   YYNHNL+W  M  N G G+    L DAI+  FGSF+ FK+    A  
Sbjct: 61  SKYPAAVRNNGGGYYNHNLYWNVMSPNGG-GEPEGELLDAINAAFGSFDAFKTAFKDAGI 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V K+GKL I+ T N  NPL++ A     PILG DVWEHAYYL+++ +R 
Sbjct: 120 KQFGSGWAWLIVGKDGKLAITSTPNQGNPLMDTAAVQGTPILGCDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+E++   +VNW YV E Y  A
Sbjct: 180 DYLEAWW-KVVNWPYVAELYRQA 201


>gi|240112561|ref|ZP_04727051.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae MS11]
 gi|254493364|ref|ZP_05106535.1| superoxide dismutase [Neisseria gonorrhoeae 1291]
 gi|268598630|ref|ZP_06132797.1| superoxide dismutase [Neisseria gonorrhoeae MS11]
 gi|11139297|gb|AAG30301.1| Fe-superoxide dismutase SodB [Neisseria gonorrhoeae]
 gi|226512404|gb|EEH61749.1| superoxide dismutase [Neisseria gonorrhoeae 1291]
 gi|268582761|gb|EEZ47437.1| superoxide dismutase [Neisseria gonorrhoeae MS11]
          Length = 193

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYEPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GVFNNAAQTWNHTFYWLGFTP-KGQGKPAGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPVGGLDLISTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|149364132|gb|ABR24272.1| iron-containing superoxide dismutase [Brassica napus]
          Length = 263

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 121/202 (59%), Gaps = 8/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKSH 61
           + L   PY  D L PYMS+ TLE H   HH+ Y DN  K L  D ++   ++EE+I  ++
Sbjct: 50  YGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDKLYGYTMEELIKATY 109

Query: 62  GSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDLITA 118
            +   L  FNNA+Q YNH+ FW  M+   G G +PQ  + + I+ +FGSF  F+     A
Sbjct: 110 NNGNPLPEFNNAAQVYNHDFFWESMQP--GGGDMPQKGVLEQIEKDFGSFTNFREKFTNA 167

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A TQFGSGW WL +K    +LE+ KT NA NPL+   IPI+ +DVWEH+YY+D+K  R  
Sbjct: 168 ALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIISLDVWEHSYYIDYKNERGK 227

Query: 177 YIESFITNLVNWEYVCERYETA 198
           YI +F+ +LV+W     R   A
Sbjct: 228 YINTFLNHLVSWNAAMSRMARA 249


>gi|157828557|ref|YP_001494799.1| superoxide dismutase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933271|ref|YP_001650060.1| superoxide dismutase [Rickettsia rickettsii str. Iowa]
 gi|157801038|gb|ABV76291.1| superoxide dismutase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908358|gb|ABY72654.1| superoxide dismutase [Rickettsia rickettsii str. Iowa]
          Length = 209

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 114/191 (59%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEII-IKS 60
           F LP+LPY  +   P+ + ET +YHH  HH  Y  N   L  D E L    LEEII   S
Sbjct: 14  FILPDLPYEKESFKPHFTLETFDYHHGKHHNTYVQNLNNLLKDKEELQKKDLEEIIEWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K   G GK    + + I+ +F SFE+F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHTFFWHSIKPQGG-GKPSGKILEQINKDFASFEEFCKHFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ +G  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLVYHDNRLQIIKTANAGTPIAHGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWQFV 203


>gi|311279481|ref|YP_003941712.1| Superoxide dismutase [Enterobacter cloacae SCF1]
 gi|308748676|gb|ADO48428.1| Superoxide dismutase [Enterobacter cloacae SCF1]
          Length = 193

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 120/194 (61%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         +LEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLVKGTAFEGKTLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++ AID  FGSF +FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWHCLAPNAG-GEPTGAVAAAIDAAFGSFAEFKAKFTDAAI 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKGADGKLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189


>gi|58040231|ref|YP_192195.1| superoxide dismutase [Fe] [Gluconobacter oxydans 621H]
 gi|58002645|gb|AAW61539.1| Superoxide dismutase [Fe] [Gluconobacter oxydans 621H]
          Length = 202

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 128/205 (62%), Gaps = 10/205 (4%)

Query: 1   MDFKLPNLPYSYDDLS-PYMSKETLEYHHDVHHKNYADNALK--LASDAEMLHLSLEEII 57
           M F+LP LPY+ + L+   M +ETLE HHD HH+ Y   AL   + S  E+   +LEEII
Sbjct: 1   MAFELPPLPYAENALAGAGMCQETLELHHDKHHQAYV-TALNGFVESKPELAGKTLEEII 59

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S+G    A +FNNA Q++NH LFW  +    G+  +P  L   I ++FGS E+FK   
Sbjct: 60  AFSYGKPEIAPVFNNAGQHWNHILFWKNLSPKGGQ--IPTGLEKKIAEDFGSVEEFKKLF 117

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLING-AIPILGIDVWEHAYYLDFKYR 173
             AA+TQFGSGW WL + K+GKL ++KT N  NPL  G    +LG+DVWEHAYYLDF+ R
Sbjct: 118 KQAATTQFGSGWAWLVLDKSGKLAVTKTANGSNPLAEGQGKALLGLDVWEHAYYLDFRNR 177

Query: 174 RAHYIESFITNLVNWEYVCERYETA 198
           R  YI +++  L N+E+     ++A
Sbjct: 178 RPDYITNYLDKLANYEFAEAELKSA 202


>gi|60685137|gb|AAX34451.1| ferrous superoxide dismutase [Aeromonas veronii bv. sobria]
          Length = 182

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 115/187 (61%), Gaps = 7/187 (3%)

Query: 8   LPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL 67
           LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S+G   G+
Sbjct: 1   LPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTSNG---GI 57

Query: 68  FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGW 127
           FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF +FK     +A   FGS W
Sbjct: 58  FNNAAQIWNHTFYWHCLSPNGG-GEPTGALADAINKAFGSFAEFKDAFTKSAIGNFGSSW 116

Query: 128 GWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYIESFITNL 185
            WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+E+F T L
Sbjct: 117 TWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFWT-L 175

Query: 186 VNWEYVC 192
           VNWE+V 
Sbjct: 176 VNWEFVA 182


>gi|60685139|gb|AAX34452.1| ferrous superoxide dismutase [Aeromonas veronii bv. sobria]
          Length = 182

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 115/187 (61%), Gaps = 7/187 (3%)

Query: 8   LPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL 67
           LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S+G   G+
Sbjct: 1   LPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTSNG---GI 57

