PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1i08

>gi|13399618|pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205
>gi|13399619|pdb|1I08|B Chain B, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205
 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 82/207 (39%), Positives = 117/207 (56%), Gaps = 15/207 (7%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK- 59
            + LP+LPY+YD L P+  K+T+E HH   H+ Y +NA        E  +L +EE+I K 
Sbjct: 1   SYTLPSLPYAYDALEPHFDKQTMEIHHTKAHQTYVNNANAALESLPEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL F
Sbjct: 118 KAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYET 197
           + RR  YI+ F  N+VNW+    R+  
Sbjct: 178 QNRRPDYIKEF-WNVVNWDEAAARFAA 203