PSIBLAST alignment of GI: 254780495 and protein with PDB id: 3lsu

>gi|323714460|pdb|3LSU|A Chain A, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207
>gi|323714461|pdb|3LSU|B Chain B, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207
>gi|323714462|pdb|3LSU|C Chain C, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207
>gi|323714463|pdb|3LSU|D Chain D, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207
 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 87/204 (42%), Gaps = 12/204 (5%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAE-----MLHLSLEEIII 58
            LP+L + +  L PY+S +  E H+  HH+ Y +         +     +          
Sbjct: 3   TLPDLXWDFGALEPYISGQINELHYTXHHQTYVNGFNTAVDQFQELSDLLAXEPSPANAR 62

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKK--NDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   +  +   + NH LFW  +      G      AL+ AID+ FGS ++      
Sbjct: 63  XMIAIQQNIXFHGGGFTNHCLFWENLAPESQGGGEPPTGALAXAIDEQFGSLDELIXLTN 122

Query: 117 TAASTQFGSGWGWLSVKNGK---LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYR 173
           T  +   GSGW ++         L++ +T N +  +    +P++ ID WEHAYYL ++  
Sbjct: 123 TXLAGVQGSGWAFIVXNLSNGGXLDVVQTYNQDT-VTGPLVPLVAIDAWEHAYYLQYQNX 181

Query: 174 RAHYIESFITNLVNWEYVCERYET 197
            A Y  + I N+VNW     R++ 
Sbjct: 182 XADYFXA-IWNVVNWXEASRRFDA 204