PSIBLAST alignment of GI: 254780495 and protein with PDB id: 2p4k

>gi|145580455|pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198
>gi|145580456|pdb|2P4K|B Chain B, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198
 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH    +N        +         +     
Sbjct: 2   HSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLNVTEEKYQEALAKG--DVTAQIA 59

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 60  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 118

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 119 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 178

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 179 A-IWNVINWENVTERYMACKK 198