Query: 68  FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGW 127
           FNNA+Q +NH  +W C+  N G G+   AL+DAI+  FGSF +FK     +A   FGS W
Sbjct: 58  FNNAAQIWNHTFYWHCLSPNGG-GEPTGALADAINKAFGSFAEFKDAFTKSAIGNFGSSW 116

Query: 128 GWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYIESFITNL 185
            WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+E+F T L
Sbjct: 117 TWLVKKADGTLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFWT-L 175

Query: 186 VNWEYVC 192
           VNWE+V 
Sbjct: 176 VNWEFVA 182


>gi|56554197|pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna
           Unguiculata Suggests A New Enzymatic Mechanism
          Length = 238

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 124/216 (57%), Gaps = 21/216 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  + L P MS++TLE+H   HH+ Y +N  K     E+   SLEEII+ ++ 
Sbjct: 19  FELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYN 78

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH+ FW CMK   G     + L + I+ +FGSFEKF  +   AA+
Sbjct: 79  KGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELL-ELIERDFGSFEKFLDEFKAAAA 137

Query: 121 TQFGSGWGWLSVKNGKLE-----------------ISKTQNAENPLI-NGAIPILGIDVW 162
           TQFGSGW WL+ K  KL+                 + K+ NA NPL+  G  P+L IDVW
Sbjct: 138 TQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVW 197

Query: 163 EHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           EHAYYLDF+ RR  YI  F+  LV+W+ V  R E A
Sbjct: 198 EHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQA 233


>gi|166711818|ref|ZP_02243025.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++  +
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           KS   N    + NN   + NH+LFW  +  N G G+    ++ AI+ + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAINKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|319892606|ref|YP_004149481.1| superoxide dismutase [Staphylococcus pseudintermedius HKU10-03]
 gi|317162302|gb|ADV05845.1| superoxide dismutase [Staphylococcus pseudintermedius HKU10-03]
 gi|323464355|gb|ADX76508.1| superoxide dismutase [Staphylococcus pseudintermedius ED99]
          Length = 199

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 10/203 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPYSYD L P++ KET+E HH  HH  Y           E  + SLE++I  +
Sbjct: 1   MAFELPKLPYSYDALEPHIDKETMEIHHSKHHNTYVTKLNAAVEGTEFENKSLEDLIANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S   N    + NN   + NH+++W  +  N + KG+V     D I + +GS ++FKS+ 
Sbjct: 61  DSVPENLRTAVRNNGGGHLNHSIYWQILAPNSEEKGEV----VDKIKEQWGSLDEFKSEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NGKLEI  T N ++PL +G  PIL +DVWEHAYYL F+ +R 
Sbjct: 117 ADKAAGRFGSGWAWLVVNNGKLEIVTTANQDSPLTDGLTPILALDVWEHAYYLKFQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNWE V E Y+ A
Sbjct: 177 DYISTFW-NVVNWEKVDELYKAA 198


>gi|257885247|ref|ZP_05664900.1| manganese superoxide dismutase [Enterococcus faecium 1,231,501]
 gi|261209015|ref|ZP_05923420.1| manganese superoxide dismutase [Enterococcus faecium TC 6]
 gi|289565173|ref|ZP_06445625.1| superoxide dismutase [Enterococcus faecium D344SRF]
 gi|293553255|ref|ZP_06673892.1| superoxide dismutase [Mn] [Enterococcus faecium E1039]
 gi|294615297|ref|ZP_06695173.1| superoxide dismutase [Mn] [Enterococcus faecium E1636]
 gi|294619062|ref|ZP_06698557.1| superoxide dismutase [Mn] [Enterococcus faecium E1679]
 gi|257821099|gb|EEV48233.1| manganese superoxide dismutase [Enterococcus faecium 1,231,501]
 gi|260077054|gb|EEW64776.1| manganese superoxide dismutase [Enterococcus faecium TC 6]
 gi|289162994|gb|EFD10842.1| superoxide dismutase [Enterococcus faecium D344SRF]
 gi|291591855|gb|EFF23488.1| superoxide dismutase [Mn] [Enterococcus faecium E1636]
 gi|291594723|gb|EFF26105.1| superoxide dismutase [Mn] [Enterococcus faecium E1679]
 gi|291602665|gb|EFF32880.1| superoxide dismutase [Mn] [Enterococcus faecium E1039]
          Length = 202

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTIEELLSD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G G+    + +AI++ FG F  FK + 
Sbjct: 61  MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAG-GEPTGEIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +R+E A
Sbjct: 180 DYIAAFW-NVINWDEVNKRFEAA 201


>gi|294879808|ref|XP_002768791.1| iron-dependent superoxide dismutase, putative [Perkinsus marinus
           ATCC 50983]
 gi|239871683|gb|EER01509.1| iron-dependent superoxide dismutase, putative [Perkinsus marinus
           ATCC 50983]
          Length = 199

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKL-ASDAEMLHLSLEEIIIKSHGS 63
           LP LP++ D L P+MS ET++YH+  HH  Y  N  K+ A D E+  +S+EEII    G 
Sbjct: 8   LPPLPWAEDALEPHMSAETIQYHYGKHHATYVANLNKICAEDGEVAKMSMEEIIKTKSG- 66

Query: 64  NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQF 123
             G+FN A+Q +NH  FW  +  N G     + ++D I+ +FGSFE+FK     AA   F
Sbjct: 67  --GVFNQAAQAWNHTFFWNSLSPNGGNAPTGK-IADLINRDFGSFEEFKKQFTAAAVGHF 123

Query: 124 GSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFIT 183
           GSGW WL   NGKL++ +  +A  PL +G  PI+  DVWEHAYY+D++  R  Y+E F  
Sbjct: 124 GSGWAWLVADNGKLKVVQGHDAGCPLRDGQTPIINCDVWEHAYYIDYRNARPKYVEHFW- 182

Query: 184 NLVNWEYVCERYETAML 200
            ++NW++  +    A +
Sbjct: 183 QIINWDFANKNVTAAGM 199


>gi|237798593|ref|ZP_04587054.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021446|gb|EGI01503.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 9/205 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y  N        E    S+E+++   
Sbjct: 1   MSYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYITNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDL 115
                     + N    + NH+LFW  M    G G +PQ A++ AID+  G FE+FK   
Sbjct: 61  SQLPENLRPAVINQGGGHANHSLFWEVMVP--GGGGLPQGAIAAAIDEQLGGFERFKEAF 118

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FG GW WLSV  + KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR
Sbjct: 119 TKAALTRFGRGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRR 178

