BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780495|ref|YP_003064908.1| superoxide dismutase
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|27382885|ref|NP_774414.1| superoxide dismutase [Bradyrhizobium japonicum USDA 110]
 gi|27356058|dbj|BAC53039.1| superoxide dismutase [Bradyrhizobium japonicum USDA 110]
          Length = 213

 Score =  230 bits (587), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 110/198 (55%), Positives = 135/198 (68%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  +MSKETLE+HHD HH+ Y  N        E    SLEEI+  S
Sbjct: 16  MTFTLPPLPYAYDALGQFMSKETLEFHHDKHHQAYVTNGNNALKGTEWEGKSLEEIVKGS 75

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  +FNNA Q+YNH  FW+ MK N G  K+P  L   I+++ G FEKFK+D   A  
Sbjct: 76  FGKNPAVFNNAGQHYNHIHFWSWMKPNGGGTKLPGKLEKKINEDLGGFEKFKTDFQAAGV 135

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VKNGKLEISKT N ENPL++GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 136 GQFGSGWCWLQVKNGKLEISKTPNGENPLVHGATPILGCDVWEHSYYIDYRNRRPDYLKA 195

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNWEYV   ++ A
Sbjct: 196 FVENLVNWEYVESLFDKA 213


>gi|299132184|ref|ZP_07025379.1| Manganese/iron superoxide dismutase-like protein [Afipia sp. 1NLS2]
 gi|298592321|gb|EFI52521.1| Manganese/iron superoxide dismutase-like protein [Afipia sp. 1NLS2]
          Length = 199

 Score =  229 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 117/198 (59%), Positives = 142/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPDLPYAHDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH LFW  MK   G  K+P  L+  ID++ G FEKFK+D   A +
Sbjct: 61  FGKNAGLFNNAAQHYNHTLFWKMMKPKGGGTKLPGKLAKKIDEDLGGFEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLE++KT N ENPL++G  PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEVTKTPNGENPLVHGGSPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWEYV E    A
Sbjct: 181 FIENLVNWEYVEELLSKA 198


>gi|153010027|ref|YP_001371242.1| superoxide dismutase [Ochrobactrum anthropi ATCC 49188]
 gi|151561915|gb|ABS15413.1| Superoxide dismutase [Ochrobactrum anthropi ATCC 49188]
          Length = 198

 Score =  228 bits (581), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 146/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLE HHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLELHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N GLFNNA Q+YNH LFW  MKKN G  K+P  L  AI+ + G ++KF++D I A  
Sbjct: 61  YGKNQGLFNNAGQHYNHILFWKWMKKNGGGKKLPGKLEKAIESDLGGYDKFRADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGATPILGVDVWEHSYYVDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWE+V E YE A
Sbjct: 181 FVDSLINWEFVEELYEKA 198


>gi|86748800|ref|YP_485296.1| superoxide dismutase [Rhodopseudomonas palustris HaA2]
 gi|86571828|gb|ABD06385.1| Superoxide dismutase [Rhodopseudomonas palustris HaA2]
          Length = 199

 Score =  228 bits (580), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 115/199 (57%), Positives = 141/199 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q++NH  FW  MK N G  K+P AL   I+++ G  +KFK+D   A +
Sbjct: 61  FGKNAPLFNNAGQHFNHIHFWKWMKPNGGGTKLPGALEKKINEDLGGLDKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTANGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVDNLINWEYVEELYSKAV 199


>gi|209884047|ref|YP_002287904.1| superoxide dismutase [Oligotropha carboxidovorans OM5]
 gi|209872243|gb|ACI92039.1| superoxide dismutase [Oligotropha carboxidovorans OM5]
          Length = 199

 Score =  227 bits (578), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 116/198 (58%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L PYMSKETLEYHHD HH+ Y  N   L    E    SLE+I+  S
Sbjct: 1   MTFTLPDLPYAHDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEDIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+Q+YNH LFW  MK N G  K+P  L+  ID++ G FEKFK+D   A +
Sbjct: 61  FGKNQGLFNNAAQHYNHTLFWKWMKPNGGGSKLPGKLAKKIDEDLGGFEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLE+SKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEVSKTPNGENPLVHGASPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNWEYV E +  A
Sbjct: 181 FVDHLVNWEYVEELFSKA 198


>gi|148252893|ref|YP_001237478.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           BTAi1]
 gi|146405066|gb|ABQ33572.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           BTAi1]
          Length = 199

 Score =  226 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 114/199 (57%), Positives = 140/199 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PYMSKETLEYHHD HH+ Y  N        E    SLEEI+  S
Sbjct: 1   MTFTLPPLPYAYEALGPYMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  +FNNA Q++NH  FW+ +K N G  K+P AL   ID++ G +EKFK+D I A  
Sbjct: 61  FGKNPAVFNNAGQHFNHIHFWSWLKPNGGGTKLPGALEKKIDEDLGGYEKFKADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTANGENPLVYGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVENLINWEYVEELYSKAV 199


>gi|17987650|ref|NP_540284.1| superoxide dismutase (Mn) [Brucella melitensis bv. 1 str. 16M]
 gi|17983362|gb|AAL52548.1| superoxide dismutase (mn) [Brucella melitensis bv. 1 str. 16M]
          Length = 243

 Score =  226 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 45  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 104

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 105 FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 164

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 165 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 224

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 225 FVDSLVNWDYVLEMYEKA 242


>gi|326408590|gb|ADZ65655.1| superoxide dismutase [Brucella melitensis M28]
 gi|326538310|gb|ADZ86525.1| superoxide dismutase, Fe-Mn family protein [Brucella melitensis
           M5-90]
          Length = 266

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|237815031|ref|ZP_04594029.1| Superoxide dismutase [Fe] [Brucella abortus str. 2308 A]
 gi|237789868|gb|EEP64078.1| Superoxide dismutase [Fe] [Brucella abortus str. 2308 A]
          Length = 266

 Score =  224 bits (571), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   S EEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|256420107|ref|YP_003120760.1| superoxide dismutase [Chitinophaga pinensis DSM 2588]
 gi|256035015|gb|ACU58559.1| Superoxide dismutase [Chitinophaga pinensis DSM 2588]
          Length = 201

 Score =  224 bits (571), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 91/203 (44%), Positives = 127/203 (62%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L P++ K T+E HH  HH+ Y DN  K  +  E  + SLEE++  +
Sbjct: 1   MAFTLPSLPYAHDALEPHIDKLTMEIHHGKHHQAYVDNLNKAIAGTENENKSLEELVASA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH+ FW  +  N G      AL+DAI   FGSFE+FK     A +
Sbjct: 61  GKISPAVRNNGGGHWNHSFFWKVIGPNAGGEP-TGALADAIKSTFGSFEEFKEKFANAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL VK+GKLEI+ T N +NPL++       P+LGIDVWEHAYYL ++ RR  
Sbjct: 120 TRFGSGWAWLIVKDGKLEITSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+++F  ++VNW  V + YE A 
Sbjct: 180 YLKAF-WSVVNWSEVAKNYEAAK 201


>gi|39934763|ref|NP_947039.1| superoxide dismutase [Rhodopseudomonas palustris CGA009]
 gi|39648613|emb|CAE27134.1| superoxide dismutase [Rhodopseudomonas palustris CGA009]
          Length = 198

 Score =  224 bits (570), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 115/198 (58%), Positives = 141/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q++NH  FW  MK N G  K+P AL   I+++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHFNHIHFWKWMKPNGGGSKLPGALEKKINEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWEYV E Y  A
Sbjct: 181 FVDSLINWEYVEELYSKA 198


>gi|225627074|ref|ZP_03785112.1| superoxide dismutase, Fe-Mn family protein [Brucella ceti str.
           Cudo]
 gi|225617909|gb|EEH14953.1| superoxide dismutase, Fe-Mn family protein [Brucella ceti str.
           Cudo]
          Length = 266

 Score =  223 bits (569), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 68  MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 127

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 128 FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 187

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 188 SQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 247

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 248 FVDSLVNWDYVLEMYEKA 265


>gi|115525836|ref|YP_782747.1| superoxide dismutase [Rhodopseudomonas palustris BisA53]
 gi|115519783|gb|ABJ07767.1| Superoxide dismutase [Rhodopseudomonas palustris BisA53]
          Length = 198

 Score =  223 bits (569), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 118/198 (59%), Positives = 142/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALAPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G  K+P AL+  ID++ G FEKFK+D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHMHFWKWMKPNGGGDKLPGALAKKIDEDLGGFEKFKTDFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISK+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKSANGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ N++NWEYV E Y  A
Sbjct: 181 FVENMINWEYVEEMYSKA 198


>gi|146343080|ref|YP_001208128.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           ORS278]
 gi|146195886|emb|CAL79913.1| superoxide dismutase, iron/manganese cofactor [Bradyrhizobium sp.
           ORS278]
          Length = 199

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 116/199 (58%), Positives = 142/199 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  YMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPPLPYAYDALGAYMSKETLEYHHDKHHQAYVTNGNNLIKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA +FNNA Q+YNH  FW+ MK N G  K+P AL   I+++ G +EKFK+D I A  
Sbjct: 61  FGKNAPIFNNAGQHYNHIHFWSWMKPNGGGTKLPGALEKKINEDLGGYEKFKTDFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N E+PL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTANGESPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVENLINWEYVEELYSKAV 199


>gi|192290286|ref|YP_001990891.1| Superoxide dismutase [Rhodopseudomonas palustris TIE-1]
 gi|192284035|gb|ACF00416.1| Superoxide dismutase [Rhodopseudomonas palustris TIE-1]
          Length = 198

 Score =  223 bits (568), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q++NH  FW  MK N G  K+P  L   I+++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHFNHIHFWKWMKPNGGGSKLPGVLEKKINEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +L+NWEYV E Y  A
Sbjct: 181 FVDSLINWEYVEELYSKA 198


>gi|316935145|ref|YP_004110127.1| manganese/iron superoxide dismutase-like protein [Rhodopseudomonas
           palustris DX-1]
 gi|315602859|gb|ADU45394.1| Manganese/iron superoxide dismutase-like protein [Rhodopseudomonas
           palustris DX-1]
          Length = 198

 Score =  223 bits (568), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 116/198 (58%), Positives = 142/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA LFNNA+Q+YNH  FW  MK N G  K+P AL+  ID++ G FEKFK+D   A +
Sbjct: 61  FNKNAPLFNNAAQHYNHIHFWKWMKPNGGGTKLPGALAKKIDEDLGGFEKFKTDFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++ +R  Y+++
Sbjct: 121 GQFGSGWAWLAVKDGKLEISKTSNGENPLVHGATPILGVDVWEHSYYIDYRNKRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           FI NL+NWEYV E Y  A
Sbjct: 181 FIENLINWEYVEEMYAKA 198


>gi|283781947|ref|YP_003372702.1| superoxide dismutase [Pirellula staleyi DSM 6068]
 gi|283440400|gb|ADB18842.1| Superoxide dismutase [Pirellula staleyi DSM 6068]
          Length = 201

 Score =  223 bits (568), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 87/203 (42%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+ + L PY+  +T+E HH  HH+ Y  NA    + +E+  LS+E +I   
Sbjct: 1   MAFTLPALPYATNALEPYIDAKTMEIHHTKHHQAYITNANNALAGSELESLSVEALIADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + NNA  + NH+LFW  +    G       L DAI   FGSF+ FK    
Sbjct: 61  SKVPENIRATVRNNAGGHANHSLFWTILGPGAGGTP-SGELGDAITSTFGSFDTFKEAFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            A +T+FGSGW WLSV  GKL +  T N ++P++ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAGATRFGSGWAWLSVSGGKLIVESTPNQDSPIMEGRTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW  V  R+  A 
Sbjct: 180 YIAAF-WNIVNWNEVARRFAAAK 201


>gi|126662608|ref|ZP_01733607.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
 gi|126625987|gb|EAZ96676.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
          Length = 201

 Score =  222 bits (565), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 86/201 (42%), Positives = 122/201 (60%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y  N     +  E+   S+E+I+   
Sbjct: 1   MAFELPQLSYAFDALEPHIDAKTMEIHHSKHHNAYVTNLNAAIAGTELEGKSIEDIMKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   ++NH LFW  M  N G       L+ AID  FGSF+ FK++   A +
Sbjct: 61  DMNNMAVRNNGGGHFNHTLFWEIMSPNGGGLP-TGELATAIDAAFGSFDAFKAEFSKAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL VK+GKLE+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 TRFGSGWAWLCVKDGKLEVCSTPNQDNPLMPGVACGGQPILGMDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYET 197
           Y+E+F  N++NW  V +R+  
Sbjct: 180 YMEAFF-NVINWTEVAKRFSA 199


>gi|91978086|ref|YP_570745.1| superoxide dismutase [Rhodopseudomonas palustris BisB5]
 gi|91684542|gb|ABE40844.1| Superoxide dismutase [Rhodopseudomonas palustris BisB5]
          Length = 198

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 114/197 (57%), Positives = 138/197 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MTFTLPELPYAYDALQPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q++NH  FW  MK N G  K+P AL   I+++ G  EKFK+D   A +
Sbjct: 61  FGKNAALFNNAGQHFNHIHFWKWMKPNGGGTKLPGALEKKINEDLGGLEKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GK EISKT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLSVKDGKFEISKTANGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ NL+NWEYV E Y  
Sbjct: 181 FVDNLINWEYVEELYSK 197


>gi|92118893|ref|YP_578622.1| superoxide dismutase [Nitrobacter hamburgensis X14]
 gi|91801787|gb|ABE64162.1| Superoxide dismutase [Nitrobacter hamburgensis X14]
          Length = 199

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 108/198 (54%), Positives = 139/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY++D L+PYMSKETLEYHHD HH+ Y  N        E    SLE+I+  +
Sbjct: 1   MTFTLPDLPYAHDALAPYMSKETLEYHHDKHHQAYVTNGNNALKGTEYEGKSLEDIVRAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HG N  +FNNA Q+YNH  FW  MK N G  K+P  L   I ++F S +KFK+D + A +
Sbjct: 61  HGKNPSVFNNAGQHYNHLHFWKWMKPNGGGNKLPGRLEKKIIEDFTSLDKFKADFVAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VKNGKL++SKT NAE+PL+ GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 121 GQFGSGWAWLQVKNGKLQVSKTANAESPLVQGATPILGCDVWEHSYYIDYRNRRPDYLKA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E +  A
Sbjct: 181 FLDNLVNWDYVDELFSKA 198


>gi|298290674|ref|YP_003692613.1| superoxide dismutase [Starkeya novella DSM 506]
 gi|296927185|gb|ADH87994.1| Superoxide dismutase [Starkeya novella DSM 506]
          Length = 198

 Score =  221 bits (564), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 114/199 (57%), Positives = 141/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+P+MS+ETLEYHHD HH+ Y  N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPELPYAYDALAPFMSRETLEYHHDKHHQAYVTNGNNLLKGTEWEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G NAGLFNNA Q+YNH  FW  MK N G G +P  L   I ++ GS EKFK D   A  
Sbjct: 61  YGKNAGLFNNAGQHYNHIHFWKWMKPN-GGGAIPGELEKKIVEDLGSVEKFKEDFAQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GKL I+KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWAWLAVKDGKLVITKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           FI +LVNW+YV E Y  A+
Sbjct: 180 FIDSLVNWDYVAELYSKAV 198


>gi|212638719|ref|YP_002315239.1| Superoxide dismutase [Anoxybacillus flavithermus WK1]
 gi|212560199|gb|ACJ33254.1| Superoxide dismutase [Anoxybacillus flavithermus WK1]
          Length = 202

 Score =  221 bits (563), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNAYVTNLNAALEGHPELQSKTIEELMAH 60

Query: 61  -----HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI++ FGSFEKFK + 
Sbjct: 61  LNEVPENIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELAEAINNTFGSFEKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N + PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAATRFGSGWAWLVVHNGQLEVTSTPNQDTPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +RY  A 
Sbjct: 180 DYISAF-WNVVNWDEVAKRYAAAK 202


>gi|254502359|ref|ZP_05114510.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Labrenzia alexandrii DFL-11]
 gi|222438430|gb|EEE45109.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Labrenzia alexandrii DFL-11]
          Length = 200

