PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1p7g

>gi|39654426|pdb|1P7G|A Chain A, Crystal Structure Of Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222
>gi|39654427|pdb|1P7G|B Chain B, Crystal Structure Of Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222
 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 97/203 (47%), Gaps = 6/203 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + LP LPY+Y+ L PY+S E  + HH  HH+ Y + A       E       E  I    
Sbjct: 18  YTLPPLPYAYNALEPYISAEIXQLHHQKHHQGYVNGANAALEKLEKFRK--GEAQIDIRA 75

Query: 63  SNAGLFNNASQYYNHNLFWAC-MKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
               L  + + +  H++FW        G GK    ++D I+  FGSFEKFK +   AA  
Sbjct: 76  VLRDLSFHLNGHILHSIFWPNXAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKN 135

Query: 122 QFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             G GW  L  +    +L I + +         A  +L +DVWEHAYYL +K  R  Y++
Sbjct: 136 VEGVGWAILVYEPLEEQLLILQIEKHNLXHAADAQVLLALDVWEHAYYLQYKNDRGSYVD 195

Query: 180 SFITNLVNWEYVCERYETAMLAQ 202
           +   N+VNW+ V  R + A+  Q
Sbjct: 196 N-WWNVVNWDDVERRLQKALNGQ 217