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N++NW  V  RYE A+
Sbjct: 179 PEYINAFY-NVINWNEVARRYEAAL 202


>gi|319410245|emb|CBY90585.1| superoxide dismutase (Fe) [Neisseria meningitidis WUE 2594]
          Length = 195

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP++SKETLE+H+  HH+ Y  N        E  +L LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            GS   +FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SGS---VFNNAAQTWNHTFYWLGFTP-KGQGKPVGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|15924543|ref|NP_372077.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927133|ref|NP_374666.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283234|ref|NP_646322.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus MW2]
 gi|49483802|ref|YP_041026.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49486389|ref|YP_043610.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57651946|ref|YP_186450.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|82751156|ref|YP_416897.1| superoxide dismutase [Staphylococcus aureus RF122]
 gi|87161707|ref|YP_494208.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195361|ref|YP_500165.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268037|ref|YP_001246980.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|150394105|ref|YP_001316780.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|151221668|ref|YP_001332490.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156979871|ref|YP_001442130.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509782|ref|YP_001575441.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140027|ref|ZP_03564520.1| superoxide dismutase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253314924|ref|ZP_04838137.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732206|ref|ZP_04866371.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733197|ref|ZP_04867362.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|255006339|ref|ZP_05144940.2| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425678|ref|ZP_05602102.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257428339|ref|ZP_05604737.1| superoxide dismutase  1 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430976|ref|ZP_05607356.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433664|ref|ZP_05610022.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436578|ref|ZP_05612622.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793629|ref|ZP_05642608.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9781]
 gi|258411071|ref|ZP_05681351.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9763]
 gi|258420125|ref|ZP_05683080.1| superoxide dismutase 1 [Staphylococcus aureus A9719]
 gi|258423206|ref|ZP_05686099.1| superoxide dismutase 1 [Staphylococcus aureus A9635]
 gi|258437385|ref|ZP_05689369.1| superoxide dismutase SodA [Staphylococcus aureus A9299]
 gi|258443591|ref|ZP_05691930.1| superoxide dismutase SodA [Staphylococcus aureus A8115]
 gi|258446798|ref|ZP_05694952.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|258448712|ref|ZP_05696824.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|258450618|ref|ZP_05698680.1| superoxide dismutase 1 [Staphylococcus aureus A5948]
 gi|258453529|ref|ZP_05701507.1| superoxide dismutase SodA [Staphylococcus aureus A5937]
 gi|262049131|ref|ZP_06022008.1| superoxide dismutase SodA [Staphylococcus aureus D30]
 gi|262051215|ref|ZP_06023439.1| superoxide dismutase SodA [Staphylococcus aureus 930918-3]
 gi|269203181|ref|YP_003282450.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|282893054|ref|ZP_06301288.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A8117]
 gi|282905962|ref|ZP_06313817.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908872|ref|ZP_06316690.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911191|ref|ZP_06318993.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914360|ref|ZP_06322146.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282916823|ref|ZP_06324581.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919329|ref|ZP_06327064.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920102|ref|ZP_06327827.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A9765]
 gi|282924654|ref|ZP_06332322.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928186|ref|ZP_06335791.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A10102]
 gi|283770629|ref|ZP_06343521.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283958317|ref|ZP_06375768.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024612|ref|ZP_06379010.1| superoxide dismutase [Staphylococcus aureus subsp. aureus 132]
 gi|293503434|ref|ZP_06667281.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510451|ref|ZP_06669157.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293530991|ref|ZP_06671673.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848584|ref|ZP_06789330.1| superoxide dismutase 1 [Staphylococcus aureus A9754]
 gi|295406676|ref|ZP_06816481.1| superoxide dismutase 1 [Staphylococcus aureus A8819]
 gi|295428131|ref|ZP_06820763.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275090|ref|ZP_06857597.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MR1]
 gi|297207728|ref|ZP_06924163.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245742|ref|ZP_06929607.1| superoxide dismutase 1 [Staphylococcus aureus A8796]
 gi|297590903|ref|ZP_06949541.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300911809|ref|ZP_07129252.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304380858|ref|ZP_07363518.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|60390904|sp|Q6G913|SODM1_STAAS RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60390909|sp|Q6GGE6|SODM1_STAAR RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415928|sp|P0A0J1|SODM1_STAAM RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415929|sp|P0A0J2|SODM1_STAAW RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415930|sp|P0A0J3|SODM1_STAA8 RecName: Full=Superoxide dismutase [Mn] 1
 gi|60415931|sp|P99098|SODM1_STAAN RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|81694393|sp|Q5HFK7|SODM1_STAAC RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|123735978|sp|Q2FGH0|SODM1_STAA3 RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|123754586|sp|Q2YT26|SODM1_STAAB RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|4325247|gb|AAD17309.1| superoxide dismutase SodA [Staphylococcus aureus]
 gi|13701351|dbj|BAB42645.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247324|dbj|BAB57715.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204674|dbj|BAB95370.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus MW2]
 gi|49241931|emb|CAG40625.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244832|emb|CAG43292.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57286132|gb|AAW38226.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|82656687|emb|CAI81114.1| superoxide dismutase [Staphylococcus aureus RF122]
 gi|87127681|gb|ABD22195.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87202919|gb|ABD30729.1| superoxide dismutase, Mn, putative [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|147741106|gb|ABQ49404.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|149946557|gb|ABR52493.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|150374468|dbj|BAF67728.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156722006|dbj|BAF78423.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368591|gb|ABX29562.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253723995|gb|EES92724.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728737|gb|EES97466.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|257271372|gb|EEV03518.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257275180|gb|EEV06667.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278406|gb|EEV09042.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281757|gb|EEV11894.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus E1410]
 gi|257283929|gb|EEV14052.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787601|gb|EEV25941.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9781]
 gi|257840221|gb|EEV64685.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9763]
 gi|257843836|gb|EEV68230.1| superoxide dismutase 1 [Staphylococcus aureus A9719]
 gi|257846656|gb|EEV70677.1| superoxide dismutase  1 [Staphylococcus aureus A9635]
 gi|257848590|gb|EEV72578.1| superoxide dismutase SodA [Staphylococcus aureus A9299]
 gi|257850997|gb|EEV74940.1| superoxide dismutase SodA [Staphylococcus aureus A8115]
 gi|257854373|gb|EEV77322.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|257857990|gb|EEV80879.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|257861776|gb|EEV84575.1| superoxide dismutase  1 [Staphylococcus aureus A5948]
 gi|257864260|gb|EEV87010.1| superoxide dismutase SodA [Staphylococcus aureus A5937]
 gi|259160852|gb|EEW45872.1| superoxide dismutase SodA [Staphylococcus aureus 930918-3]
 gi|259162800|gb|EEW47365.1| superoxide dismutase SodA [Staphylococcus aureus D30]
 gi|262075471|gb|ACY11444.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|269941043|emb|CBI49427.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TW20]
 gi|282313489|gb|EFB43884.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317139|gb|EFB47513.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319310|gb|EFB49662.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321541|gb|EFB51866.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282324886|gb|EFB55196.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327136|gb|EFB57431.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331254|gb|EFB60768.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589993|gb|EFB95075.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A10102]
 gi|282594450|gb|EFB99435.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A9765]
 gi|282764372|gb|EFC04498.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A8117]
 gi|283460776|gb|EFC07866.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283470831|emb|CAQ50042.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ST398]
 gi|283790466|gb|EFC29283.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817235|gb|ADC37722.1| Manganese superoxide dismutase; Superoxide dismutase (Fe)
           [Staphylococcus aureus 04-02981]
 gi|290920259|gb|EFD97325.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095100|gb|EFE25365.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466815|gb|EFF09335.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824610|gb|EFG41033.1| superoxide dismutase 1 [Staphylococcus aureus A9754]
 gi|294968423|gb|EFG44447.1| superoxide dismutase 1 [Staphylococcus aureus A8819]
 gi|295128489|gb|EFG58123.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887745|gb|EFH26643.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177393|gb|EFH36645.1| superoxide dismutase 1 [Staphylococcus aureus A8796]
 gi|297575789|gb|EFH94505.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|298694835|gb|ADI98057.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED133]
 gi|300886055|gb|EFK81257.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|302333229|gb|ADL23422.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|302751384|gb|ADL65561.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304340585|gb|EFM06519.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437978|gb|ADQ77049.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829941|emb|CBX34783.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129831|gb|EFT85821.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195455|gb|EFU25842.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS00]
 gi|315198752|gb|EFU29080.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140562|gb|EFW32416.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320144099|gb|EFW35868.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440451|gb|EGA98163.1| superoxide dismutase [Staphylococcus aureus O11]
 gi|323443225|gb|EGB00843.1| superoxide dismutase [Staphylococcus aureus O46]
 gi|329314229|gb|AEB88642.1| Superoxide dismutase [Mn] 1 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727081|gb|EGG63537.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21172]
 gi|329728455|gb|EGG64892.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21189]
 gi|329730875|gb|EGG67253.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21193]
          Length = 199