 Score =  221 bits (563), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 109/200 (54%), Positives = 145/200 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L+PYMS ETLE+HHD HH+ Y     +L + + +   SLE+++ +S
Sbjct: 1   MSFELPDLPYAYDALAPYMSAETLEFHHDKHHQAYVTKGNELLAGSGLEGKSLEDVVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MKK+ G   +P AL+ AID + G ++KF++D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHIHFWKWMKKDGGGTSLPGALASAIDSDLGGYDKFRADFIAAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKLEI KT N ENPL++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLAVKDGKLEIMKTPNGENPLVHGASPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           FI N++NW+YV E YE A  
Sbjct: 181 FIDNMINWDYVLEMYEAATK 200


>gi|307946139|ref|ZP_07661474.1| superoxide dismutase (Fe) [Roseibium sp. TrichSKD4]
 gi|307769803|gb|EFO29029.1| superoxide dismutase (Fe) [Roseibium sp. TrichSKD4]
          Length = 233

 Score =  220 bits (561), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 106/198 (53%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY++D L PYMS ETLE+HHD HH  Y     +L + + +   SLEE++ +S
Sbjct: 35  MSFELPDLPYAHDALGPYMSSETLEFHHDKHHMAYVTKGNELLAGSGLEGKSLEEVVKES 94

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G  A LFNNA Q++NH  FW  MK N G   +P AL+  ID + G F+KF++D I A  
Sbjct: 95  FGKYAPLFNNAGQHFNHIHFWNWMKPNGGGTSLPGALASKIDSDLGGFDKFRADFIAAGV 154

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL +K+GKLEI KT N ENPL++GA P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 155 GQFGSGWAWLVLKDGKLEIMKTPNGENPLVHGAAPLLGVDVWEHSYYIDYRNARPKYLEA 214

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E YE A
Sbjct: 215 FVDNLVNWDYVLELYEAA 232


>gi|182678620|ref|YP_001832766.1| superoxide dismutase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634503|gb|ACB95277.1| Superoxide dismutase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 199

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 109/199 (54%), Positives = 140/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+YD L P+MSKETLE+HHD HH+ Y  N   L  D+ +   SLE+I+ +S
Sbjct: 1   MSLTLPPLPYAYDALQPFMSKETLEFHHDKHHQAYVTNGNNLLKDSGLEGKSLEDIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA Q+YNH  FW  MK N G G +P  +  AI D+FGS +K K + I A  
Sbjct: 61  FGKNPGLFNNAGQHYNHLHFWQWMKPN-GGGAIPGTVEKAIIDSFGSVDKAKEEFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GK+ + KT N ENPL++GA PILG DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWSWLAVKDGKIVVMKTPNGENPLVHGATPILGCDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWEYV E Y  A+
Sbjct: 180 FVDSLVNWEYVEELYTKAV 198


>gi|134650|sp|P00449|SODM_BACST RecName: Full=Superoxide dismutase [Mn]
 gi|143203|gb|AAA22600.1| manganese superoxide dismutase (EC 1.15.1.1) [Geobacillus
           stearothermophilus]
 gi|143552|gb|AAA22765.1| Mn-superoxide dismutase [Geobacillus stearothermophilus]
 gi|143555|gb|AAA22767.1| Mn-superoxide dismutase [Geobacillus stearothermophilus]
          Length = 204

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELADAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V +RY  A  
Sbjct: 180 EYIAAF-WNVVNWDEVAKRYSEAKA 203


>gi|319651564|ref|ZP_08005691.1| superoxide dismutase [Bacillus sp. 2_A_57_CT2]
 gi|317396631|gb|EFV77342.1| superoxide dismutase [Bacillus sp. 2_A_57_CT2]
          Length = 202

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P + KET+  HH  HH  Y  N        E L     E ++  
Sbjct: 1   MAFELPQLPYAYDALEPNIDKETMNIHHTKHHNTYVTNLNNALEGNEELLSKTVEEVVSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI   FGS++ FK + 
Sbjct: 61  LDAVPEAVRTAVRNNGGGHANHSLFWQIISPNGGGEP-TGELADAISSKFGSYDSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL+V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AKAATTRFGSGWAWLAVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI SF  N+VNW+ V +RY  A 
Sbjct: 180 EYINSF-WNVVNWDEVSKRYSAAK 202


>gi|158424677|ref|YP_001525969.1| superoxide dismutase [Azorhizobium caulinodans ORS 571]
 gi|158331566|dbj|BAF89051.1| superoxide dismutase [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 115/199 (57%), Positives = 141/199 (70%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPYSYD L+PYMS+ETLEYHHD HH  Y +N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPDLPYSYDALAPYMSRETLEYHHDKHHLAYVNNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G G +P  L   I ++FGS EKFK D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHLHFWHWMKPN-GGGAIPGELEKKIVEDFGSVEKFKEDFIAAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I+KT N E+PL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLSIAKTPNGESPLVSGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWEYV E Y  A+
Sbjct: 180 FVDHLVNWEYVAELYGKAI 198


>gi|56420992|ref|YP_148310.1| manganese superoxide dismutase [Geobacillus kaustophilus HTA426]
 gi|261417679|ref|YP_003251361.1| superoxide dismutase [Geobacillus sp. Y412MC61]
 gi|297529375|ref|YP_003670650.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           C56-T3]
 gi|319767515|ref|YP_004133016.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y412MC52]
 gi|134649|sp|P28760|SODM_BACCA RecName: Full=Superoxide dismutase [Mn]
 gi|7578509|gb|AAF64074.1|AF147780_1 superoxide dismutase [Geobacillus thermoleovorans]
 gi|39453|emb|CAA44556.1| Manganese superoxide dismutase [Bacillus caldotenax]
 gi|56380834|dbj|BAD76742.1| manganese superoxide dismutase [Geobacillus kaustophilus HTA426]
 gi|261374136|gb|ACX76879.1| Superoxide dismutase [Geobacillus sp. Y412MC61]
 gi|297252627|gb|ADI26073.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           C56-T3]
 gi|315361444|gb|ADU05414.1| Mn-sod [Geobacillus sp. POT5]
 gi|317112381|gb|ADU94873.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y412MC52]
 gi|384175|prf||1905285A superoxide dismutase
          Length = 204

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELAEAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V +RY  A  
Sbjct: 180 EYIAAF-WNIVNWDEVAKRYSEAKA 203


>gi|222147937|ref|YP_002548894.1| superoxide dismutase [Agrobacterium vitis S4]
 gi|221734925|gb|ACM35888.1| superoxide dismutase [Agrobacterium vitis S4]
          Length = 200

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 115/200 (57%), Positives = 148/200 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P+MS ETLE+HHD HH+ Y  N   L  D+ +  LSLEE++ +S
Sbjct: 1   MAFELPALPYAYDALGPFMSAETLEFHHDKHHQAYVTNGNNLLKDSGLEGLSLEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G NAGLFNNA Q+YNH  FW  +KK+ G  K+P  L  AI  + G ++KFK+D I A +
Sbjct: 61  YGKNAGLFNNAGQHYNHVHFWNWLKKDGGGTKLPGKLEAAIASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLSVK+GKLEISKT N ENPLI+GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLSVKDGKLEISKTPNGENPLIHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV E YE A  
Sbjct: 181 FVDSLINWDYVAELYEAATK 200


>gi|15888217|ref|NP_353898.1| superoxide dismutase [Agrobacterium tumefaciens str. C58]
 gi|15155867|gb|AAK86683.1| superoxide dismutase [Agrobacterium tumefaciens str. C58]
          Length = 200

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 123/200 (61%), Positives = 154/200 (77%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+PYMS+ETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK+ G  K+P  L  A   + G ++KFK+D I A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWMKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV ERYE A  
Sbjct: 181 FVDNLINWDYVLERYEAAAK 200


>gi|154686764|ref|YP_001421925.1| hypothetical protein RBAM_023340 [Bacillus amyloliquefaciens FZB42]
 gi|154352615|gb|ABS74694.1| SodA [Bacillus amyloliquefaciens FZB42]
          Length = 201

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEP-TGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  P+LG+DVWEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V   Y  A 
Sbjct: 180 YISAF-WNVVNWDEVARLYSEAK 201


>gi|328554238|gb|AEB24730.1| superoxide dismutase [Bacillus amyloliquefaciens TA208]
 gi|328912635|gb|AEB64231.1| Superoxide dismutase [Bacillus amyloliquefaciens LL3]
          Length = 201

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 86/203 (42%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEP-TGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V   Y  A 
Sbjct: 180 YISAF-WNVVNWDEVARLYSEAK 201


>gi|138896037|ref|YP_001126490.1| manganese superoxide dismutase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248930|ref|ZP_03147630.1| Superoxide dismutase [Geobacillus sp. G11MC16]
 gi|134267550|gb|ABO67745.1| Manganese superoxide dismutase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196211806|gb|EDY06565.1| Superoxide dismutase [Geobacillus sp. G11MC16]
          Length = 204

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MPFELPALPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELAEAINKKFGSFAAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V +RY  A  
Sbjct: 180 EYIAAF-WNVVNWDEVAKRYSEAKA 203


>gi|225852095|ref|YP_002732328.1| superoxide dismutase [Brucella melitensis ATCC 23457]
 gi|256044276|ref|ZP_05447180.1| superoxide dismutase (Mn) [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113109|ref|ZP_05453986.1| superoxide dismutase (Mn) [Brucella melitensis bv. 3 str. Ether]
 gi|256264394|ref|ZP_05466926.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260563629|ref|ZP_05834115.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 1
           str. 16M]
 gi|265990686|ref|ZP_06103243.1| superoxide dismutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994518|ref|ZP_06107075.1| superoxide dismutase [Brucella melitensis bv. 3 str. Ether]
 gi|225640460|gb|ACO00374.1| superoxide dismutase, Fe-Mn family protein [Brucella melitensis
           ATCC 23457]
 gi|260153645|gb|EEW88737.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 1
           str. 16M]
 gi|262765631|gb|EEZ11420.1| superoxide dismutase [Brucella melitensis bv. 3 str. Ether]
 gi|263001470|gb|EEZ14045.1| superoxide dismutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094689|gb|EEZ18468.1| manganese and iron superoxide dismutase [Brucella melitensis bv. 2
           str. 63/9]
          Length = 199

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH LFW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|7798571|dbj|BAA95631.1| superoxide dismutase [Geobacillus thermoleovorans]
          Length = 204

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 112/205 (54%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELAEAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +F  GW WL V NG+LEI+ T N ++P++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 SKAAAGRFSPGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V +RY  A  
Sbjct: 180 EYIAAF-WNIVNWDEVAKRYSEAKA 203


>gi|94984937|ref|YP_604301.1| superoxide dismutase [Deinococcus geothermalis DSM 11300]
 gi|94555218|gb|ABF45132.1| Superoxide dismutase [Deinococcus geothermalis DSM 11300]
          Length = 212

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 119/213 (55%), Gaps = 13/213 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +EE+I K 
Sbjct: 1   MAYQLPQLPYAYDALEPHIDARTMEIHHTKHHQTYIDNANKALEGTEFADLPVEELIQKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  M            L+ AI++ FGSFE FK    
Sbjct: 61  DQVPADKKTVLRNNAGGHANHSLFWQVMTPQGQGQP-TGELAQAINETFGSFEAFKQQFE 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
            AA  +FGSGW WL VK  G+L +  T N +NPL+          PILG+DVWEHAYYL+
Sbjct: 120 DAAKGRFGSGWAWLVVKPGGQLAVVSTANQDNPLMGEAIAGASGTPILGVDVWEHAYYLN 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLAQ 202
           ++ RR  Y+++F  N+VNW+ V  RY+ A    
Sbjct: 180 YQNRRPDYLKAF-WNVVNWDEVARRYQQAKSQA 211


>gi|87307276|ref|ZP_01089421.1| superoxide dismutase [Blastopirellula marina DSM 3645]
 gi|87290016|gb|EAQ81905.1| superoxide dismutase [Blastopirellula marina DSM 3645]
          Length = 202

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 85/202 (42%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y            +   ++EE++   
Sbjct: 1   MAYTLPELPYAYDALEPSIDAKTMEIHHTKHHQAYITKVNDAIKGTALESKTIEELVSDL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  MK N G      AL+ AID   G FEKFK D  
Sbjct: 61  SAVPENVRGAVRNNGGGHANHSLFWTIMKPNGGGAP-TGALAAAIDAELGGFEKFKEDFS 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WLSV  GKL +  T N + PL+ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAAATRFGSGWAWLSVDGGKLLVESTPNQDTPLMEGRTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ +F  N++NW+ V + Y  A
Sbjct: 180 YVSAFF-NVINWDEVSKLYAAA 200


>gi|89889936|ref|ZP_01201447.1| superoxide dismutase, iron/manganese-dependent [Flavobacteria
           bacterium BBFL7]
 gi|89518209|gb|EAS20865.1| superoxide dismutase, iron/manganese-dependent [Flavobacteria
           bacterium BBFL7]
          Length = 201

 Score =  219 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 87/203 (42%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E HH  HH  Y           ++   S+E+I+   
Sbjct: 1   MAFELPKLNYAYDALEPHIDARTMEIHHSKHHNGYTTKLNNAIEGTDLEGKSIEDILANL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH LFW  M  N G GK    L+ AID  FGS++ F+    TAA 
Sbjct: 61  DMDNKAVRNNGGGFYNHRLFWEVMSPN-GGGKPTGDLAAAIDSAFGSYDAFQDKFATAAK 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           TQFGSGW +L VK+G LE+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 TQFGSGWAFLCVKDGALEVCGTPNQDNPLMPGVGCGGTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+ +F  N+++W+ V E+Y  A 
Sbjct: 180 YVSAFF-NVIDWDAVSEKYNAAK 201


>gi|325283219|ref|YP_004255760.1| Superoxide dismutase [Deinococcus proteolyticus MRP]
 gi|324315028|gb|ADY26143.1| Superoxide dismutase [Deinococcus proteolyticus MRP]
          Length = 209

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 88/210 (41%), Positives = 118/210 (56%), Gaps = 12/210 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY +D L P++  +T++ HH  HH+ Y DNA K     E     + ++I   
Sbjct: 1   MAFELPQLPYGFDALEPHIDAQTMQIHHGKHHQAYVDNANKALEGTEWADRDVLDVIQNL 60

Query: 61  HGSNAGL----FNNASQYYNHNLFWACMKKNDGKGKVPQ-ALSDAIDDNFGSFEKFKSDL 115
               A       NNA  + NH+LFW  +    G+G  P   L DAI   FGSF+ FK   
Sbjct: 61  DSLPADKKGAVRNNAGGHANHSLFWTVLSGKGGEGNQPSGELMDAITSTFGSFDAFKEKF 120

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA T+FGSGW WL VK+G L +  T N +NPL+          PILG+DVWEHAYYL+
Sbjct: 121 EDAAKTRFGSGWAWLVVKDGALAVVSTANQDNPLMGEAVAGTSGTPILGVDVWEHAYYLN 180

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           ++ RR  Y+++F  N+VNW+ V  RY  A 
Sbjct: 181 YQNRRPDYLKAF-WNVVNWDEVARRYAEAK 209


>gi|311069104|ref|YP_003974027.1| superoxide dismutase [Bacillus atrophaeus 1942]
 gi|310869621|gb|ADP33096.1| superoxide dismutase [Bacillus atrophaeus 1942]
 gi|315423625|gb|ADU17255.1| superoxide dismutase [Bacillus subtilis]
          Length = 202

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K             E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNKAVEGNTAFANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G       L++AI   FGSF+KFK   
Sbjct: 61  LNAVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGDLAEAIKSEFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 GAAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|239831421|ref|ZP_04679750.1| Superoxide dismutase [Fe] [Ochrobactrum intermedium LMG 3301]
 gi|239823688|gb|EEQ95256.1| Superoxide dismutase [Fe] [Ochrobactrum intermedium LMG 3301]
          Length = 221

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLE HHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 24  MAFELPALPYDYDALAPFMSRETLELHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N GLFNNA Q+YNH  FW  MKK  G  K+P  L  AI+ + G ++KF+ D I A  
Sbjct: 84  YGTNQGLFNNAGQHYNHIQFWKWMKKGGGGKKLPGKLEKAIESDLGGYDKFREDFIAAGV 143

