PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1gv3

>gi|23200074|pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248
>gi|23200075|pdb|1GV3|B Chain B, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248
 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 106/206 (51%), Gaps = 8/206 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK---- 59
           +LP LPY YD L   +  ET++ HHD HH  Y +N          L  S  E +++    
Sbjct: 39  ELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNS 98

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH +FW  M   DG G+    ++  I+  FGSFE+FK     A
Sbjct: 99  VPEDIRTTVRNNGGGHLNHTIFWQIMSP-DGGGQPTGDIAQEINQTFGSFEEFKKQFNQA 157

Query: 119 ASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
              +FGSGW WL      +L++  T N +NP++ G+ PI+G DVWEHAYYL ++ RR  Y
Sbjct: 158 GGDRFGSGWVWLVRNPQGQLQVVSTPNQDNPIMEGSYPIMGNDVWEHAYYLRYQNRRPEY 217

Query: 178 IESFITNLVNWEYVCERYETAMLAQK 203
           + +   N+VNW  +  R + +  +  
Sbjct: 218 LNN-WWNVVNWSEINRRTQASRQSNS 242