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 119/200 (59%), Gaps = 10/200 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M F+LP LPY++D L P+  KET+E HHD HH  Y           ++   S+EEI+  +
Sbjct: 1   MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 59  KSHGSN--AGLFNNASQYYNHNLFWACMKKN-DGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            S  +N    + NN   + NH+LFW  +  N + KG V     + I + +GS E+FK + 
Sbjct: 61  DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTV----VEKIKEQWGSLEEFKKEF 116

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 117 ADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRP 176

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNWE V E Y
Sbjct: 177 DYIGAFW-NVVNWEKVDELY 195


>gi|225075191|ref|ZP_03718390.1| hypothetical protein NEIFLAOT_00191 [Neisseria flavescens
           NRL30031/H210]
 gi|224953366|gb|EEG34575.1| hypothetical protein NEIFLAOT_00191 [Neisseria flavescens
           NRL30031/H210]
          Length = 193

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY  D LSP+++KETLE+H+  HH+ Y  N        E   + LEEI+ KS
Sbjct: 1   MEHKLPQLPYELDALSPHLTKETLEFHYGKHHQTYITNLNNQIKGTEFEEMPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W       G+GK    L+ AID  +GSFEKF+      A+
Sbjct: 61  SG---GMFNNAAQTWNHTFYWLGFTPK-GQGKPVGELAAAIDAKWGSFEKFQEAFNACAA 116

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     G+L++  T NA  PL     P+L  DVWEHAYY+D++  R +Y++
Sbjct: 117 GTFGSGWAWLVKTPAGELDLVSTSNAGTPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLK 176

Query: 180 SFITNLVNWEYVCERY 195
            F   +VNW+ V +R+
Sbjct: 177 GFW-EIVNWDEVAKRF 191


>gi|294649919|ref|ZP_06727312.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
 gi|292824187|gb|EFF82997.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
          Length = 207

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYSLPALPYAYDALEPNIDTKTMEIHHSKHHQTYINNINGAIEGTEWEKLPVEELVAKV 60

Query: 61  HGSNAGL----FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +   A L     NNA  + NH+LFW  M    G GK    ++DAID   G F+ FK    
Sbjct: 61  NEVPANLKNMVINNAGGHANHSLFWTVMSPQGG-GKPTGPVADAIDQQLGGFDAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAISRFGSGWAWLSVTPEHKLIVESSANQDSPLMYGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V  RY  A+
Sbjct: 180 EYIAAFY-NVVNWDEVNRRYHDAL 202


>gi|229019498|ref|ZP_04176317.1| Superoxide dismutase [Bacillus cereus AH1273]
 gi|229025740|ref|ZP_04182142.1| Superoxide dismutase [Bacillus cereus AH1272]
 gi|228735559|gb|EEL86152.1| Superoxide dismutase [Bacillus cereus AH1272]
 gi|228741797|gb|EEL91978.1| Superoxide dismutase [Bacillus cereus AH1273]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK--- 59
           +LPNLPY+YD L P+  KET+  HH  HH  Y  N    L   AE+   S+EE++     
Sbjct: 5   ELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNE 64

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH  FW  +  N G   V + L+ AI+  FGSF+ FK +   A
Sbjct: 65  VPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGE-LATAIEAKFGSFDAFKEEFAKA 123

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR  YI
Sbjct: 124 GATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYI 183

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F  N+V+W    + Y+ A
Sbjct: 184 GAFW-NVVDWNVAEKLYQEA 202


>gi|224004080|ref|XP_002295691.1| superoxide dismutase (Fe) [Thalassiosira pseudonana CCMP1335]
 gi|209585723|gb|ACI64408.1| superoxide dismutase (Fe) [Thalassiosira pseudonana CCMP1335]
          Length = 227

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEM--LHLSLEEII--IK 59
           +LP+LPY Y  LSP +SK+TL  HH  HH  Y   A ++ +D ++    L+ E+II  +K
Sbjct: 22  ELPDLPYGYSALSPVISKKTLMTHHLKHHAKYVATANQILNDEKLSLKELTSEQIIKNVK 81