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 144 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYVDYRNLRPKYLEA 203

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWE+V E YE A
Sbjct: 204 FVDNLINWEFVEELYEKA 221


>gi|218441422|ref|YP_002379751.1| superoxide dismutase [Cyanothece sp. PCC 7424]
 gi|218174150|gb|ACK72883.1| Superoxide dismutase [Cyanothece sp. PCC 7424]
          Length = 199

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 100/200 (50%), Positives = 135/200 (67%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M +KLP+LPY Y  L P++SK TLE+HHD HH  Y +N  K     E+  +S+E++I K 
Sbjct: 1   MAYKLPDLPYDYTALEPHISKSTLEFHHDKHHAAYVNNFNKAVEGTELDSMSIEDVIKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  GLFNNA+Q +NH  +W CMK N G      AL+D I+ +FGSF+KF  +   A
Sbjct: 61  AGDSSKTGLFNNAAQAWNHTFYWNCMKPNGGGTP-SGALADKINADFGSFDKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + NG L+++KT NA+NPL +G +P+L +DVWEHAYYLD++  R  Y+
Sbjct: 120 GGTQFGSGWAWLVLDNGTLKVTKTPNADNPLTSGQVPLLTMDVWEHAYYLDYQNSRPGYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           E FI NL+NW++V E +  A
Sbjct: 180 EKFINNLINWDFVAENFSKA 199


>gi|311745178|ref|ZP_07718963.1| superoxide dismutase, Mn [Algoriphagus sp. PR1]
 gi|126577700|gb|EAZ81920.1| superoxide dismutase, Mn [Algoriphagus sp. PR1]
          Length = 201

 Score =  218 bits (556), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 123/204 (60%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L P +  +T+E HH  HH  Y  N  K     ++   SL E ++K 
Sbjct: 1   MAFELPSLPYAYDALEPNIDAKTMEIHHSKHHNGYVTNLNKAVEGTDLEGKSL-EELLKI 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            GSN  + NN   ++NH+LFW+ +   DG G+    L+D+I   FGSF  FK     AA+
Sbjct: 60  AGSNTAVRNNGGGHFNHSLFWSILSP-DGGGEPTGELADSISAKFGSFAAFKETFNKAAA 118

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL +   K L +  + N +NPL++       PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCIDTKKELCVCSSPNQDNPLMDVAECPGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+++W+ V +RY  A 
Sbjct: 179 DYINAF-WNVIDWDAVSKRYAAAK 201


>gi|325292253|ref|YP_004278117.1| Superoxide dismutase [Agrobacterium sp. H13-3]
 gi|325060106|gb|ADY63797.1| Superoxide dismutase [Agrobacterium sp. H13-3]
          Length = 200

 Score =  218 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 121/200 (60%), Positives = 154/200 (77%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+PYMS+ETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  +KK+ G  K+P  L  A   + G ++KFK+D I A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWLKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV ERYE A  
Sbjct: 181 FVDNLINWDYVLERYEAAFK 200


>gi|308174292|ref|YP_003920997.1| superoxide dismutase [Bacillus amyloliquefaciens DSM 7]
 gi|307607156|emb|CBI43527.1| superoxide dismutase [Bacillus amyloliquefaciens DSM 7]
          Length = 201

 Score =  218 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N  K    + +   S++E++   
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       L++ I   FGSF++FK    
Sbjct: 61  NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEP-TGELAEEIKSTFGSFDQFKEKFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+D+WEHAYYL+++ RR  
Sbjct: 120 AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDIWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V   Y  A 
Sbjct: 180 YISAF-WNVVNWDEVARLYSEAK 201


>gi|313884690|ref|ZP_07818446.1| superoxide dismutase, Mn [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620058|gb|EFR31491.1| superoxide dismutase, Mn [Eremococcus coleocola ACS-139-V-Col8]
          Length = 200

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 82/201 (40%), Positives = 111/201 (55%), Gaps = 5/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P + +ET++ HHD HH  Y            +   S+EEII   
Sbjct: 1   MAFELPELPYAYDALEPVIDEETMKLHHDKHHNTYVTKLNDAIKGTNLESKSIEEIIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW   +      +VP  L   I+ +FGSFE FK +  
Sbjct: 61  NDVPEKIRTAVRNNGGGHLNHTLFWDETQAPSDNNEVPADLLKKIEADFGSFEDFKKEFK 120

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ QFGSGW WL   NGK E+  T N +NP+ +G  P+LG+DVWEHAYYL ++  R  
Sbjct: 121 AAATGQFGSGWAWLVDNNGKFEVVGTPNQDNPITDGKKPLLGLDVWEHAYYLKYRNVRPD 180

Query: 177 YIESFITNLVNWEYVCERYET 197
           Y+++F   +VNW+ V ER   
Sbjct: 181 YVDAF-WKVVNWDVVAERLAK 200


>gi|239827731|ref|YP_002950355.1| superoxide dismutase [Geobacillus sp. WCH70]
 gi|239808024|gb|ACS25089.1| Superoxide dismutase [Geobacillus sp. WCH70]
          Length = 204

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 87/205 (42%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSIEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELADAINKKFGSFAAFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TKAAATRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V  RY  A  
Sbjct: 180 EYIAAF-WNIVNWDEVARRYSEAKA 203


>gi|90418815|ref|ZP_01226726.1| iron/manganese superoxide dismutase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336895|gb|EAS50600.1| iron/manganese superoxide dismutase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 224

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 108/198 (54%), Positives = 140/198 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMS ETLE+HHD HH+ Y     +LA  A M  LSLEE++ KS
Sbjct: 25  MAFTLPELPYAYDALGPYMSAETLEFHHDKHHQAYVTKGNELAEKAGMADLSLEEVVKKS 84

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G++  LFNNA Q+YNH  FW  M  N G   +P  L  A D + G ++KFK+D   A +
Sbjct: 85  YGTDQALFNNAGQHYNHIHFWQWMTPNGGGKSLPGKLQTAFDSDLGGYDKFKADFEAAGA 144

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VKNGKLEI KT N ENPL++GA+PILG+DVWEH+YY+D++  R  Y+ +
Sbjct: 145 GQFGSGWAWVAVKNGKLEIMKTPNGENPLVHGAVPILGVDVWEHSYYIDYRNARPKYLSA 204

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NW++V E YE A
Sbjct: 205 FVDNLINWDHVLECYEKA 222


>gi|329929520|ref|ZP_08283254.1| superoxide dismutase, Mn [Paenibacillus sp. HGF5]
 gi|328936408|gb|EGG32855.1| superoxide dismutase, Mn [Paenibacillus sp. HGF5]
          Length = 202

 Score =  218 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F+LP LPY+ D L P++  +T+E HHD HH  Y  N      +A  L     E +I  
Sbjct: 1   MAFQLPALPYANDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQGKSLEDLIGN 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G      AL+DAI+   G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPNGGGQP-TGALADAINSELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTPNQDSPIMEGQTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V +RY+ A 
Sbjct: 180 DYISAF-WNVVNWEEVGKRYDNAK 202


>gi|222085262|ref|YP_002543792.1| superoxide dismutase protein [Agrobacterium radiobacter K84]
 gi|221722710|gb|ACM25866.1| superoxide dismutase protein [Agrobacterium radiobacter K84]
          Length = 200

 Score =  218 bits (554), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 123/200 (61%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD LSP+MS+ETLEYHHD HHK Y DN  KLA++A +  LSLEEI+ KS
Sbjct: 1   MAFELPELPYDYDALSPFMSRETLEYHHDKHHKAYVDNGNKLAAEAGLSDLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFAAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           FI +L+NW+YV ERYE A  
Sbjct: 181 FIDSLINWDYVLERYEAATK 200


>gi|295399183|ref|ZP_06809165.1| Superoxide dismutase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110215|ref|YP_003988531.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y4.1MC1]
 gi|294978649|gb|EFG54245.1| Superoxide dismutase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215316|gb|ADP73920.1| Manganese/iron superoxide dismutase-like protein [Geobacillus sp.
           Y4.1MC1]
          Length = 204

 Score =  218 bits (554), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 87/205 (42%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L PY+ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MAFELPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELAEAINKKFGSFAAFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TKAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V +RY  A  
Sbjct: 180 EYIAAF-WNIVNWDEVAKRYSEAKA 203


>gi|255534102|ref|YP_003094474.1| Superoxide dismutase [Pedobacter heparinus DSM 2366]
 gi|255347086|gb|ACU06412.1| Superoxide dismutase [Pedobacter heparinus DSM 2366]
          Length = 201

 Score =  218 bits (554), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 88/203 (43%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ K+T+E HH  HH+ Y  N  K          S+EEI+   
Sbjct: 1   MAFELPALPYATDALEPHIDKQTMEIHHGKHHQAYVTNLNKALEGKPEASQSIEEIVKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH+LFW  +  N G       L+DAI+  FGSF  FK+    A +
Sbjct: 61  SKFPAAVRNNGGGHFNHSLFWEVIGPNKGGEP-TGELADAINAAFGSFADFKTKFAEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WLSV  + KL +S T N +NPL++       PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLSVGADKKLVVSSTPNQDNPLMDIAEVKGTPILGMDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  ++VNW+ V ER++ A
Sbjct: 180 DYIAAF-WSVVNWDAVAERFKKA 201


>gi|62289534|ref|YP_221327.1| Fe-Mn superoxide dismutase [Brucella abortus bv. 1 str. 9-941]
 gi|82699463|ref|YP_414037.1| manganese and iron superoxide dismutase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023791|ref|YP_001934559.1| Manganese and iron superoxide dismutase [Brucella abortus S19]
 gi|254688852|ref|ZP_05152106.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 6
           str. 870]
 gi|254693334|ref|ZP_05155162.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 3
           str. Tulya]
 gi|254696982|ref|ZP_05158810.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729884|ref|ZP_05188462.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 4
           str. 292]
 gi|256257100|ref|ZP_05462636.1| Manganese and iron superoxide dismutase [Brucella abortus bv. 9
           str. C68]
 gi|260545710|ref|ZP_05821451.1| manganese and iron superoxide dismutase [Brucella abortus NCTC
           8038]
 gi|260754335|ref|ZP_05866683.1| superoxide dismutase [Brucella abortus bv. 6 str. 870]
 gi|260757554|ref|ZP_05869902.1| superoxide dismutase [Brucella abortus bv. 4 str. 292]
 gi|260761379|ref|ZP_05873722.1| superoxide dismutase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883360|ref|ZP_05894974.1| superoxide dismutase [Brucella abortus bv. 9 str. C68]
 gi|261213581|ref|ZP_05927862.1| superoxide dismutase [Brucella abortus bv. 3 str. Tulya]
 gi|297247947|ref|ZP_06931665.1| Fe-Mn family superoxide dismutase [Brucella abortus bv. 5 str.
           B3196]
 gi|62195666|gb|AAX73966.1| Fe-Mn superoxide dismutase [Brucella abortus bv. 1 str. 9-941]
 gi|82615564|emb|CAJ10547.1| Manganese and iron superoxide dismutase:ATP/GTP-binding site motif
           A (P-loop) [Brucella melitensis biovar Abortus 2308]
 gi|189019363|gb|ACD72085.1| Manganese and iron superoxide dismutase [Brucella abortus S19]
 gi|260097117|gb|EEW80992.1| manganese and iron superoxide dismutase [Brucella abortus NCTC
           8038]
 gi|260667872|gb|EEX54812.1| superoxide dismutase [Brucella abortus bv. 4 str. 292]
 gi|260671811|gb|EEX58632.1| superoxide dismutase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674443|gb|EEX61264.1| superoxide dismutase [Brucella abortus bv. 6 str. 870]
 gi|260872888|gb|EEX79957.1| superoxide dismutase [Brucella abortus bv. 9 str. C68]
 gi|260915188|gb|EEX82049.1| superoxide dismutase [Brucella abortus bv. 3 str. Tulya]
 gi|297175116|gb|EFH34463.1| Fe-Mn family superoxide dismutase [Brucella abortus bv. 5 str.
           B3196]
          Length = 199

 Score =  218 bits (554), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   S EEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|254780495|ref|YP_003064908.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040172|gb|ACT56968.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 205

 Score =  217 bits (553), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS
Sbjct: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS
Sbjct: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES
Sbjct: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180

Query: 181 FITNLVNWEYVCERYETAMLAQKVT 205
           FITNLVNWEYVCERYETAMLAQKVT
Sbjct: 181 FITNLVNWEYVCERYETAMLAQKVT 205


>gi|149178189|ref|ZP_01856783.1| superoxide dismutase, Mn family protein [Planctomyces maris DSM
           8797]
 gi|148842971|gb|EDL57340.1| superoxide dismutase, Mn family protein [Planctomyces maris DSM
           8797]
          Length = 203

 Score =  217 bits (553), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P++  +T+E HH  HH+ Y   A         L     E ++  
Sbjct: 1   MSYSLPDLPYAYDALEPHIDAKTMEIHHTKHHQAYISKANAALEGHSDLAAKSIEDLMSD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  M  + G       L+  ID  FGSF+ FK   
Sbjct: 61  LSAVPEDIRGAIRNNGGGHANHSLFWTVMSPSGGGAP-SGDLAADIDSTFGSFDAFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WLSV  GKL +  T N + PL  G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 SNAAATRFGSGWAWLSVDGGKLVVESTPNQDTPLSEGHTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +RY  A 
Sbjct: 180 DYISAFF-NVINWDEVAKRYAAAK 202


>gi|148559931|ref|YP_001258565.1| Fe/Mn family superoxide dismutase [Brucella ovis ATCC 25840]
 gi|254701362|ref|ZP_05163190.1| superoxide dismutase (Mn) [Brucella suis bv. 5 str. 513]
 gi|254709701|ref|ZP_05171512.1| superoxide dismutase (Mn) [Brucella pinnipedialis B2/94]
 gi|254712877|ref|ZP_05174688.1| superoxide dismutase (Mn) [Brucella ceti M644/93/1]
 gi|254716769|ref|ZP_05178580.1| superoxide dismutase (Mn) [Brucella ceti M13/05/1]
 gi|254718718|ref|ZP_05180529.1| superoxide dismutase (Mn) [Brucella sp. 83/13]
 gi|256031192|ref|ZP_05444806.1| superoxide dismutase (Mn) [Brucella pinnipedialis M292/94/1]
 gi|256159289|ref|ZP_05457084.1| superoxide dismutase (Mn) [Brucella ceti M490/95/1]
 gi|256254599|ref|ZP_05460135.1| superoxide dismutase (Mn) [Brucella ceti B1/94]
 gi|256369007|ref|YP_003106513.1| superoxide dismutase, Fe-Mn family [Brucella microti CCM 4915]
 gi|261218565|ref|ZP_05932846.1| superoxide dismutase [Brucella ceti M13/05/1]
 gi|261221773|ref|ZP_05936054.1| superoxide dismutase [Brucella ceti B1/94]
 gi|261317231|ref|ZP_05956428.1| superoxide dismutase [Brucella pinnipedialis B2/94]
 gi|261320586|ref|ZP_05959783.1| superoxide dismutase [Brucella ceti M644/93/1]
 gi|261751899|ref|ZP_05995608.1| superoxide dismutase [Brucella suis bv. 5 str. 513]
 gi|265983693|ref|ZP_06096428.1| superoxide dismutase [Brucella sp. 83/13]
 gi|265988270|ref|ZP_06100827.1| superoxide dismutase [Brucella pinnipedialis M292/94/1]
 gi|265997737|ref|ZP_06110294.1| superoxide dismutase [Brucella ceti M490/95/1]
 gi|294851937|ref|ZP_06792610.1| superoxide dismutase [Brucella sp. NVSL 07-0026]
 gi|306838695|ref|ZP_07471530.1| Fe/Mn family superoxide dismutase [Brucella sp. NF 2653]
 gi|306842163|ref|ZP_07474832.1| Fe/Mn family superoxide dismutase [Brucella sp. BO2]
 gi|148371188|gb|ABQ61167.1| superoxide dismutase, Fe-Mn family [Brucella ovis ATCC 25840]
 gi|255999165|gb|ACU47564.1| superoxide dismutase, Fe-Mn family [Brucella microti CCM 4915]
 gi|260920357|gb|EEX87010.1| superoxide dismutase [Brucella ceti B1/94]
 gi|260923654|gb|EEX90222.1| superoxide dismutase [Brucella ceti M13/05/1]
 gi|261293276|gb|EEX96772.1| superoxide dismutase [Brucella ceti M644/93/1]
 gi|261296454|gb|EEX99950.1| superoxide dismutase [Brucella pinnipedialis B2/94]
 gi|261741652|gb|EEY29578.1| superoxide dismutase [Brucella suis bv. 5 str. 513]
 gi|262552205|gb|EEZ08195.1| superoxide dismutase [Brucella ceti M490/95/1]
 gi|264660467|gb|EEZ30728.1| superoxide dismutase [Brucella pinnipedialis M292/94/1]
 gi|264662285|gb|EEZ32546.1| superoxide dismutase [Brucella sp. 83/13]
 gi|294820526|gb|EFG37525.1| superoxide dismutase [Brucella sp. NVSL 07-0026]
 gi|306287750|gb|EFM59181.1| Fe/Mn family superoxide dismutase [Brucella sp. BO2]
 gi|306406182|gb|EFM62426.1| Fe/Mn family superoxide dismutase [Brucella sp. NF 2653]
          Length = 199

