PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1ma1

gi|23200495|pdb|1MA1|A Chain A, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205
>gi|23200496|pdb|1MA1|B Chain B, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205
 Score =  190 bits (483), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 69/197 (35%), Positives = 107/197 (54%), Gaps = 6/197 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           ++LP LPY YD L P++S+E L  HH  HH+ Y D A  L    +    S  ++ IK   
Sbjct: 9   YELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIK--A 66

Query: 63  SNAGLFNNASQYYNHNLFWACMKK-NDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           +   L  +   Y  H  FW  M   ++  G+    L++ I+ +FGSFE+F+ +   AA +
Sbjct: 67  ALKELSFHVGGYVLHLFFWGNMGPADECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAIS 126

Query: 122 QFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             GSGW  L+      +L I + +     +I     +L +DVWEHAYY+D++  R  Y+E
Sbjct: 127 AEGSGWAVLTYCQRTDRLFIMQVEKHNVNVIPHFRILLVLDVWEHAYYIDYRNVRPDYVE 186

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW+ V +R+E
Sbjct: 187 AF-WNIVNWKEVEKRFE 202