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMK-KNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
              ++  LFNN +Q +NH  +W CM  K  G      AL + I+ +FGSF+  +  + TA
Sbjct: 82  LAITHPSLFNNIAQSWNHAFYWKCMSVKGGGTPTKESALMNMIERDFGSFDNLRQLMETA 141

Query: 119 ASTQFGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A T FGSGW WL    K  KL ++KT  A NP+  G  PIL IDVWEHAYYLD++ +R  
Sbjct: 142 ALTAFGSGWAWLGYDGKRKKLIVTKTTGAGNPMTEGITPILTIDVWEHAYYLDYQEKRNA 201

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y++ F   LVNW +  E  E A+
Sbjct: 202 YVKGFFDKLVNWSFAEESLELAI 224


>gi|325921166|ref|ZP_08183035.1| superoxide dismutase [Xanthomonas gardneri ATCC 19865]
 gi|325548360|gb|EGD19345.1| superoxide dismutase [Xanthomonas gardneri ATCC 19865]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPEYLQGPVRNNGGGHANHSLFWTVLSPNGG-GEPKGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV  + KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V  RY  A+
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAI 202


>gi|296123731|ref|YP_003631509.1| superoxide dismutase [Planctomyces limnophilus DSM 3776]
 gi|296016071|gb|ADG69310.1| Superoxide dismutase [Planctomyces limnophilus DSM 3776]
          Length = 205

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 121/204 (59%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F LP LPY+   L P++  +T+E HH  HH+ Y +NA K L    E+  L+ E++I  
Sbjct: 1   MPFTLPALPYAPAALEPHIDAQTMEIHHGKHHQAYINNANKALEGHPELAALTAEQLISD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                 G    + NNA  + NH+LFW  +  + G G    AL  AI+  FG+F+ FK   
Sbjct: 61  LSKVPEGIRTVIRNNAGGHANHSLFWTVLAPSAG-GTPTGALEAAINHTFGTFDAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WLSV + G L +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 NAAATTRFGSGWAWLSVDSKGGLVVESTPNQDSPLMEGRTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI SF  N+VNW  V +R+  A
Sbjct: 180 PDYIASFW-NIVNWPEVSKRFAAA 202


>gi|45735395|dbj|BAD13298.1| iron-superoxide dismutase [Matteuccia struthiopteris]
          Length = 262

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 118/209 (56%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  L  LP+  D L P+MSK+TLE H   HH++Y DN  K     E+  + L+E++   
Sbjct: 36  MESYLKPLPFEMDALDPHMSKQTLEIHWGKHHRSYVDNLNKQIVGTELESMQLDELLKFG 95

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +   +    FNNA Q +NH+ F   +K   GK    + L   I  +FGSFE F  +   A
Sbjct: 96  YNNANPTAYFNNAGQVWNHDFFGNSIKPEGGKQPSGEVLY-LIKRDFGSFEAFVDEFKQA 154

Query: 119 ASTQFGSGWGWLSVKN---------GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLD 169
           A+ QFGSGW WL  K           KL I KT NA NPLI G IP+L IDVWEHAYYLD
Sbjct: 155 AAAQFGSGWAWLFAKKTDPLVEKNFAKLAIEKTHNAVNPLILGHIPLLTIDVWEHAYYLD 214

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETA 198
           F+ RRA YI +FI  L++WE V  R   A
Sbjct: 215 FQNRRADYISTFIDELISWETVIARLARA 243


>gi|144059|gb|AAC36882.1| superoxide dismutase [Bordetella pertussis]
 gi|534896|emb|CAA44779.1| Superoxide Dismutase [Bordetella pertussis]
          Length = 192

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYALDALAPRISKETLEFHYGKHHQTYVTNLNNLVPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL+DAI   +GS + FK     +A+
Sbjct: 61  SG---GVFNNAAQVWNHTFYWNSLSPNGG-GEPSGALADAIKAKWGSVDAFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLDIVNTSNAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNWE+  + +
Sbjct: 177 NFWA-LVNWEFAAKNF 191


>gi|157825803|ref|YP_001493523.1| superoxide dismutase [Rickettsia akari str. Hartford]
 gi|157799761|gb|ABV75015.1| Superoxide dismutase [Rickettsia akari str. Hartford]
          Length = 209

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-LEEIII-KS 60
           F LP+LPY  +   P+ + ET +YH+  HH  Y  N   L  D E L    LE+II   S
Sbjct: 14  FILPDLPYDKESFKPHFTPETFDYHYGKHHNAYVQNLNNLLKDKEELQKKDLEKIIYWSS 73

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA +FNNA+Q +NH  FW  +K + G GK    + + I+ +FGSFE F       A 
Sbjct: 74  QNSNAAIFNNAAQIWNHTFFWHSIKPHGG-GKPNGKILEQINKDFGSFEGFCEQFKQEAV 132

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL   + +L+I KT NA  P+ NG  P+L  DVWEHAYY+D++ +R  Y++ 
Sbjct: 133 GQFGSGWAWLVYHDNRLQIIKTANAGTPIANGMKPLLACDVWEHAYYIDYRNKRPDYVDI 192

Query: 181 FITNLVNWEYV 191
           FI +++NW++V
Sbjct: 193 FIKHMINWQFV 203


>gi|289434723|ref|YP_003464595.1| superoxide dismutase, Mn [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170967|emb|CBH27509.1| superoxide dismutase, Mn [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|313633255|gb|EFS00122.1| superoxide dismutase, Mn [Listeria seeligeri FSL N1-067]
          Length = 202

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     + +A  A++    +EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G G     L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGG-GAPTGNLKTAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NWE   +R++ A
Sbjct: 180 EYIDTFW-NVINWEEANKRFDAA 201


>gi|260779268|ref|ZP_05888160.1| superoxide dismutase [Fe] [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605432|gb|EEX31727.1| superoxide dismutase [Fe] [Vibrio coralliilyticus ATCC BAA-450]
          Length = 194

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETL++HH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L+I  T NA  PL   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLDIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYM 176

Query: 179 ESFITNLVNWEYVCE 193
             F   LVNW++V E
Sbjct: 177 NGFWA-LVNWDFVAE 190


>gi|325982191|ref|YP_004294593.1| Superoxide dismutase [Nitrosomonas sp. AL212]
 gi|325531710|gb|ADZ26431.1| Superoxide dismutase [Nitrosomonas sp. AL212]
          Length = 213

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 113/192 (58%), Gaps = 3/192 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + L  LPYS   L P +S  TL +H+  HHK Y DN   L +++++   SLE+II  + G
Sbjct: 19  YVLAPLPYSDTALQPVISSNTLSFHYGKHHKTYVDNLNNLLANSDLAGQSLEQIIKATAG 78