 Score =  217 bits (553), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|294501259|ref|YP_003564959.1| superoxide dismutase (Mn) [Bacillus megaterium QM B1551]
 gi|294351196|gb|ADE71525.1| superoxide dismutase (Mn) [Bacillus megaterium QM B1551]
          Length = 202

 Score =  217 bits (553), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N          L     E +I  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAAVEGKADLESKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI   FGSF++FK + 
Sbjct: 61  LDAVPEDIRTAVRNNGGGHANHSLFWTILCPNGGGAP-TGELADAIASKFGSFDQFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ANAAKTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+V W+ V +RY+ A 
Sbjct: 180 DYISAFF-NVVKWDEVAKRYDAAK 202


>gi|23501455|ref|NP_697582.1| Fe/Mn family superoxide dismutase [Brucella suis 1330]
 gi|161618540|ref|YP_001592427.1| superoxide dismutase (Fe) [Brucella canis ATCC 23365]
 gi|163842843|ref|YP_001627247.1| superoxide dismutase (Fe) [Brucella suis ATCC 23445]
 gi|254703907|ref|ZP_05165735.1| superoxide dismutase (Fe) [Brucella suis bv. 3 str. 686]
 gi|260566845|ref|ZP_05837315.1| manganese and iron superoxide dismutase [Brucella suis bv. 4 str.
           40]
 gi|261754557|ref|ZP_05998266.1| superoxide dismutase [Brucella suis bv. 3 str. 686]
 gi|23347358|gb|AAN29497.1| superoxide dismutase, Fe-Mn family [Brucella suis 1330]
 gi|161335351|gb|ABX61656.1| Superoxide dismutase (Fe) [Brucella canis ATCC 23365]
 gi|163673566|gb|ABY37677.1| Superoxide dismutase (Fe) [Brucella suis ATCC 23445]
 gi|260156363|gb|EEW91443.1| manganese and iron superoxide dismutase [Brucella suis bv. 4 str.
           40]
 gi|261744310|gb|EEY32236.1| superoxide dismutase [Brucella suis bv. 3 str. 686]
          Length = 199

 Score =  217 bits (553), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 144/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLAGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|304393547|ref|ZP_07375475.1| superoxide dismutase (Fe) [Ahrensia sp. R2A130]
 gi|303294554|gb|EFL88926.1| superoxide dismutase (Fe) [Ahrensia sp. R2A130]
          Length = 199

 Score =  217 bits (552), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 146/199 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L  YMS ETLEYHHD HHK Y DN  KLA +A M   SLEEI+  S
Sbjct: 1   MAFTLPELPYAYDALGDYMSAETLEYHHDKHHKAYVDNGNKLAEEAGMADKSLEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HG+NAGLFNNA+Q++NH  FW  M  N G  K+P  L  AI+ + G ++KFK+D + A +
Sbjct: 61  HGTNAGLFNNAAQHFNHEHFWHWMAPNGGGKKMPSELEKAINGDLGGYDKFKADFMAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKLEISKT N ENPL++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWCWVSVKDGKLEISKTPNGENPLVHGATPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NW+YV E Y  A 
Sbjct: 181 FVDNLINWDYVAELYSKAK 199


>gi|116251108|ref|YP_766946.1| superoxide dismutase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255756|emb|CAK06837.1| putative superoxide dismutase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 200

 Score =  217 bits (552), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 119/200 (59%), Positives = 153/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D  TA +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFATAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV ERYE A  
Sbjct: 181 FVDSLINWDYVLERYEAATK 200


>gi|149371100|ref|ZP_01890695.1| superoxide dismutase [unidentified eubacterium SCB49]
 gi|149355886|gb|EDM44444.1| superoxide dismutase [unidentified eubacterium SCB49]
          Length = 202

 Score =  217 bits (552), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 81/202 (40%), Positives = 118/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L+P++ ++T++ HH  HH+ Y +N        ++   ++E I+I  
Sbjct: 1   MAFELPKLPYAHDALAPHIDEQTMQIHHGKHHQGYTNNLNAAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH+LFW  M  N G       +  AI  +FGSF  FK    TAA 
Sbjct: 61  DMDNKAVRNNGGGFYNHSLFWEVMSPNGGGEP-TGEIMSAIKSSFGSFADFKEKFSTAAK 119

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW +L VK    L+I    N +NPL+     G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 TQFGSGWAFLCVKEDGSLDICGCPNQDNPLMPGVGCGGQPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NW+ V  R+  
Sbjct: 180 DYVSAFF-NVINWDEVNARFLK 200


>gi|315185725|gb|EFU19492.1| Superoxide dismutase [Spirochaeta thermophila DSM 6578]
          Length = 206

 Score =  217 bits (552), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 115/207 (55%), Gaps = 8/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY YD L P++   T+E HH  HH  Y +N       A          ++++
Sbjct: 1   MSFTLPSLPYPYDALEPHIDARTMEIHHTKHHAGYVNNLNAALEKAPAAKDKDLVFLLRN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH+LFW  +    G      A+  AI   FGSF+ FK   
Sbjct: 61  LKSLPEEVQTAVRNNGGGHANHSLFWTVLSPKGGGTP-RDAVGKAIASTFGSFDAFKEAF 119

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V   G+L++  T N ++P ++G IPILG+DVWEHAYYL ++ RR
Sbjct: 120 SKAAATRFGSGWAWLVVNAYGELQVYSTPNQDSPYMDGFIPILGLDVWEHAYYLSYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAMLA 201
             YI +F  N+VNWE V  RY+ A+ +
Sbjct: 180 PDYIAAF-WNVVNWEEVERRYKEALAS 205


>gi|261404715|ref|YP_003240956.1| Superoxide dismutase [Paenibacillus sp. Y412MC10]
 gi|261281178|gb|ACX63149.1| Superoxide dismutase [Paenibacillus sp. Y412MC10]
          Length = 202

 Score =  217 bits (552), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F+LP LPY+ D L P++  +T+E HHD HH  Y  N      +A  L     E +I  
Sbjct: 1   MAFQLPALPYANDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQGKSLEDLIGN 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G      AL+DAI+   G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPNGGGQP-TGALADAINSELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTANQDSPIMEGQTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V +RY+ A 
Sbjct: 180 DYISAF-WNVVNWEEVGKRYDNAK 202


>gi|229547650|ref|ZP_04436375.1| Mn superoxide dismutase [Enterococcus faecalis TX1322]
 gi|256852436|ref|ZP_05557812.1| superoxide dismutase [Enterococcus faecalis T8]
 gi|229307142|gb|EEN73129.1| Mn superoxide dismutase [Enterococcus faecalis TX1322]
 gi|256712290|gb|EEU27322.1| superoxide dismutase [Enterococcus faecalis T8]
 gi|315028409|gb|EFT40341.1| superoxide dismutase, Mn [Enterococcus faecalis TX4000]
          Length = 202

 Score =  217 bits (552), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKYPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|260168327|ref|ZP_05755138.1| superoxide dismutase (Mn) [Brucella sp. F5/99]
 gi|261757787|ref|ZP_06001496.1| manganese and iron superoxide dismutase [Brucella sp. F5/99]
 gi|261737771|gb|EEY25767.1| manganese and iron superoxide dismutase [Brucella sp. F5/99]
          Length = 199

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 145/198 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 SQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|90425222|ref|YP_533592.1| superoxide dismutase [Rhodopseudomonas palustris BisB18]
 gi|90107236|gb|ABD89273.1| Superoxide dismutase [Rhodopseudomonas palustris BisB18]
          Length = 199

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 108/198 (54%), Positives = 139/198 (70%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+YD L+PYMSKETLEYHHD HH+ Y  N   L    E    SLEE++  S
Sbjct: 1   MTFTLPDLPYAYDALAPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA+Q+YNH  FW  MK N G  K+P  L   I ++ G  EKFK+D   A  
Sbjct: 61  FGKNAPLFNNAAQHYNHIEFWKWMKPNGGGDKLPGRLEKKITEDLGGLEKFKTDFAAAGV 120

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            QFGSGW WLSV K+GKLEI+KT N ENPL++GA P+LG+DVWEH+YY+D++ +R  Y++
Sbjct: 121 GQFGSGWAWLSVSKDGKLEITKTPNGENPLVHGATPLLGVDVWEHSYYIDYRNKRPDYLK 180

Query: 180 SFITNLVNWEYVCERYET 197
           +F+ +L+NW+YV E +  
Sbjct: 181 AFVDHLINWDYVDELFSK 198


>gi|15806297|ref|NP_295003.1| Mn family superoxide dismutase [Deinococcus radiodurans R1]
 gi|32363428|sp|Q9RUV2|SODM_DEIRA RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|310942702|pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans In The Orthorhombic Space Group
           P212121: A Case Study Of Mistaken Identity
 gi|310942703|pdb|3KKY|B Chain B, Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans In The Orthorhombic Space Group
           P212121: A Case Study Of Mistaken Identity
 gi|6459027|gb|AAF10851.1|AE001975_5 superoxide dismutase (sodA), Mn family [Deinococcus radiodurans R1]
          Length = 211

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 91/212 (42%), Positives = 123/212 (58%), Gaps = 14/212 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I + 
Sbjct: 1   MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ---ALSDAIDDNFGSFEKFKS 113
                     L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK 
Sbjct: 61  DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ 120

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYY 167
               AA T+FGSGW WL VK+GKL++  T N +NPL+          PILG+DVWEHAYY
Sbjct: 121 KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY 180

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           L+++ RR  Y+ +F  N+VNW+ V +RY  A 
Sbjct: 181 LNYQNRRPDYLAAF-WNVVNWDEVSKRYAAAK 211


>gi|256617381|ref|ZP_05474227.1| manganese superoxide dismutase [Enterococcus faecalis ATCC 4200]
 gi|256761384|ref|ZP_05501964.1| manganese superoxide dismutase [Enterococcus faecalis T3]
 gi|256957636|ref|ZP_05561807.1| manganese superoxide dismutase [Enterococcus faecalis DS5]
 gi|256959656|ref|ZP_05563827.1| manganese superoxide dismutase [Enterococcus faecalis Merz96]
 gi|256963231|ref|ZP_05567402.1| manganese superoxide dismutase [Enterococcus faecalis HIP11704]
 gi|257080127|ref|ZP_05574488.1| manganese superoxide dismutase [Enterococcus faecalis JH1]
 gi|257080860|ref|ZP_05575221.1| manganese superoxide dismutase [Enterococcus faecalis E1Sol]
 gi|257083544|ref|ZP_05577905.1| manganese superoxide dismutase [Enterococcus faecalis Fly1]
 gi|257085817|ref|ZP_05580178.1| manganese superoxide dismutase [Enterococcus faecalis D6]
 gi|257088959|ref|ZP_05583320.1| manganese superoxide dismutase [Enterococcus faecalis CH188]
 gi|257415180|ref|ZP_05592174.1| manganese superoxide dismutase [Enterococcus faecalis AR01/DG]
 gi|257418235|ref|ZP_05595229.1| manganese superoxide dismutase [Enterococcus faecalis T11]
 gi|293384848|ref|ZP_06630691.1| superoxide dismutase, Mn [Enterococcus faecalis R712]
 gi|293389137|ref|ZP_06633605.1| superoxide dismutase, Mn [Enterococcus faecalis S613]
 gi|294780697|ref|ZP_06746058.1| superoxide dismutase, Mn [Enterococcus faecalis PC1.1]
 gi|307268575|ref|ZP_07549947.1| superoxide dismutase, Mn [Enterococcus faecalis TX4248]
 gi|307272273|ref|ZP_07553533.1| superoxide dismutase, Mn [Enterococcus faecalis TX0855]
 gi|307275563|ref|ZP_07556704.1| superoxide dismutase, Mn [Enterococcus faecalis TX2134]
 gi|307288824|ref|ZP_07568802.1| superoxide dismutase, Mn [Enterococcus faecalis TX0109]
 gi|307290623|ref|ZP_07570531.1| superoxide dismutase, Mn [Enterococcus faecalis TX0411]
 gi|312900205|ref|ZP_07759517.1| superoxide dismutase, Mn [Enterococcus faecalis TX0470]
 gi|312904839|ref|ZP_07763979.1| superoxide dismutase, Mn [Enterococcus faecalis TX0635]
 gi|312908146|ref|ZP_07767124.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 512]
 gi|312952098|ref|ZP_07770980.1| superoxide dismutase, Mn [Enterococcus faecalis TX0102]
 gi|312979082|ref|ZP_07790797.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 516]
 gi|256596908|gb|EEU16084.1| manganese superoxide dismutase [Enterococcus faecalis ATCC 4200]
 gi|256682635|gb|EEU22330.1| manganese superoxide dismutase [Enterococcus faecalis T3]
 gi|256948132|gb|EEU64764.1| manganese superoxide dismutase [Enterococcus faecalis DS5]
 gi|256950152|gb|EEU66784.1| manganese superoxide dismutase [Enterococcus faecalis Merz96]
 gi|256953727|gb|EEU70359.1| manganese superoxide dismutase [Enterococcus faecalis HIP11704]
 gi|256988157|gb|EEU75459.1| manganese superoxide dismutase [Enterococcus faecalis JH1]
 gi|256988890|gb|EEU76192.1| manganese superoxide dismutase [Enterococcus faecalis E1Sol]
 gi|256991574|gb|EEU78876.1| manganese superoxide dismutase [Enterococcus faecalis Fly1]
 gi|256993847|gb|EEU81149.1| manganese superoxide dismutase [Enterococcus faecalis D6]
 gi|256997771|gb|EEU84291.1| manganese superoxide dismutase [Enterococcus faecalis CH188]
 gi|257157008|gb|EEU86968.1| manganese superoxide dismutase [Enterococcus faecalis ARO1/DG]
 gi|257160063|gb|EEU90023.1| manganese superoxide dismutase [Enterococcus faecalis T11]
 gi|291077852|gb|EFE15216.1| superoxide dismutase, Mn [Enterococcus faecalis R712]
 gi|291081529|gb|EFE18492.1| superoxide dismutase, Mn [Enterococcus faecalis S613]
 gi|294452307|gb|EFG20748.1| superoxide dismutase, Mn [Enterococcus faecalis PC1.1]
 gi|295114169|emb|CBL32806.1| Superoxide dismutase [Enterococcus sp. 7L76]
 gi|306498337|gb|EFM67846.1| superoxide dismutase, Mn [Enterococcus faecalis TX0411]
 gi|306500293|gb|EFM69632.1| superoxide dismutase, Mn [Enterococcus faecalis TX0109]
 gi|306507668|gb|EFM76797.1| superoxide dismutase, Mn [Enterococcus faecalis TX2134]
 gi|306511162|gb|EFM80172.1| superoxide dismutase, Mn [Enterococcus faecalis TX0855]
 gi|306515064|gb|EFM83607.1| superoxide dismutase, Mn [Enterococcus faecalis TX4248]
 gi|310625854|gb|EFQ09137.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 512]
 gi|310629945|gb|EFQ13228.1| superoxide dismutase, Mn [Enterococcus faecalis TX0102]
 gi|310631845|gb|EFQ15128.1| superoxide dismutase, Mn [Enterococcus faecalis TX0635]
 gi|311288116|gb|EFQ66672.1| superoxide dismutase, Mn [Enterococcus faecalis DAPTO 516]
 gi|311292566|gb|EFQ71122.1| superoxide dismutase, Mn [Enterococcus faecalis TX0470]
 gi|315026273|gb|EFT38205.1| superoxide dismutase, Mn [Enterococcus faecalis TX2137]
 gi|315032225|gb|EFT44157.1| superoxide dismutase, Mn [Enterococcus faecalis TX0017]
 gi|315035539|gb|EFT47471.1| superoxide dismutase, Mn [Enterococcus faecalis TX0027]
 gi|315143953|gb|EFT87969.1| superoxide dismutase, Mn [Enterococcus faecalis TX2141]
 gi|315146817|gb|EFT90833.1| superoxide dismutase, Mn [Enterococcus faecalis TX4244]
 gi|315149456|gb|EFT93472.1| superoxide dismutase, Mn [Enterococcus faecalis TX0012]
 gi|315153949|gb|EFT97965.1| superoxide dismutase, Mn [Enterococcus faecalis TX0031]
 gi|315161029|gb|EFU05046.1| superoxide dismutase, Mn [Enterococcus faecalis TX0645]
 gi|315166229|gb|EFU10246.1| superoxide dismutase, Mn [Enterococcus faecalis TX1302]
 gi|315167721|gb|EFU11738.1| superoxide dismutase, Mn [Enterococcus faecalis TX1341]
 gi|315170818|gb|EFU14835.1| superoxide dismutase, Mn [Enterococcus faecalis TX1342]
 gi|315173876|gb|EFU17893.1| superoxide dismutase, Mn [Enterococcus faecalis TX1346]
 gi|315576480|gb|EFU88671.1| superoxide dismutase, Mn [Enterococcus faecalis TX0630]
 gi|327534201|gb|AEA93035.1| superoxide dismutase [Enterococcus faecalis OG1RF]
          Length = 202

