PSIBLAST alignment of GI: 254780495 and protein with PDB id: 2nyb

>gi|119390689|pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192
>gi|119390690|pdb|2NYB|B Chain B, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192
 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/197 (43%), Positives = 114/197 (57%), Gaps = 6/197 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S 
Sbjct: 1   SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSE 60

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA++ +NH  +W C+  N G       +++AI  +FGSF  FK+    AA  
Sbjct: 61  G---GVFNNAAEVWNHTFYWNCLAPNAGGEP-TGKVAEAIAASFGSFADFKAQFTDAAIK 116

Query: 122 QFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            FGSGW WL   +  KL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E 
Sbjct: 117 NFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEH 176

Query: 181 FITNLVNWEYVCERYET 197
           F   LVNWE+V +    
Sbjct: 177 F-WALVNWEFVAKNLAA 192