Query: 63  SN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A +FNNA+Q +NH  +W  +K N G G+    L   I+ +FGS E  K +   AA 
Sbjct: 79  QTEKAAIFNNAAQVWNHMFYWHSLKPNGG-GEPSSTLKQKIEASFGSLEACKKEFAQAAL 137

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL     K+ + KT NAE PL     P+L IDVWEHAYYLD++ RRA Y  +
Sbjct: 138 TQFGSGWAWLVQDGDKIALVKTGNAETPLTKNVRPLLTIDVWEHAYYLDYQNRRADYANA 197

Query: 181 FITNLVNWEYVC 192
            +  L+NW++  
Sbjct: 198 ILEKLINWDFAA 209


>gi|313637839|gb|EFS03174.1| superoxide dismutase, Mn [Listeria seeligeri FSL S4-171]
          Length = 202

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     + +A  A++    +EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G G     L  AI+  FG+F++FK   
Sbjct: 61  LDSIPEDIRGAVRNHGGGHANHTLFWSILSPNGG-GAPTGNLKTAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NWE   +R++ A
Sbjct: 180 EYIDTFW-NVINWEEANKRFDAA 201


>gi|163802819|ref|ZP_02196708.1| superoxide dismutase [Vibrio sp. AND4]
 gi|159173359|gb|EDP58182.1| superoxide dismutase [Vibrio sp. AND4]
          Length = 194

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 120/195 (61%), Gaps = 7/195 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLE+HH  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLEFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+    G G+   A+++AI+  FGSF++FK+    +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLAPKAG-GEPTGAVAEAINTAFGSFDEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L+I  T NA  PL   G  P+L +D+WEHAYY+DF+  R +Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLDIVNTSNAATPLTEEGVTPLLTVDLWEHAYYIDFRNVRPNYM 176

Query: 179 ESFITNLVNWEYVCE 193
            +F + LVNW++V E
Sbjct: 177 AAFWS-LVNWDFVAE 190


>gi|332531106|ref|ZP_08407022.1| superoxide dismutase [Hylemonella gracilis ATCC 19624]
 gi|332039452|gb|EGI75862.1| superoxide dismutase [Hylemonella gracilis ATCC 19624]
          Length = 193

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 116/196 (59%), Gaps = 5/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ SKETLE+HH  HH  Y  N   L    E    +LE+I+  S
Sbjct: 1   MEHTLPPLPYAIDALAPHYSKETLEFHHGKHHNAYVVNLNNLQKGTEFESKTLEDIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK N G G+   AL+ AI   +GS+  FK   + +A 
Sbjct: 61  SG---GIYNNAAQIWNHTFFWNCMKPNGG-GEPTGALAAAITKKWGSYAAFKEAFVKSAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I  T  A  PL      +L +DVWEHAYY+D++  R  ++E
Sbjct: 117 GNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNLRQKFVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNW++  + +
Sbjct: 177 TFFDKLVNWDFAAKNF 192


>gi|283852422|ref|ZP_06369691.1| Superoxide dismutase [Desulfovibrio sp. FW1012B]
 gi|283572160|gb|EFC20151.1| Superoxide dismutase [Desulfovibrio sp. FW1012B]
          Length = 235

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 7/195 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F +P LPY  + L P +S  T+ +H+  H K Y DNA KL +D  +    LE++ +++  
Sbjct: 41  FAMPPLPYPENALEPVISARTVSFHYGKHEKAYFDNANKLVADTPLAGQPLEKVFLEAGK 100

Query: 63  SN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQA-LSDAIDDNFGSFEKFKSDLITAA 119
                GLFNN +Q +NH  +W  +K     G  P   L+ AID +FGS +  K  L  AA
Sbjct: 101 DPKMVGLFNNTAQAWNHVFYWNGLKAG---GPAPSGKLAKAIDASFGSLDGCKKALSEAA 157

Query: 120 STQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           +TQFGSGW WL +  +GKL++ KT NA NPL  G  P+  +DVWEHAYYLD++ RR  YI
Sbjct: 158 ATQFGSGWAWLVAGPDGKLKVVKTGNAGNPLQEGLKPLWTLDVWEHAYYLDYQNRRPEYI 217

Query: 179 ESFITNLVNWEYVCE 193
           ++ +  LVNW++V +
Sbjct: 218 QAVLDKLVNWDFVAK 232


>gi|257880204|ref|ZP_05659857.1| manganese superoxide dismutase [Enterococcus faecium 1,230,933]
 gi|257883005|ref|ZP_05662658.1| manganese superoxide dismutase [Enterococcus faecium 1,231,502]
 gi|257891412|ref|ZP_05671065.1| manganese superoxide dismutase [Enterococcus faecium 1,231,410]
 gi|257893591|ref|ZP_05673244.1| manganese superoxide dismutase [Enterococcus faecium 1,231,408]
 gi|258614392|ref|ZP_05712162.1| superoxide dismutase, Mn [Enterococcus faecium DO]
 gi|260560498|ref|ZP_05832672.1| manganese superoxide dismutase [Enterococcus faecium C68]
 gi|293563317|ref|ZP_06677767.1| superoxide dismutase [Mn] [Enterococcus faecium E1162]
 gi|293569312|ref|ZP_06680610.1| superoxide dismutase [Mn] [Enterococcus faecium E1071]
 gi|294621460|ref|ZP_06700629.1| superoxide dismutase [Mn] [Enterococcus faecium U0317]
 gi|314939796|ref|ZP_07847016.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a04]
 gi|314943907|ref|ZP_07850633.1| superoxide dismutase, Mn [Enterococcus faecium TX0133C]
 gi|314950004|ref|ZP_07853297.1| superoxide dismutase, Mn [Enterococcus faecium TX0082]
 gi|314953526|ref|ZP_07856438.1| superoxide dismutase, Mn [Enterococcus faecium TX0133A]
 gi|314994271|ref|ZP_07859573.1| superoxide dismutase, Mn [Enterococcus faecium TX0133B]
 gi|314995139|ref|ZP_07860255.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a01]
 gi|257814432|gb|EEV43190.1| manganese superoxide dismutase [Enterococcus faecium 1,230,933]
 gi|257818663|gb|EEV45991.1| manganese superoxide dismutase [Enterococcus faecium 1,231,502]
 gi|257827772|gb|EEV54398.1| manganese superoxide dismutase [Enterococcus faecium 1,231,410]
 gi|257829970|gb|EEV56577.1| manganese superoxide dismutase [Enterococcus faecium 1,231,408]
 gi|260073500|gb|EEW61828.1| manganese superoxide dismutase [Enterococcus faecium C68]
 gi|291588018|gb|EFF19868.1| superoxide dismutase [Mn] [Enterococcus faecium E1071]
 gi|291598954|gb|EFF30002.1| superoxide dismutase [Mn] [Enterococcus faecium U0317]
 gi|291604769|gb|EFF34253.1| superoxide dismutase [Mn] [Enterococcus faecium E1162]
 gi|313590630|gb|EFR69475.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a01]
 gi|313591306|gb|EFR70151.1| superoxide dismutase, Mn [Enterococcus faecium TX0133B]
 gi|313594449|gb|EFR73294.1| superoxide dismutase, Mn [Enterococcus faecium TX0133A]
 gi|313597448|gb|EFR76293.1| superoxide dismutase, Mn [Enterococcus faecium TX0133C]
 gi|313640936|gb|EFS05516.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a04]
 gi|313643651|gb|EFS08231.1| superoxide dismutase, Mn [Enterococcus faecium TX0082]
          Length = 202