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|323490090|ref|ZP_08095311.1| superoxide dismutase (Mn) [Planococcus donghaensis MPA1U2]
 gi|323396386|gb|EGA89211.1| superoxide dismutase (Mn) [Planococcus donghaensis MPA1U2]
          Length = 202

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N        E L     E +I  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYITNVNAALEGHEDLASKSVEELIAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  + G      AL +AI+  FGSF++FK   
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWKLLSPSGGGNP-TGALGEAINSKFGSFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A  T+FGSGW WL + NG+LE+  T N ++PL+ G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 AAAGKTRFGSGWAWLVLSNGELEVVSTPNQDSPLMEGKTPLLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V  RYETA 
Sbjct: 180 DYINAF-WNVVNWEEVSNRYETAK 202


>gi|306845181|ref|ZP_07477757.1| Fe/Mn family superoxide dismutase [Brucella sp. BO1]
 gi|306274340|gb|EFM56147.1| Fe/Mn family superoxide dismutase [Brucella sp. BO1]
          Length = 199

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y  L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYGALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G ++KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|86356843|ref|YP_468735.1| superoxide dismutase protein [Rhizobium etli CFN 42]
 gi|86280945|gb|ABC90008.1| superoxide dismutase protein [Rhizobium etli CFN 42]
          Length = 200

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 120/200 (60%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLADLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           FI +L+NW+YV ERYE A  
Sbjct: 181 FIDSLINWDYVLERYEEATK 200


>gi|257867782|ref|ZP_05647435.1| manganese superoxide dismutase [Enterococcus casseliflavus EC30]
 gi|257874109|ref|ZP_05653762.1| manganese superoxide dismutase [Enterococcus casseliflavus EC10]
 gi|257876670|ref|ZP_05656323.1| manganese superoxide dismutase [Enterococcus casseliflavus EC20]
 gi|3320377|gb|AAC26483.1| manganese superoxide dismutase [Vibrio alginolyticus]
 gi|257801865|gb|EEV30768.1| manganese superoxide dismutase [Enterococcus casseliflavus EC30]
 gi|257808273|gb|EEV37095.1| manganese superoxide dismutase [Enterococcus casseliflavus EC10]
 gi|257810836|gb|EEV39656.1| manganese superoxide dismutase [Enterococcus casseliflavus EC20]
          Length = 201

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKTVEELLAD 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH  FW  +  N G      A+ +AI++ FGSFE FK + 
Sbjct: 61  FSSVPEDIQTAVRNNGGGHANHTFFWEILGPNAGGEP-TGAIKEAIEETFGSFEDFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL VK+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  ++VNW+ V E +  A
Sbjct: 180 DYINAF-WSVVNWDKVNEYFAKA 201


>gi|254471705|ref|ZP_05085106.1| superoxide dismutase protein [Pseudovibrio sp. JE062]
 gi|211958907|gb|EEA94106.1| superoxide dismutase protein [Pseudovibrio sp. JE062]
          Length = 199

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 108/199 (54%), Positives = 142/199 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L +LPY+YD L+PYMS ETLE+HHD HH  Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MSFALEDLPYAYDALAPYMSAETLEFHHDKHHMAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+NAGLFNNA Q+ NH  FW  MK N G   +P  L+  +D++ G F+KF++D I A  
Sbjct: 61  YGTNAGLFNNAGQHLNHLHFWKWMKPNGGGSSLPGVLAKKVDEDLGGFDKFRADFINAGV 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GKL + KT N ENP+++GA PILG DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLAVKDGKLVVMKTPNGENPIVHGATPILGCDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NL+NWEYV E Y  A+
Sbjct: 181 FVDNLINWEYVEELYSAAV 199


>gi|229548388|ref|ZP_04437113.1| Mn superoxide dismutase [Enterococcus faecalis ATCC 29200]
 gi|255971016|ref|ZP_05421602.1| manganese superoxide dismutase [Enterococcus faecalis T1]
 gi|257420742|ref|ZP_05597732.1| superoxide dismutase [Enterococcus faecalis X98]
 gi|229306604|gb|EEN72600.1| Mn superoxide dismutase [Enterococcus faecalis ATCC 29200]
 gi|255962034|gb|EET94510.1| manganese superoxide dismutase [Enterococcus faecalis T1]
 gi|257162566|gb|EEU92526.1| superoxide dismutase [Enterococcus faecalis X98]
 gi|315155011|gb|EFT99027.1| superoxide dismutase, Mn [Enterococcus faecalis TX0043]
          Length = 202

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWKIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|227821306|ref|YP_002825276.1| superoxide dismutase contains Mn [Sinorhizobium fredii NGR234]
 gi|227340305|gb|ACP24523.1| superoxide dismutase contains Mn [Sinorhizobium fredii NGR234]
          Length = 200

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 117/200 (58%), Positives = 149/200 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A + +LS+EEI+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSNLSVEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  +KK  G   +P  L  AI  + G ++KF++D I A +
Sbjct: 61  YGTNQPLFNNAGQHYNHIHFWKWLKKGGGGTSLPGKLDAAIKSDLGGYDKFRTDFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV E YE A+ 
Sbjct: 181 FVDNLINWDYVLEMYEAAVK 200


>gi|295706606|ref|YP_003599681.1| superoxide dismutase (Mn) [Bacillus megaterium DSM 319]
 gi|294804265|gb|ADF41331.1| superoxide dismutase (Mn) [Bacillus megaterium DSM 319]
          Length = 202

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y  N          L     E +I  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAAVEGKADLESKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI   FGSF++FK + 
Sbjct: 61  LDAVPEDIRTAVRNNGGGHANHSLFWTILCPNGGGAP-TGELADAIASKFGSFDQFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V NG LE++ T N ++PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ANAAKTRFGSGWAWLVVNNGALEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+V W+ V +RY+ A 
Sbjct: 180 DYISAFF-NVVKWDEVAKRYDAAK 202


>gi|227519125|ref|ZP_03949174.1| superoxide dismutase, Mn [Enterococcus faecalis TX0104]
 gi|227073473|gb|EEI11436.1| superoxide dismutase, Mn [Enterococcus faecalis TX0104]
          Length = 202

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNTIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFVAAK 202


>gi|190890912|ref|YP_001977454.1| superoxide dismutase [Rhizobium etli CIAT 652]
 gi|190696191|gb|ACE90276.1| superoxide dismutase protein [Rhizobium etli CIAT 652]
          Length = 200

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 120/200 (60%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLEE++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           FI +L+NW+YV ERYE A  
Sbjct: 181 FIDSLINWDYVLERYEEATK 200


>gi|29375094|ref|NP_814247.1| superoxide dismutase, Mn [Enterococcus faecalis V583]
 gi|227553829|ref|ZP_03983878.1| Mn superoxide dismutase [Enterococcus faecalis HH22]
 gi|56404874|sp|Q838I4|SODM_ENTFA RecName: Full=Superoxide dismutase [Fe]
 gi|29342553|gb|AAO80318.1| superoxide dismutase, Mn [Enterococcus faecalis V583]
 gi|227177082|gb|EEI58054.1| Mn superoxide dismutase [Enterococcus faecalis HH22]
 gi|315574928|gb|EFU87119.1| superoxide dismutase, Mn [Enterococcus faecalis TX0309B]
 gi|315582183|gb|EFU94374.1| superoxide dismutase, Mn [Enterococcus faecalis TX0309A]
          Length = 202

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVENLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|220925732|ref|YP_002501034.1| manganese and iron superoxide dismutase [Methylobacterium nodulans
           ORS 2060]
 gi|219950339|gb|ACL60731.1| manganese and iron superoxide dismutase [Methylobacterium nodulans
           ORS 2060]
          Length = 199

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 141/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL   +E+   S+EE++  S
Sbjct: 1   MAFTLPELPYAYDALQPYMSKETLEFHHDKHHKAYVDTGNKLLEGSELAGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G G +P AL   I  + G  +KFK+D I A  
Sbjct: 61  YGQNQALFNNAGQHYNHIHFWQWMKPN-GGGAIPGALEKKIAQDLGGTDKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WL+VKNGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 SQFGSGWAWLAVKNGKLEIMKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWE+V + Y  A
Sbjct: 180 FIENLVNWEHVEKMYAEA 197


>gi|327192626|gb|EGE59569.1| Superoxide dismutase [Rhizobium etli CNPAF512]
          Length = 200

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 119/200 (59%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           FI +L+NW+YV ERYE A  
Sbjct: 181 FIDSLINWDYVLERYEEATK 200


>gi|325106235|ref|YP_004275889.1| Manganese/iron superoxide dismutase [Pedobacter saltans DSM 12145]
 gi|324975083|gb|ADY54067.1| Manganese/iron superoxide dismutase [Pedobacter saltans DSM 12145]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ ++T+E HH  HH  Y  N  K     E    SLEEI    
Sbjct: 1   MAFELPALPYASDALEPHIDQQTMEIHHGKHHAAYVTNLNKALEGKEGADSSLEEINKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   +YNH+LFW  +  N G       L++AI+  FGSFE FK+    A +
Sbjct: 61  SKYPVAVRNNGGGHYNHSLFWTVIGPNGGGAP-QGELAEAINAAFGSFEDFKTKFAEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V  +GKL ++ T N +NPL++       PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLIVGADGKLAVTSTPNQDNPLMDVAEVQGTPILGMDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+++W  V ER+  A 
Sbjct: 180 DYISAF-WNVIDWNAVAERFAQAK 202


>gi|320333611|ref|YP_004170322.1| Manganese/iron superoxide dismutase [Deinococcus maricopensis DSM
           21211]
 gi|319754900|gb|ADV66657.1| Manganese/iron superoxide dismutase [Deinococcus maricopensis DSM
           21211]
          Length = 207

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 90/209 (43%), Positives = 121/209 (57%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +EE+I K 
Sbjct: 1   MPYQLPALPYAYDALEPHVDTRTMEIHHTKHHQAYIDNANKALEGTEFADLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  M  N         L+DAI   FGSF+ FK    
Sbjct: 61  DQVPSDKKNVLRNNAGGHANHSLFWTVMGPNGSGQP-SGELADAITAAFGSFDAFKEKFE 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA T+FGSGW WL VK+G+L +  T N ++PL+          PILG+DVWEHAYYL++
Sbjct: 120 DAAKTRFGSGWAWLVVKDGQLAVVSTANQDSPLMGEAVAGVSGTPILGVDVWEHAYYLNY 179

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  Y+++F  N+VNW+ V +RY  A 
Sbjct: 180 QNKRPDYLKAF-WNVVNWDAVAQRYAQAK 207


>gi|163754622|ref|ZP_02161744.1| superoxide dismutase, Mn family protein [Kordia algicida OT-1]
 gi|161325563|gb|EDP96890.1| superoxide dismutase, Mn family protein [Kordia algicida OT-1]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P +   T+E HH  HH  Y +         ++   S+E+I+   
Sbjct: 1   MAFELPKLPYAYDALEPNIDARTMEIHHSKHHNGYTNKLNAAIEGTDLEGKSIEDILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+G+ NN   +YNH+LFW  M   + +G +   L DAI+  FGS ++F      AA+
Sbjct: 61  DMSNSGVRNNGGGFYNHSLFWEVMNP-EDRGYLSGELKDAIEAAFGSKDEFIDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPEVGCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW  V  RY  A 
Sbjct: 180 DYIKAFF-NVINWNEVERRYAEAK 202


>gi|15964726|ref|NP_385079.1| superoxide dismutase Fe protein [Sinorhizobium meliloti 1021]
 gi|7388259|sp|Q9XD74|SODF_RHIME RecName: Full=Superoxide dismutase [Mn]
 gi|5163197|gb|AAD40579.1| superoxide dismutase [Sinorhizobium meliloti]
 gi|15073904|emb|CAC45545.1| Probable superoxide dismutase FE protein [Sinorhizobium meliloti
           1021]
          Length = 200

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 117/200 (58%), Positives = 146/200 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D   A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFSAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV E YE A  
Sbjct: 181 FVDNLINWDYVLELYEAAAK 200


>gi|241203704|ref|YP_002974800.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857594|gb|ACS55261.1| Superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 200

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 118/200 (59%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV ERYE A  
Sbjct: 181 FVDSLINWDYVLERYEEATK 200


>gi|255973529|ref|ZP_05424115.1| manganese superoxide dismutase [Enterococcus faecalis T2]
 gi|307282801|ref|ZP_07563001.1| superoxide dismutase, Mn [Enterococcus faecalis TX0860]
 gi|255966401|gb|EET97023.1| manganese superoxide dismutase [Enterococcus faecalis T2]
 gi|306503657|gb|EFM72888.1| superoxide dismutase, Mn [Enterococcus faecalis TX0860]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-NGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|295132153|ref|YP_003582829.1| superoxide dismutase [Zunongwangia profunda SM-A87]
 gi|294980168|gb|ADF50633.1| superoxide dismutase [Zunongwangia profunda SM-A87]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 120/202 (59%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP L Y++D L P++  +T+E HHD HH  Y           ++   ++E I+   
Sbjct: 1   MAFALPELKYAFDALEPHIDAKTMEIHHDKHHAGYTTKLNNAIEGTDLEGKTIENILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+ + NN   +YNH+LFW  M   DG GK    L++AID  FGSF+ FK +   AA+
Sbjct: 61  DLSNSAVRNNGGGFYNHSLFWEVMSP-DGGGKPEGELAEAIDTAFGSFDAFKEEFSNAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V   GKLEI  T N +NPL+        PILG+DVWEHAYYL+++ +R 
Sbjct: 120 GQFGSGWAWLCVHDGGKLEICSTPNQDNPLMPEVGCGGTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI++F  N+++W+ V  RY  
Sbjct: 180 AYIDAFF-NVIDWKEVASRYAK 200


