PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1dt0

>gi|12084342|pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197
>gi|12084343|pdb|1DT0|B Chain B, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197
 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 93/196 (47%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S 
Sbjct: 1   AFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSS 60

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    +  
Sbjct: 61  G---GIFNNAAQVWNHTFYWNCLSPNAGGQP-TGALADAINAAFGSFDKFKEEFTKTSVG 116

Query: 122 QFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            FGSGWGWL  K +G L ++ T  A  PL  G  P+L  DVWEHAYY+D++  R  Y+E+
Sbjct: 117 TFGSGWGWLVKKADGSLALASTIGAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEA 176

Query: 181 FITNLVNWEYVCERYE 196
           F  NLVNW +V E++E
Sbjct: 177 F-WNLVNWAFVAEQFE 191