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N    +    E+   ++EE++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNSAIEKYPELGEKTIEELLSD 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G G+    + +AI++ FG F  FK + 
Sbjct: 61  MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAG-GEPTGEIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N++NW+ V +R+E A
Sbjct: 180 DYIAAFW-NVINWDEVNKRFEAA 201


>gi|6572460|emb|CAA10341.1| superoxide dismutase [Vibrio metschnikovii]
          Length = 195

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 116/196 (59%), Gaps = 7/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y      L    E    +LEEII  S
Sbjct: 1   MAFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVKLNGLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+   A++DAI+  FGSFE+FK+    +A 
Sbjct: 61  TG---GIFNNAAQVWNHTFYWHCLAPNAG-GEPTGAVADAINAAFGSFEEFKAKFTDSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             FGS W WL  K +G L I  T NA  P+   G  P+L +D+WEHAYY+D++  R  Y+
Sbjct: 117 NNFGSSWTWLVKKADGSLAIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNLRPDYM 176

Query: 179 ESFITNLVNWEYVCER 194
             F   LVNWE+V   
Sbjct: 177 NGFWA-LVNWEFVARE 191


>gi|302383779|ref|YP_003819602.1| superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194407|gb|ADL01979.1| Superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 242

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 124/201 (61%), Gaps = 6/201 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIKSH 61
           F LP LPY++D L P +  ET++ HH  HHK Y DN    +A+D  +  L++E+++ +  
Sbjct: 42  FTLPALPYAFDALDPAIDAETMQIHHGRHHKAYVDNLNAAVAADPALAGLAIEDLLGRVS 101

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
              A + NN   ++NH+LFW  +      G+    LS AI  +FGS E FK+    AA+T
Sbjct: 102 TLPAAVRNNGGGHWNHSLFWTLLAPVGQGGEPSPELSAAITRDFGSMEAFKTAFNQAATT 161

Query: 122 QFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYRRAHY 177
           +FGSGW WL V NGKL+I+ T N +NPL++ A     P+L +DVWEHAYYL ++ +RA Y
Sbjct: 162 RFGSGWAWLIVANGKLQITSTPNQDNPLMDLAEVRGTPVLAVDVWEHAYYLKYQNKRADY 221

Query: 178 IESFITNLVNWEYVCERYETA 198
           + +F T +VNW+ V   Y  A
Sbjct: 222 LTAFWT-VVNWDSVNRLYADA 241


>gi|149371100|ref|ZP_01890695.1| superoxide dismutase [unidentified eubacterium SCB49]
 gi|149355886|gb|EDM44444.1| superoxide dismutase [unidentified eubacterium SCB49]
          Length = 202

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 122/200 (61%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L+P++ ++T++ HH  HH+ Y +N        ++   ++E I+I  
Sbjct: 1   MAFELPKLPYAHDALAPHIDEQTMQIHHGKHHQGYTNNLNAAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH+LFW  M  N G G+    +  AI  +FGSF  FK    TAA 
Sbjct: 61  DMDNKAVRNNGGGFYNHSLFWEVMSPN-GGGEPTGEIMSAIKSSFGSFADFKEKFSTAAK 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW +L VK +G L+I    N +NPL+     G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 TQFGSGWAFLCVKEDGSLDICGCPNQDNPLMPGVGCGGQPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ +F  N++NW+ V  R+
Sbjct: 180 DYVSAFF-NVINWDEVNARF 198


>gi|327402915|ref|YP_004343753.1| Manganese/iron superoxide dismutase [Fluviicola taffensis DSM
           16823]
 gi|327318423|gb|AEA42915.1| Manganese/iron superoxide dismutase [Fluviicola taffensis DSM
           16823]
          Length = 199

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 121/201 (60%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E H+  HH+ YA N     +  +M   S+E  I+++
Sbjct: 1   MAFELPKLGYAYDALEPHIDARTMEIHYTKHHQAYATNLNNAIAGTDMEGKSIE-YILQN 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NHNLFW  M  N G G     L+ AI+D FG+FE FK +   A +
Sbjct: 60  CKDKPAVRNNGGGFWNHNLFWEVMAPNAG-GTPTGELAQAINDAFGTFEHFKEEFSKAGA 118

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN---GAIPILGIDVWEHAYYLDFKYRRAHY 177
           T+FGSGW WL V+ GKL +  T N +NPL+       PIL +DVWEHAYYL+++ RR  Y
Sbjct: 119 TRFGSGWAWLCVEGGKLVVCSTANQDNPLMGEGCKGTPILAMDVWEHAYYLNYQNRRPDY 178

Query: 178 IESFITNLVNWEYVCERYETA 198
           + +F  N++NW+ V +++  A
Sbjct: 179 MNAFF-NVINWDVVAKKFAAA 198


>gi|315303173|ref|ZP_07873835.1| superoxide dismutase, Mn [Listeria ivanovii FSL F6-596]
 gi|313628457|gb|EFR96928.1| superoxide dismutase, Mn [Listeria ivanovii FSL F6-596]
          Length = 202

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     + +A  A++    +EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G G     L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGG-GAPTGNLKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F  N++NWE   +R++ A
Sbjct: 180 EYIDTFW-NVINWEEANKRFDAA 201


>gi|167464819|ref|ZP_02329908.1| superoxide dismutase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 204

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEII-- 57
           M ++LP LPY+ + L P++ + T+  HHD HH  Y  N    L     +   S+E++I  
Sbjct: 1   MAYQLPALPYANNALEPHIDETTMMIHHDRHHNTYVTNLNAALEGHDNLSSKSVEDLISD 60