>gi|15613972|ref|NP_242275.1| superoxide dismutase [Bacillus halodurans C-125]
 gi|34395853|sp|Q9KD10|SODM_BACHD RecName: Full=Superoxide dismutase [Mn]
 gi|10174025|dbj|BAB05128.1| superoxide dismutase [Bacillus halodurans C-125]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY  + L P++ + T+  HH  HH  Y             L     E ++  
Sbjct: 1   MAFELPKLPYPANALEPHIDEATMNIHHGKHHNTYVTKLNAALEGHSALAEKSIEALVSD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G       L+DAI+  FGSF++FK   
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHTLFWQILSPNGGGAP-TGELADAINAEFGSFDQFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V +GKLEI+ T N + PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ADAAANRFGSGWAWLVVNDGKLEITSTPNQDTPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +RY  A 
Sbjct: 180 DYISAF-WNVVNWDEVAKRYNEAK 202


>gi|288555787|ref|YP_003427722.1| superoxide dismutase [Bacillus pseudofirmus OF4]
 gi|288546947|gb|ADC50830.1| superoxide dismutase [Bacillus pseudofirmus OF4]
          Length = 202

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+ + L P++ ++T+  HH  HH  Y           + L     E ++  
Sbjct: 1   MAYELPQLPYAANALEPHIDEQTMNIHHGKHHNTYITKLNAALEGHDDLQSKSIEELVSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  +  N G       L+DAI+  FGSFE FK   
Sbjct: 61  LDAVPENIRGAVRNNGGGHANHTFFWQILSPNGGGAP-TGELADAINSEFGSFEAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A + +FGSGW WL V  GKL ++ T N + PL+ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ADAGANRFGSGWAWLIVDGGKLAVTSTPNQDTPLMEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V +RY  A 
Sbjct: 180 DYINAF-WNVVNWEEVSKRYAEAK 202


>gi|325571023|ref|ZP_08146595.1| superoxide dismutase [Enterococcus casseliflavus ATCC 12755]
 gi|325156108|gb|EGC68294.1| superoxide dismutase [Enterococcus casseliflavus ATCC 12755]
          Length = 201

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 86/203 (42%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKTVEELLAD 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH  FW  +  N G      A+ +AID+ FGSFE FK + 
Sbjct: 61  FSSVPEDIQTAVRNNGGGHANHTFFWEILGPNAGGEP-TGAIKEAIDEAFGSFEDFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL VK+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  ++VNW+ V E +  A
Sbjct: 180 DYINAF-WSVVNWDKVNEYFAKA 201


>gi|307304303|ref|ZP_07584055.1| Superoxide dismutase [Sinorhizobium meliloti BL225C]
 gi|307321702|ref|ZP_07601092.1| Superoxide dismutase [Sinorhizobium meliloti AK83]
 gi|306892666|gb|EFN23462.1| Superoxide dismutase [Sinorhizobium meliloti AK83]
 gi|306902771|gb|EFN33364.1| Superoxide dismutase [Sinorhizobium meliloti BL225C]
          Length = 200

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 118/200 (59%), Positives = 147/200 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D I A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV E YE A  
Sbjct: 181 FVDNLINWDYVLELYEAAAK 200


>gi|150395811|ref|YP_001326278.1| superoxide dismutase [Sinorhizobium medicae WSM419]
 gi|150027326|gb|ABR59443.1| Superoxide dismutase [Sinorhizobium medicae WSM419]
          Length = 200

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 117/200 (58%), Positives = 147/200 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD L+PYMS+ETLEYHHD HH  Y  N  KLA +A +  LSLE+I+ KS
Sbjct: 1   MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G+N  LFNNA Q+YNH  FW  MKK  G   +P  L  AI  + G ++KF++D + A +
Sbjct: 61  YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFVAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ NL+NW+YV E YE A  
Sbjct: 181 FVDNLINWDYVLELYEAAAK 200


>gi|448837|prf||1918164A superoxide dismutase
          Length = 205

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 86/206 (41%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY YD L P++ KET+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI+  FGSF  FK + 
Sbjct: 61  LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEP-TGELADAINKKFGSFTAFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+ +FGSGW WL V NG+LEI+ T N ++ P++ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 SKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPPIMEGKTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N+VNW+ V +RY  A  
Sbjct: 180 PEYIAAF-WNVVNWDEVAKRYSEAKA 204


>gi|299822911|ref|ZP_07054797.1| manganese (Mn) superoxide dismutase SodA [Listeria grayi DSM 20601]
 gi|299816440|gb|EFI83678.1| manganese (Mn) superoxide dismutase SodA [Listeria grayi DSM 20601]
          Length = 202

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 84/204 (41%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E HH  HH  Y           + L     + ++  
Sbjct: 1   MAYELPKLPYAYDALEPNFDKETMEIHHTKHHNTYVTKLNDALKGHDDLASKSVDELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  +  N G      A+ DAI+  FGSF+ FK   
Sbjct: 61  LNSVPEDIRTAVRNNGGGHSNHTFFWQILSPNGGGEP-TGAIKDAIESTFGSFDAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG LEI+ T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 AEAATGRFGSGWAWLVVNNGNLEITSTANQDSPLTDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +R+E A 
Sbjct: 180 EYITTF-WNVVNWDEVNKRFEAAK 202


>gi|61679581|pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679582|pdb|1Y67|B Chain B, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679583|pdb|1Y67|C Chain C, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|61679584|pdb|1Y67|D Chain D, Crystal Structure Of Manganese Superoxide Dismutase From
           Deinococcus Radiodurans
 gi|114793454|pdb|2AW9|A Chain A, Superoxide Dismutase With Manganese From Deinococcus
           Radiodurans
 gi|114793455|pdb|2AW9|B Chain B, Superoxide Dismutase With Manganese From Deinococcus
           Radiodurans
          Length = 229

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 122/211 (57%), Gaps = 14/211 (6%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I +  
Sbjct: 3   AYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLD 62

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ---ALSDAIDDNFGSFEKFKSD 114
                    L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK  
Sbjct: 63  RVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQK 122

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYL 168
              AA T+FGSGW WL VK+GKL++  T N +NPL+          PILG+DVWEHAYYL
Sbjct: 123 FEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYYL 182

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           +++ RR  Y+ +F  N+VNW+ V +RY  A 
Sbjct: 183 NYQNRRPDYLAAF-WNVVNWDEVSKRYAAAK 212


>gi|257899007|ref|ZP_05678660.1| manganese superoxide dismutase [Enterococcus faecium Com15]
 gi|257836919|gb|EEV61993.1| manganese superoxide dismutase [Enterococcus faecium Com15]
          Length = 202

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTIEELLSD 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G      A+ +AI++ FG F  FK + 
Sbjct: 61  MDAVPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEP-TGAIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVLENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +R+E A 
Sbjct: 180 DYIAAF-WNVINWDEVNKRFEAAK 202


>gi|257885247|ref|ZP_05664900.1| manganese superoxide dismutase [Enterococcus faecium 1,231,501]
 gi|261209015|ref|ZP_05923420.1| manganese superoxide dismutase [Enterococcus faecium TC 6]
 gi|289565173|ref|ZP_06445625.1| superoxide dismutase [Enterococcus faecium D344SRF]
 gi|293553255|ref|ZP_06673892.1| superoxide dismutase [Mn] [Enterococcus faecium E1039]
 gi|294615297|ref|ZP_06695173.1| superoxide dismutase [Mn] [Enterococcus faecium E1636]
 gi|294619062|ref|ZP_06698557.1| superoxide dismutase [Mn] [Enterococcus faecium E1679]
 gi|257821099|gb|EEV48233.1| manganese superoxide dismutase [Enterococcus faecium 1,231,501]
 gi|260077054|gb|EEW64776.1| manganese superoxide dismutase [Enterococcus faecium TC 6]
 gi|289162994|gb|EFD10842.1| superoxide dismutase [Enterococcus faecium D344SRF]
 gi|291591855|gb|EFF23488.1| superoxide dismutase [Mn] [Enterococcus faecium E1636]
 gi|291594723|gb|EFF26105.1| superoxide dismutase [Mn] [Enterococcus faecium E1679]
 gi|291602665|gb|EFF32880.1| superoxide dismutase [Mn] [Enterococcus faecium E1039]
          Length = 202

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTIEELLSD 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G       + +AI++ FG F  FK + 
Sbjct: 61  MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEP-TGEIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +R+E A 
Sbjct: 180 DYIAAF-WNVINWDEVNKRFEAAK 202


>gi|240140048|ref|YP_002964525.1| superoxide dismutase [Methylobacterium extorquens AM1]
 gi|240010022|gb|ACS41248.1| superoxide dismutase [Methylobacterium extorquens AM1]
          Length = 199

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 112/200 (56%), Positives = 140/200 (70%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G    P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGGGQP-PAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++G+ PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGSTPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           FI NLVNWEYV + Y  A  
Sbjct: 180 FIENLVNWEYVEKLYGEAKA 199


>gi|256060699|ref|ZP_05450863.1| superoxide dismutase (Mn) [Brucella neotomae 5K33]
 gi|261324689|ref|ZP_05963886.1| superoxide dismutase [Brucella neotomae 5K33]
 gi|261300669|gb|EEY04166.1| superoxide dismutase [Brucella neotomae 5K33]
          Length = 199

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD L+P+MS+ETLEYHHD HH+ Y  N  KL   + +   SLEEI+ +S
Sbjct: 1   MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N  LFNNA Q+YNH  FW  MKK+ G  K+P  L  A D + G + KF++D I A +
Sbjct: 61  FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYNKFRADFIAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WLSVK+GKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ +LVNW+YV E YE A
Sbjct: 181 FVDSLVNWDYVLEMYEKA 198


>gi|312115130|ref|YP_004012726.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220259|gb|ADP71627.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 200

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/198 (51%), Positives = 138/198 (69%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+Y+ L PYMS ETL+YHHD HH+ Y D    L   + +    LE+I+  +
Sbjct: 1   MAFELPALPYAYEALQPYMSAETLQYHHDKHHQAYVDTGNNLLKGSGLEDKGLEDIVKAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G   +P  L+  ID + G ++KF+   I A  
Sbjct: 61  YGKNQPLFNNAGQHYNHLHFWKWMKPNGGGKSLPGKLAAKIDSDLGGYDKFREAFIEAGK 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL++K+GKLE++KT N ENPL++G +P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLTLKDGKLEVTKTPNGENPLVHGGVPLLGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNWEYV E +E A
Sbjct: 181 FVDNLVNWEYVEELFEKA 198


>gi|37520251|ref|NP_923628.1| superoxide dismutase [Gloeobacter violaceus PCC 7421]
 gi|35211244|dbj|BAC88623.1| superoxide dismutase [Gloeobacter violaceus PCC 7421]
          Length = 316

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 110/206 (53%), Gaps = 8/206 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            +KL  LPY Y  L PY+  ET++ HHD HH+ Y DN  K       L     E +++  
Sbjct: 112 PYKLAPLPYDYSALEPYIDAETMKLHHDKHHQAYVDNLNKALEKYPDLQKKSPEQLLRDL 171

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                 + A +  N   + NH +FW  MK   G       ++ AI  NFGSF+ FK+   
Sbjct: 172 KQVPEDTRAAVRGNGGGHVNHTMFWEIMKPKGGGEPAGP-IAAAIRTNFGSFDAFKTQFN 230

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A + +FGSGW WL     GKLEI  T N ++P+ +G  PI+G DVWEHAYYL ++ RRA
Sbjct: 231 EAGTKRFGSGWVWLVSNPGGKLEIVSTANQDSPIADGKYPIMGNDVWEHAYYLKYQNRRA 290

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            Y+ +   N +NW+ +  R++ A   
Sbjct: 291 DYLSA-WWNTLNWDEINRRFQKASTG 315


>gi|227550529|ref|ZP_03980578.1| superoxide dismutase [Enterococcus faecium TX1330]
 gi|257888556|ref|ZP_05668209.1| manganese superoxide dismutase [Enterococcus faecium 1,141,733]
 gi|257897069|ref|ZP_05676722.1| manganese superoxide dismutase [Enterococcus faecium Com12]
 gi|293378757|ref|ZP_06624915.1| superoxide dismutase, Mn [Enterococcus faecium PC4.1]
 gi|227180430|gb|EEI61402.1| superoxide dismutase [Enterococcus faecium TX1330]
 gi|257824610|gb|EEV51542.1| manganese superoxide dismutase [Enterococcus faecium 1,141,733]
 gi|257833634|gb|EEV60055.1| manganese superoxide dismutase [Enterococcus faecium Com12]
 gi|292642685|gb|EFF60837.1| superoxide dismutase, Mn [Enterococcus faecium PC4.1]
          Length = 202

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTVEELLSD 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G      A+ +AI++ FG F  FK + 
Sbjct: 61  MDAVPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEP-TGAIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +R+E A 
Sbjct: 180 DYIAAF-WNVINWDEVNKRFEAAK 202


>gi|209548448|ref|YP_002280365.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|218674122|ref|ZP_03523791.1| Superoxide dismutase [Rhizobium etli GR56]
 gi|209534204|gb|ACI54139.1| Superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 200

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 118/200 (59%), Positives = 152/200 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L+P+MSKETLE+HHD HHK Y DN  KLA++A +  LSLE+++ KS
Sbjct: 1   MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+NAGLFNNA+Q+YNH  FW  MKK  G  K+P  L  A   + G ++KFK+D   A +
Sbjct: 61  FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVKNGKLEISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +L+NW+YV ERYE A  
Sbjct: 181 FVDSLINWDYVLERYEEATK 200


>gi|293572478|ref|ZP_06683457.1| superoxide dismutase [Mn] [Enterococcus faecium E980]
 gi|291607395|gb|EFF36738.1| superoxide dismutase [Mn] [Enterococcus faecium E980]
          Length = 202

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKTIEELLSD 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G       + +AI++ FG F  FK + 
Sbjct: 61  MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEP-TGEIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA  +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAVGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +R+E A 
Sbjct: 180 DYIAAF-WNVINWDEVNKRFEAAK 202


>gi|146298890|ref|YP_001193481.1| superoxide dismutase [Flavobacterium johnsoniae UW101]
 gi|146153308|gb|ABQ04162.1| Superoxide dismutase [Flavobacterium johnsoniae UW101]
          Length = 203

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 92/202 (45%), Positives = 125/202 (61%), Gaps = 8/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     +  ++   ++E I+I  
Sbjct: 1   MAFELPQLPYAYDALEPHIDARTMEIHHTKHHNAYTTNLNAAIAGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA + NN   +YNHNLFW  M  N G       L+ AI+ +FGSFE+FK+    A +
Sbjct: 61  DKSNAAVRNNGGGFYNHNLFWTVMSPNGGGLPTGDLLA-AIESSFGSFEEFKAKFAKAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLI-----NGAIPILGIDVWEHAYYLDFKYRR 174
           TQFGSGW WL+V K GKLE+  T N +NPL+     +G  PILG+DVWEHAYYL+++ RR
Sbjct: 120 TQFGSGWAWLTVQKGGKLEVVGTPNQDNPLMPEVAGHGGTPILGMDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYE 196
             YIE+F  +++NW  V  R+ 
Sbjct: 180 PDYIEAFF-SVINWTEVARRFA 200


>gi|188582738|ref|YP_001926183.1| superoxide dismutase [Methylobacterium populi BJ001]
 gi|179346236|gb|ACB81648.1| Superoxide dismutase [Methylobacterium populi BJ001]
          Length = 199

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 112/200 (56%), Positives = 139/200 (69%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G    P  L+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGGGQP-PAELAKKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           FI NLVNWEYV + Y  A  
Sbjct: 180 FIENLVNWEYVEKLYGEAKA 199


>gi|218531553|ref|YP_002422369.1| superoxide dismutase [Methylobacterium chloromethanicum CM4]
 gi|254562473|ref|YP_003069568.1| superoxide dismutase [Methylobacterium extorquens DM4]
 gi|218523856|gb|ACK84441.1| Superoxide dismutase [Methylobacterium chloromethanicum CM4]
 gi|254269751|emb|CAX25723.1| superoxide dismutase [Methylobacterium extorquens DM4]
          Length = 199

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 113/200 (56%), Positives = 140/200 (70%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G    P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGGGQP-PAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           FI NLVNWEYV + Y  A  
Sbjct: 180 FIENLVNWEYVEKLYGEAKA 199


