PSIBLAST alignment of GI: 254780495 and protein with PDB id: 1unf

>gi|56554197|pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238
 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 95/218 (43%), Positives = 124/218 (56%), Gaps = 21/218 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  + L P MS++TLE+H   HH+ Y +N  K     E+   SLEEII+ ++ 
Sbjct: 19  FELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYN 78

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH+ FW CMK   G  K    L + I+ +FGSFEKF  +   AA+
Sbjct: 79  KGDILPAFNNAAQVWNHDFFWECMKPGGGG-KPSGELLELIERDFGSFEKFLDEFKAAAA 137

Query: 121 TQFGSGWGWLSVKNGKLE-----------------ISKTQNAENPLINGAI-PILGIDVW 162
           TQFGSGW WL+ K  KL+                 + K+ NA NPL+ G   P+L IDVW
Sbjct: 138 TQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVW 197

Query: 163 EHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAML 200
           EHAYYLDF+ RR  YI  F+  LV+W+ V  R E A  
Sbjct: 198 EHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQAKA 235