Query: 58  IKSHGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           + S   N    + NN   + NH+LFW  +  N G GK   AL+ AID   G FEKFK D 
Sbjct: 61  LNSVPENIRTAVRNNGGGHANHSLFWKLLSPNGG-GKPAGALAQAIDQELGGFEKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WLSV K GKL +  T N +NPL+ G  P+LGIDVWEHAYYL ++ +R
Sbjct: 120 AKAATTRFGSGWAWLSVDKAGKLVVHSTGNQDNPLMEGLTPVLGIDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N++NW+   ++YE A
Sbjct: 180 PDYIAAFW-NVINWDEANKQYEAA 202


>gi|77457078|ref|YP_346583.1| manganese and iron superoxide dismutase [Pseudomonas fluorescens
           Pf0-1]
 gi|77381081|gb|ABA72594.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf0-1]
          Length = 203

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MAFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFAEWPVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFW  M    G GK   AL+ AID+  G  + FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWEVMVPGGG-GKPDGALAKAIDEQLGGLDSFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV  + KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW  V  RY+ A++
Sbjct: 180 EYISAFY-NVINWPQVAARYQAALV 203


>gi|33597152|ref|NP_884795.1| superoxide dismutase [Bordetella parapertussis 12822]
 gi|33600997|ref|NP_888557.1| superoxide dismutase [Bordetella bronchiseptica RB50]
 gi|33566603|emb|CAE37861.1| superoxide dismutase [Bordetella parapertussis]
 gi|33575432|emb|CAE32509.1| superoxide dismutase [Bordetella bronchiseptica RB50]
          Length = 192

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYALDALAPRISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL+DAI   +GS + FK     +A+
Sbjct: 61  SG---GVFNNAAQVWNHTFYWNSLSPNGG-GEPTGALADAIKAKWGSVDAFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLDIVNTSNAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNWE+  + +
Sbjct: 177 NFWA-LVNWEFAAKNF 191


>gi|225454956|ref|XP_002280522.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297744964|emb|CBI38556.3| unnamed protein product [Vitis vinifera]
          Length = 306

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 120/215 (55%), Gaps = 20/215 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY    L P+MS+ETLEYH   HH+ Y DN  +     E+  ++LE+II  ++ 
Sbjct: 48  FELKPPPYPLSALEPHMSRETLEYHWGKHHRGYVDNLNRQIVGTELDGMTLEDIITITYN 107

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH  FW  MK   G G+    L + I  +FGSFE+F  +   AAS
Sbjct: 108 KGDLLPAFNNAAQVWNHTSFWESMKPGGG-GEPSGDLLELIKRDFGSFERFVEEFKLAAS 166

Query: 121 TQFGSGWGWLSVKNGKLEIS-----------------KTQNAENPLINGAIPILGIDVWE 163
           TQFGSGW WL+ K  +L++                  K+ NA NPL+    P+L IDVWE
Sbjct: 167 TQFGSGWAWLAYKANRLDVGNAVNPRPSEEDKKLVVVKSPNAINPLLWDCNPLLTIDVWE 226

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           HAYYLDF+  R  YI  F+  LV+WE V  R E A
Sbjct: 227 HAYYLDFQNHRPDYISIFMEKLVSWEAVSSRLEMA 261


>gi|33593721|ref|NP_881365.1| superoxide dismutase [Bordetella pertussis Tohama I]
 gi|34978393|sp|P37369|SODF_BORPE RecName: Full=Superoxide dismutase [Fe]
 gi|33563794|emb|CAE43036.1| superoxide dismutase [Bordetella pertussis Tohama I]
 gi|332383124|gb|AEE67971.1| superoxide dismutase [Bordetella pertussis CS]
          Length = 192

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKETLE+H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYALDALAPRISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G G+   AL+DAI   +GS + FK     +A+
Sbjct: 61  SG---GVFNNAAQVWNHTFYWNSLSPNGG-GEPSGALADAIKAKWGSVDAFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLDIVNTSNAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F   LVNWE+  + +
Sbjct: 177 NFWA-LVNWEFAAKNF 191


>gi|60685109|gb|AAX34437.1| ferrous superoxide dismutase [Aeromonas hydrophila]
          Length = 182

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 113/187 (60%), Gaps = 7/187 (3%)

Query: 8   LPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGL 67
           LPY+ + L P++S+ETLEYHH  HH  Y  N   L    E    SLEEII  S G   G+
Sbjct: 1   LPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTSTG---GI 57

Query: 68  FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGW 127
           FNNA+Q +NH  +W C+  N G G+   AL+DAI   FGSF +FK     +A   FGS W
Sbjct: 58  FNNAAQIWNHTFYWHCLSPNGG-GEPTGALADAITKAFGSFAEFKDAFTKSAIGNFGSSW 116

Query: 128 GWLSVK-NGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRRAHYIESFITNL 185
            WL  K +G L I  T NA  PL   G  P+L +D+WEHAYY+DF+  R  Y+E+F T L
Sbjct: 117 TWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFWT-L 175

Query: 186 VNWEYVC 192
           VNWE+V 
Sbjct: 176 VNWEFVA 182


>gi|110636534|ref|YP_676741.1| superoxide dismutase, manganese [Cytophaga hutchinsonii ATCC 33406]
 gi|110279215|gb|ABG57401.1| superoxide dismutase, manganese [Cytophaga hutchinsonii ATCC 33406]
          Length = 209

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (59%), Gaps = 12/202 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYA---DNALKLASDAEMLHLSLEEII 57
           M F+LP LPY+ + L P + + T+E HH  HH  Y    +NA+K  +DAE   LS+EEI 
Sbjct: 1   MAFELPALPYATNALEPNIDQATMEIHHGKHHNAYVTNLNNAIK-GTDAE--SLSIEEIC 57

Query: 58  IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                    + NN   ++NH+LFW  +  N G G     L+ AID  FGSF+ FK     
Sbjct: 58  KNISKYTPAIRNNGGGHFNHSLFWTVIGPNAG-GTPTGELATAIDKAFGSFDAFKEQFAA 116

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGA----IPILGIDVWEHAYYLDFKYR 173
           A +T+FGSGW WL V NG+L+I+ T N +NPL++ A     PILG+DVWEHAYYL ++ R
Sbjct: 117 AGATRFGSGWAWLVVANGELKITSTPNQDNPLMDIAEVKGTPILGLDVWEHAYYLKYQNR 176

Query: 174 RAHYIESFITNLVNWEYVCERY 195
           R  YI +F  N+VNW  V   Y
Sbjct: 17