>gi|257880204|ref|ZP_05659857.1| manganese superoxide dismutase [Enterococcus faecium 1,230,933]
 gi|257883005|ref|ZP_05662658.1| manganese superoxide dismutase [Enterococcus faecium 1,231,502]
 gi|257891412|ref|ZP_05671065.1| manganese superoxide dismutase [Enterococcus faecium 1,231,410]
 gi|257893591|ref|ZP_05673244.1| manganese superoxide dismutase [Enterococcus faecium 1,231,408]
 gi|258614392|ref|ZP_05712162.1| superoxide dismutase, Mn [Enterococcus faecium DO]
 gi|260560498|ref|ZP_05832672.1| manganese superoxide dismutase [Enterococcus faecium C68]
 gi|293563317|ref|ZP_06677767.1| superoxide dismutase [Mn] [Enterococcus faecium E1162]
 gi|293569312|ref|ZP_06680610.1| superoxide dismutase [Mn] [Enterococcus faecium E1071]
 gi|294621460|ref|ZP_06700629.1| superoxide dismutase [Mn] [Enterococcus faecium U0317]
 gi|314939796|ref|ZP_07847016.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a04]
 gi|314943907|ref|ZP_07850633.1| superoxide dismutase, Mn [Enterococcus faecium TX0133C]
 gi|314950004|ref|ZP_07853297.1| superoxide dismutase, Mn [Enterococcus faecium TX0082]
 gi|314953526|ref|ZP_07856438.1| superoxide dismutase, Mn [Enterococcus faecium TX0133A]
 gi|314994271|ref|ZP_07859573.1| superoxide dismutase, Mn [Enterococcus faecium TX0133B]
 gi|314995139|ref|ZP_07860255.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a01]
 gi|257814432|gb|EEV43190.1| manganese superoxide dismutase [Enterococcus faecium 1,230,933]
 gi|257818663|gb|EEV45991.1| manganese superoxide dismutase [Enterococcus faecium 1,231,502]
 gi|257827772|gb|EEV54398.1| manganese superoxide dismutase [Enterococcus faecium 1,231,410]
 gi|257829970|gb|EEV56577.1| manganese superoxide dismutase [Enterococcus faecium 1,231,408]
 gi|260073500|gb|EEW61828.1| manganese superoxide dismutase [Enterococcus faecium C68]
 gi|291588018|gb|EFF19868.1| superoxide dismutase [Mn] [Enterococcus faecium E1071]
 gi|291598954|gb|EFF30002.1| superoxide dismutase [Mn] [Enterococcus faecium U0317]
 gi|291604769|gb|EFF34253.1| superoxide dismutase [Mn] [Enterococcus faecium E1162]
 gi|313590630|gb|EFR69475.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a01]
 gi|313591306|gb|EFR70151.1| superoxide dismutase, Mn [Enterococcus faecium TX0133B]
 gi|313594449|gb|EFR73294.1| superoxide dismutase, Mn [Enterococcus faecium TX0133A]
 gi|313597448|gb|EFR76293.1| superoxide dismutase, Mn [Enterococcus faecium TX0133C]
 gi|313640936|gb|EFS05516.1| superoxide dismutase, Mn [Enterococcus faecium TX0133a04]
 gi|313643651|gb|EFS08231.1| superoxide dismutase, Mn [Enterococcus faecium TX0082]
          Length = 202

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNSAIEKYPELGEKTIEELLSD 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G       + +AI++ FG F  FK + 
Sbjct: 61  MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEP-TGEIKEAINEAFGDFSSFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL ++NGKL I+ T N ++PL+ G  PILG+DVWEHAYYL +K  R 
Sbjct: 120 KKAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V +R+E A 
Sbjct: 180 DYIAAF-WNVINWDEVNKRFEAAK 202


>gi|299537687|ref|ZP_07050976.1| superoxide dismutase (Fe) [Lysinibacillus fusiformis ZC1]
 gi|298726666|gb|EFI67252.1| superoxide dismutase (Fe) [Lysinibacillus fusiformis ZC1]
          Length = 201

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP L Y+YD L P++  +T+E HH  HH  Y  N        E     + ++I   
Sbjct: 1   MAYELPQLTYAYDALEPHIDAKTMEIHHSKHHNTYVTNLNAAVEGTEFADKDINDLIANL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW  +            ++ AID  FGSF+ FK +  
Sbjct: 61  DALPADKQTAVRNNGGGHANHTLFWEVIAPGGSNTP-VGEVAKAIDAKFGSFDAFKEEFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WL V    + ++ T N ++P++ G  P+LG+DVWEHAYYL+++ RR  
Sbjct: 120 KAATTRFGSGWAWLIVDGDSVAVTSTPNQDSPVMEGKTPVLGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V  +++ A 
Sbjct: 180 YIGAF-WNVVNWDVVEAKFQAAK 201


>gi|268316483|ref|YP_003290202.1| Superoxide dismutase [Rhodothermus marinus DSM 4252]
 gi|82659489|gb|ABB88856.1| superoxide dismutase [Rhodothermus sp. XMH10]
 gi|262334017|gb|ACY47814.1| Superoxide dismutase [Rhodothermus marinus DSM 4252]
          Length = 209

 Score =  215 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 84/206 (40%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY YD L PY+  +T+E HH  HH+ Y +N  K       L     E +++ 
Sbjct: 1   MAFTLPPLPYPYDALEPYVDAQTMEIHHTKHHQGYVNNLNKALEGYPELQNKSIEELLRG 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  MK N G       L++AI   FGSFE FK   
Sbjct: 61  INEIPEAIRTAVRNNGGGHANHSLFWTIMKPNGGGEP-TGELAEAIKATFGSFEAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A+ +FGSGW WL V    KL++  T N ++P + G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 SAEAAGRFGSGWAWLVVDENGKLQVYSTPNQDSPYMQGHTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
           A YI++   N+VNW+ V + Y+ A+ 
Sbjct: 180 AEYIQN-WWNVVNWDQVAQYYKEALA 204


>gi|305665917|ref|YP_003862204.1| superoxide dismutase, Mn family protein [Maribacter sp. HTCC2170]
 gi|88710692|gb|EAR02924.1| superoxide dismutase, Mn family protein [Maribacter sp. HTCC2170]
          Length = 202

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/202 (43%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y +N     +  ++   S+E+I+   
Sbjct: 1   MAFELPKLPYAYDALEPHIDARTMEIHHTKHHNGYTNNLNGAIAGTDLETKSIEDILANL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH LFW  M   DG G+    L+DAI++ FGSFE FK     AA 
Sbjct: 61  DMDNGAVRNNGGGFYNHALFWEIMSP-DGGGEPSGELADAINEAFGSFESFKEKFSKAAG 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  T N +N L+        PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEVCSTPNQDNSLMPNVGCGGHPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NW  V E Y  
Sbjct: 180 DYVNAFF-NVINWSKVSELYAA 200


>gi|83858670|ref|ZP_00952192.1| superoxide dismutase [Oceanicaulis alexandrii HTCC2633]
 gi|83853493|gb|EAP91345.1| superoxide dismutase [Oceanicaulis alexandrii HTCC2633]
          Length = 198

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 97/199 (48%), Positives = 129/199 (64%), Gaps = 2/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+ D L+P++S ETL +HH  HHK Y D A       +   LSLEE+I KS
Sbjct: 1   MAFTLPDLPYAQDALAPHISGETLSFHHGKHHKAYVDKANDAIKGTDYEGLSLEEVIKKS 60

Query: 61  H-GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
               N G+FNNA+Q +NH  +W  M  N G GK   A+++AID +FGS++KF  +   A 
Sbjct: 61  WSEKNMGVFNNAAQIWNHTFYWNSMSPN-GGGKPTGAIAEAIDKSFGSYDKFAEEFKAAG 119

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           + QFGSGW WL     KLE+ KT NAENP+ +GA P+L +DVWEHAYYLD++ RR  YI 
Sbjct: 120 AGQFGSGWAWLVKNGDKLEVRKTLNAENPITDGATPLLTMDVWEHAYYLDYQNRRPDYIG 179

Query: 180 SFITNLVNWEYVCERYETA 198
            F+  LVNW++  +   +A
Sbjct: 180 DFLGKLVNWDFANQNLASA 198


>gi|89099168|ref|ZP_01172046.1| manganese superoxide dismutase [Bacillus sp. NRRL B-14911]
 gi|89086014|gb|EAR65137.1| manganese superoxide dismutase [Bacillus sp. NRRL B-14911]
          Length = 202

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/204 (43%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P + KET+  HH  HH  Y  N        E L     E ++ +
Sbjct: 1   MAFELPQLPYAYDALEPNIDKETMNIHHTKHHNTYVTNLNNALEGNEELLSKTVEEVVSN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             +        + NN   + NH+LFW  +  N G       L DAI   FG+FE FK + 
Sbjct: 61  LDAVPESVRTAVRNNGGGHANHSLFWQILSPNGGGEP-TGELQDAISSKFGNFESFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE++ T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AKAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N VNWE V +RY +A 
Sbjct: 180 EYINNFF-NAVNWEEVSKRYSSAK 202


>gi|315645143|ref|ZP_07898269.1| Superoxide dismutase [Paenibacillus vortex V453]
 gi|315279564|gb|EFU42869.1| Superoxide dismutase [Paenibacillus vortex V453]
          Length = 202

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 122/204 (59%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+ + L P++  +T+E HHD HH  Y  N      +A  L     E +I  
Sbjct: 1   MAFQLPALPYANNALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQDKSLEELIAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G      AL+DAI++  G F+KFK D 
Sbjct: 61  LDAVPESIRTAVRNNGGGHANHSLFWEVIGPNGGGQP-TGALADAINNELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VK+GKL ++ T N ++P++ G  P+LG+DVWEHAYYL+++ +R 
Sbjct: 120 AKAATTRFGSGWAWLVVKDGKLAVTSTPNQDSPIMEGQTPVLGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNWE V +RY+ A 
Sbjct: 180 DYISAF-WNVVNWEEVGKRYDNAK 202


>gi|254430497|ref|ZP_05044200.1| superoxide dismutase [Fe] [Cyanobium sp. PCC 7001]
 gi|197624950|gb|EDY37509.1| superoxide dismutase [Fe] [Cyanobium sp. PCC 7001]
          Length = 199

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 123/200 (61%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N  KL    ++   SLE+ I   
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNKLVEGTDLDGKSLEDTITAV 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G    AG+FNNA+Q +NH+ +W CMK   G      AL++ I+ +FGSFE F     TA
Sbjct: 61  AGDAGKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-TGALAEKINADFGSFEAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +  G L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDGGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|169829098|ref|YP_001699256.1| superoxide dismutase (Fe) [Lysinibacillus sphaericus C3-41]
 gi|168993586|gb|ACA41126.1| Superoxide dismutase (Fe) [Lysinibacillus sphaericus C3-41]
          Length = 201

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP L Y+YD L P++  +T+E HH  HH  Y  N        E     + ++I   
Sbjct: 1   MAYELPQLTYAYDALEPHIDAKTMEIHHSKHHNTYVTNLNAAVEGTEFAEKDINDLIANL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW  +            ++ AID  FGSF+ FK +  
Sbjct: 61  DALPADKQTAVRNNGGGHANHTLFWEVIAPGGSNTP-VGEVAKAIDAKFGSFDAFKEEFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WL V    + ++ T N ++P++ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAATTRFGSGWAWLIVDGDSVAVTSTPNQDSPVMEGKKPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V  +++ A 
Sbjct: 180 YIGAF-WNVVNWDVVEAKFQAAK 201


>gi|170743405|ref|YP_001772060.1| superoxide dismutase [Methylobacterium sp. 4-46]
 gi|168197679|gb|ACA19626.1| Superoxide dismutase [Methylobacterium sp. 4-46]
          Length = 199

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 113/200 (56%), Positives = 143/200 (71%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL   +E+   S+EE++  S
Sbjct: 1   MAFTLPELPYAYDALQPYMSKETLEFHHDKHHKAYVDTGNKLLEGSELAGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q+YNH  FW  MK N G G +P AL   I ++ G  +KFK+D I A  
Sbjct: 61  YGQNQPLFNNAGQHYNHIHFWQWMKPN-GGGAIPGALEKKIAEDLGGADKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           +QFGSGW WL+V+NGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 SQFGSGWAWLAVRNGKLEIMKTPNGENPLVHGAKPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           FI NLVNWE+V + Y  A+ 
Sbjct: 180 FIENLVNWEHVEKMYHEAIA 199


>gi|163852713|ref|YP_001640756.1| superoxide dismutase [Methylobacterium extorquens PA1]
 gi|163664318|gb|ABY31685.1| Superoxide dismutase [Methylobacterium extorquens PA1]
          Length = 199

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 113/200 (56%), Positives = 140/200 (70%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  S
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEATDLAGKSVEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G    P AL+  ID++ G +EKFK+D I A  
Sbjct: 61  YNTNQALFNNAGQHYNHLHFWNWMKPNGGGQP-PAALAQKIDEDLGGYEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAILKTPNGENPLVHGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           FI NLVNWEYV + Y  A  
Sbjct: 180 FIENLVNWEYVEKLYGEAKA 199


>gi|300861936|ref|ZP_07108016.1| superoxide dismutase [Enterococcus faecalis TUSoD Ef11]
 gi|300848461|gb|EFK76218.1| superoxide dismutase [Enterococcus faecalis TUSoD Ef11]
          Length = 202

 Score =  214 bits (546), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMASNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|327439640|dbj|BAK16005.1| superoxide dismutase [Solibacillus silvestris StLB046]
          Length = 201

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP L Y+YD L P++  +T+E HH  HH  Y  N        E     + E+I   
Sbjct: 1   MAFKLPELTYAYDALEPHIDAKTMEIHHSKHHNTYVTNLNAAVEGTEYADKDINELIANI 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW  +            ++ AID  FGSF+ FK +  
Sbjct: 61  DALPADKQTAVRNNGGGHANHTLFWELIAPGGSNTP-VGEVAAAIDAKFGSFDAFKEEFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WL V    + ++ T N ++P++ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAATTRFGSGWAWLIVDGDGVAVTSTPNQDSPVMEGKTPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V  +++ A 
Sbjct: 180 YIGAF-WNVVNWDVVEAKFQAAK 201


>gi|170750886|ref|YP_001757146.1| superoxide dismutase [Methylobacterium radiotolerans JCM 2831]
 gi|170657408|gb|ACB26463.1| Superoxide dismutase [Methylobacterium radiotolerans JCM 2831]
          Length = 199

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 141/198 (71%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L PYMSKETLE+HHD HHK Y D   KL    ++   S+EEI+  +
Sbjct: 1   MTFTLPELPYAYDALGPYMSKETLEFHHDKHHKAYVDTGNKLLEGTDLQGKSVEEIVKAA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           + +N  LFNNA Q+YNH  FW  MK N G G +P AL+  ID++ G  EKFK+D I A  
Sbjct: 61  YNTNQPLFNNAGQHYNHIHFWQWMKPN-GGGAIPGALAKKIDEDLGGAEKFKADFIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL+VK+GKL I KT N ENPL++GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLAVKDGKLAIMKTPNGENPLVHGAQPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           FI NLVNWE+V + Y  A
Sbjct: 180 FIENLVNWEHVEKMYAEA 197


>gi|223938774|ref|ZP_03630663.1| Superoxide dismutase [bacterium Ellin514]
 gi|223892625|gb|EEF59097.1| Superoxide dismutase [bacterium Ellin514]
          Length = 209

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 84/211 (39%), Positives = 111/211 (52%), Gaps = 13/211 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY  D L P++  +T+E HHD HH  Y +N  K  +    L     E +I  
Sbjct: 1   MAYELPPLPYPNDALEPHIDAKTMEIHHDKHHAAYVNNVNKAIAGKADLEKKSPEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN     NH+ FW  M    G      AL+D I   FGSF+ FK  L
Sbjct: 61  LSAVPEDIRGAVRNNGGGNVNHSFFWKLMGPKAGGTP-TGALADDIKATFGSFDAFKEKL 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYLD 169
             A   +FGSGW WL V NGKLEI+ T N +NP++          PILG+DVWEHAYYL 
Sbjct: 120 EAAGVGRFGSGWAWLIVNNGKLEIASTANQDNPIMGKAIAGCEGKPILGVDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAML 200
           ++ +R  Y+++F  N+VNW  V + YE A  
Sbjct: 180 YQNKRPDYLKAF-WNVVNWNEVAKNYEAAKK 209


>gi|150024270|ref|YP_001295096.1| superoxide dismutase [Flavobacterium psychrophilum JIP02/86]
 gi|149770811|emb|CAL42276.1| Superoxide dismutase [Mn] [Flavobacterium psychrophilum JIP02/86]
          Length = 201

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 91/203 (44%), Positives = 120/203 (59%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     +  ++   S+E+I+   
Sbjct: 1   MAFELPQLPYAYDALEPHIDARTMEIHHSKHHNAYTTNLNAAIAGTDLEGKSIEDILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + A + NN   ++NHNLFW  M  N G G     L+ AID NFG+F  FK+    A +
Sbjct: 61  DLTKAAVRNNGGGFFNHNLFWTVMSPN-GGGLPTGELAAAIDANFGTFADFKAAFAKAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           TQFGSGW WL VK GKLE+  T N +N L+     G  PILG+DVWEHAYYL ++ RR  
Sbjct: 120 TQFGSGWAWLCVKEGKLEVCGTPNQDNTLMPGVGCGGTPILGMDVWEHAYYLHYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YIE+F  N++NW  V  R+  A 
Sbjct: 180 YIEAFF-NVINWSEVARRFAEAK 201


>gi|307719114|ref|YP_003874646.1| superoxide dismutase Mn type [Spirochaeta thermophila DSM 6192]
 gi|306532839|gb|ADN02373.1| superoxide dismutase Mn type [Spirochaeta thermophila DSM 6192]
          Length = 206

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 112/207 (54%), Gaps = 8/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY YD L P++   T+E HH  HH  Y +N       A          ++++
Sbjct: 1   MSFTLPSLPYPYDALEPHIDARTMEIHHTKHHAGYVNNLNAALEKAPFAKDKDLVFLLRN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH+LFW  +    G      A+  AI   FGSF+ FK   
Sbjct: 61  LKSLPEEVQTAVRNNGGGHANHSLFWTVLSPEGGGTP-QGAVGKAIVSTFGSFDAFKEAF 119

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V   G L++  T N ++P ++G IPILG+DVWEHAYYL ++ RR
Sbjct: 120 TKAAATRFGSGWAWLVVNAYGTLQVYSTPNQDSPYLDGFIPILGLDVWEHAYYLSYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAMLA 201
             YI +F  N+VNWE V  RY   + A
Sbjct: 180 PDYIAAF-WNVVNWEEVERRYNETLEA 205


>gi|229543843|ref|ZP_04432902.1| Superoxide dismutase [Bacillus coagulans 36D1]
 gi|229324982|gb|EEN90658.1| Superoxide dismutase [Bacillus coagulans 36D1]
          Length = 202

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 93/204 (45%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L PY+ KET+  HH  HH  Y  N  K     + L     E +I  
Sbjct: 1   MTYTLPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNKALEGHDDLASKSVEDLISD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G      AL DAI+  FGSFEKFK   
Sbjct: 61  LNAVPEEIRTAVRNNGGGHANHSLFWTLLSPNGGGEP-KGALLDAINSKFGSFEKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N +NPL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGELEITSTPNQDNPLSEGKKPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V + YE A 
Sbjct: 180 EYISAF-WNVVNWDEVEKLYEAAK 202


>gi|154247247|ref|YP_001418205.1| superoxide dismutase [Xanthobacter autotrophicus Py2]
 gi|154161332|gb|ABS68548.1| Superoxide dismutase [Xanthobacter autotrophicus Py2]
          Length = 198

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 109/199 (54%), Positives = 137/199 (68%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L+PYMS+ETLEYHHD HH  Y +N   L    E    SLEEI+  S
Sbjct: 1   MSFTLPELPYAYDALAPYMSRETLEYHHDKHHLAYVNNGNNLLKGTEFEGKSLEEIVKGS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NA LFNNA Q+YNH  FW  MK N G G +P  +   I ++ GS EKFK D I A  
Sbjct: 61  FGKNAPLFNNAGQHYNHLHFWNWMKPN-GGGAIPGEIEKKIIEDIGSVEKFKEDFIAAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL++K+GKL + K+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 GQFGSGWAWLALKDGKLVVLKSPNGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNW+YV E Y  A+
Sbjct: 180 FVDHLVNWDYVAELYSKAV 198


>gi|307150139|ref|YP_003885523.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
 gi|306980367|gb|ADN12248.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
          Length = 199

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY Y  L PY+SK TLE+HHD HH  Y +N  K  +  E+  L +EE+I K 
Sbjct: 1   MAYELPVLPYDYTALEPYISKSTLEFHHDKHHAAYVNNFNKAVAGTELDSLPIEEVIKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNNA+Q +NH  +W  +K N G      A++D I+ +FGSFEKF  +   A
Sbjct: 61  AGDSSKTGVFNNAAQAWNHTFYWNSLKPNGGGTP-SGAIADKINADFGSFEKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ +R  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTPNADNPLTAGQVPLLTMDVWEHAYYLDYQNKRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           E+FI+ L+NWE+V +    A
Sbjct: 180 ETFISKLINWEFVNQNLAHA 199


>gi|157692997|ref|YP_001487459.1| manganese (Mn) superoxide dismutase SodA [Bacillus pumilus
           SAFR-032]
 gi|157681755|gb|ABV62899.1| manganese (Mn) superoxide dismutase SodA [Bacillus pumilus
           SAFR-032]
          Length = 202

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAFKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGVSALEDQSIEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI+   G FEKFKSD 
Sbjct: 61  LNSVPENIRTAVRNNGGGHANHSLFWTLLSPNGGGAP-TGELADAIEKELGGFEKFKSDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|194017668|ref|ZP_03056278.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Bacillus pumilus ATCC 7061]
 gi|194010568|gb|EDW20140.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Bacillus pumilus ATCC 7061]
          Length = 202

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 92/204 (45%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++ +
Sbjct: 1   MAFKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGVSALEDQSIEELVAN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH+LFW  +  N G       L+DAI+   G FEKFKSD 
Sbjct: 61  LNSVPENVRTAVRNNGGGHANHSLFWTLLSPNGGGAP-TGELADAIEKELGGFEKFKSDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|156332920|ref|XP_001619321.1| hypothetical protein NEMVEDRAFT_v1g231554 [Nematostella vectensis]
 gi|156202291|gb|EDO27221.1| predicted protein [Nematostella vectensis]
          Length = 202

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 91/201 (45%), Positives = 121/201 (60%), Gaps = 7/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y  N     S  ++   S+E I+I  
Sbjct: 1   MAFELPKLPYAYDALEPHIDARTMEIHHSKHHNGYTTNLNNAISGTDLEGKSIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   YYNHNLFW  M  N G       L+ AID  FGSFE FK++   AA+
Sbjct: 61  DLNNGAVRNNGGGYYNHNLFWTVMSPNGGGNP-TGELAAAIDAAFGSFEAFKTEFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GKLE+  + N +NPL+     G  PIL +DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKLEVCSSANQDNPLMPGIGCGGTPILALDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYE 196
            Y+E+F  N+++W  V  R+ 
Sbjct: 180 DYVEAFF-NVIDWTEVTRRFA 199


>gi|325111040|ref|YP_004272108.1| superoxide dismutase [Planctomyces brasiliensis DSM 5305]
 gi|324971308|gb|ADY62086.1| Superoxide dismutase [Planctomyces brasiliensis DSM 5305]
          Length = 203

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 119/205 (58%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP+LPY+YD L P++  +T+E HH  HH+ Y             L     E ++  
Sbjct: 1   MAYELPSLPYAYDALEPHIDAKTMEIHHSKHHQGYVTKVNAALEGHPELASKSIEDLMSD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  M  N G       ++DAI+  FGSF++FK+  
Sbjct: 61  LSSVPEDIRGAVRNNGGGHANHSLFWTIMSPNGGGTP-SGEVADAINKAFGSFDEFKTKF 119

Query: 116 ITAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL VK+ G++ +  T N + PL +G  PI+GIDVWEHAYYL+++ RR
Sbjct: 120 ADAAATRFGSGWAWLCVKSGGEVHVESTPNQDTPLSDGHTPIMGIDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             Y+ +F  N+++W+ V +RY+ A 
Sbjct: 180 PDYVSAF-WNVIDWDAVEKRYQAAK 203


>gi|291484948|dbj|BAI86023.1| superoxide dismutase [Bacillus subtilis subsp. natto BEST195]
          Length = 202

 Score =  214 bits (544), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL++ I   FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALAEEISSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|148242890|ref|YP_001228047.1| superoxide dismutase [Synechococcus sp. RCC307]
 gi|147851200|emb|CAK28694.1| Superoxide dismutase [Fe] [Synechococcus sp. RCC307]
          Length = 199

 Score =  214 bits (544), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 128/200 (64%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L P++S++TLE+HH  HH  Y +N  KL    ++   S+E+ I   
Sbjct: 1   MAHTLPVLPYALDALEPHISRQTLEFHHGKHHAGYVNNLNKLVEGTDLDGKSIEDTITAV 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G+   AG+FNNA+Q +NH+ +W C+K   G      AL+D I+ +FGSFEKF      A
Sbjct: 61  AGNAEKAGVFNNAAQVWNHSFYWQCIKPGGGGQP-TGALADKINADFGSFEKFIEAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V   +  A
Sbjct: 180 TTYLEKLVNWDFVAANFAAA 199


>gi|85715876|ref|ZP_01046854.1| manganese and iron superoxide dismutase [Nitrobacter sp. Nb-311A]
 gi|85697283|gb|EAQ35163.1| manganese and iron superoxide dismutase [Nitrobacter sp. Nb-311A]
          Length = 201

 Score =  214 bits (544), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 107/201 (53%), Positives = 139/201 (69%), Gaps = 2/201 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LPNLPY++D L+P+MSKETLEYHHD HH+ Y  N        E    SLE+I+  S
Sbjct: 1   MTFTLPNLPYAHDALAPHMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEDIVKSS 60

Query: 61  HGSN--AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +G +    +FNNA Q+YNH  FW  MK N G  K+P  L   I ++FG+ +KFK+D   A
Sbjct: 61  YGKSAAVAVFNNAGQHYNHLHFWNWMKPNGGGNKLPGRLEKKIIEDFGTLDKFKADFAAA 120

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            + QFGSGW WL VKNGKL +SKT NAENPLI+ A PILG DVWEH+YY+D++ RR  Y+
Sbjct: 121 GAGQFGSGWAWLQVKNGKLSVSKTPNAENPLIHNATPILGCDVWEHSYYIDYRNRRPDYL 180

Query: 179 ESFITNLVNWEYVCERYETAM 199
           ++F+ +LVNW+YV E +  A+
Sbjct: 181 KAFLDHLVNWDYVDELFSKAV 201


>gi|83593095|ref|YP_426847.1| superoxide dismutase [Rhodospirillum rubrum ATCC 11170]
 gi|83576009|gb|ABC22560.1| Superoxide dismutase [Rhodospirillum rubrum ATCC 11170]
          Length = 227

 Score =  213 bits (543), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 85/200 (42%), Positives = 114/200 (57%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LP++ + L P++S +T E+HH  HH  Y      L  D  +   SLE+II   
Sbjct: 29  MAFELPPLPFAKEALEPHISAKTFEFHHGKHHNAYVTTLNSLIKDTPLADKSLEDIITTV 88

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G      +FNNA+Q +NH  FW  +    G      A  +AID  FGS + FK     A
Sbjct: 89  AGDAAKTPVFNNAAQVWNHTFFWNSLSPTGGGQPTGAA-KEAIDGAFGSLDAFKEQFKQA 147

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL V  GKL I+KT NAE PL  G   +L  DVWEHAYYLD++ RR  ++
Sbjct: 148 GVTQFGSGWAWLVVDGGKLSIAKTPNAELPLTKGQTAVLTCDVWEHAYYLDYQNRRPDFL 207

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+ +LVNW+++      A
Sbjct: 208 QTFLDHLVNWDFLAANLAKA 227


>gi|126652200|ref|ZP_01724379.1| superoxide dismutase, Mn [Bacillus sp. B14905]
 gi|126590932|gb|EAZ85044.1| superoxide dismutase, Mn [Bacillus sp. B14905]
          Length = 201

 Score =  213 bits (543), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 109/203 (53%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP L Y+YD L P++  +T+E HH  HH  Y  N        E     + ++I   
Sbjct: 1   MAYELPQLTYAYDALEPHIDAKTMEIHHSKHHNTYVTNLNAAVEGTEFAEKDINDLIANL 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW  +            ++ AID  FGSF+ FK +  
Sbjct: 61  DALPADKQTAVRNNGGGHANHTLFWEVIAPGGSNTP-VGEVAKAIDAKFGSFDAFKEEFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+T+FGSGW WL V    + ++ T N ++P++ G  PILG+DVWEHAYYL+++ RR  
Sbjct: 120 KAATTRFGSGWAWLIVDGDSVAVTSTPNQDSPVMEGKKPILGLDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI  F  N+VNW+ V  +++ A 
Sbjct: 180 YIGGF-WNVVNWDVVEAKFQAAK 201


>gi|296123731|ref|YP_003631509.1| superoxide dismutase [Planctomyces limnophilus DSM 3776]
 gi|296016071|gb|ADG69310.1| Superoxide dismutase [Planctomyces limnophilus DSM 3776]
          Length = 205

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+   L P++  +T+E HH  HH+ Y +NA K       L     E +I  
Sbjct: 1   MPFTLPALPYAPAALEPHIDAQTMEIHHGKHHQAYINNANKALEGHPELAALTAEQLISD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                 G    + NNA  + NH+LFW  +  + G      AL  AI+  FG+F+ FK   
Sbjct: 61  LSKVPEGIRTVIRNNAGGHANHSLFWTVLAPSAGGTP-TGALEAAINHTFGTFDAFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WLSV +   L +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 NAAATTRFGSGWAWLSVDSKGGLVVESTPNQDSPLMEGRTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI SF  N+VNW  V +R+  A
Sbjct: 180 PDYIASF-WNIVNWPEVSKRFAAA 202


>gi|52081038|ref|YP_079829.1| superoxide dismutase [Bacillus licheniformis ATCC 14580]
 gi|52786415|ref|YP_092244.1| hypothetical protein BLi02679 [Bacillus licheniformis ATCC 14580]
 gi|319645004|ref|ZP_07999237.1| manganese superoxide dismutase [Bacillus sp. BT1B_CT2]
 gi|52004249|gb|AAU24191.1| superoxide dismutase [Bacillus licheniformis ATCC 14580]
 gi|52348917|gb|AAU41551.1| SodA [Bacillus licheniformis ATCC 14580]
 gi|114848848|gb|ABI83624.1| Mn-superoxide dismutase [Bacillus sp. 110-2]
 gi|317392813|gb|EFV73607.1| manganese superoxide dismutase [Bacillus sp. BT1B_CT2]
          Length = 202

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y     +  +  + L     E ++  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF++FK D 
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGGGAP-TGELAEAINSKFGSFDQFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+VNW+ V   Y  A 
Sbjct: 180 DYIKAF-WNVVNWDEVARLYSEAK 202


>gi|317969077|ref|ZP_07970467.1| superoxide dismutase [Synechococcus sp. CB0205]
          Length = 199

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 91/200 (45%), Positives = 125/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N   L +  ++   SLE+ I+  
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNNLVAGTDLEGKSLEDTIVAV 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G    AG+FNNA+Q +NH+ +W C+K N G      AL D I+ +FGSFEKF      A
Sbjct: 61  AGDAGKAGVFNNAAQVWNHSFYWQCIKPNGGGTP-SGALLDKINADFGSFEKFVEAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 STYLDKLVNWDFVAANLAAA 199


>gi|299135685|ref|ZP_07028869.1| Superoxide dismutase [Acidobacterium sp. MP5ACTX8]
 gi|298601809|gb|EFI57963.1| Superoxide dismutase [Acidobacterium sp. MP5ACTX8]
          Length = 203

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 107/205 (52%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y  L P + + T++ HHD HH+ Y  N          L     E +IK 
Sbjct: 1   MAFELPPLPYDYAALEPTIDEATMKLHHDKHHQTYVTNLNGAVEKHPDLGKKTPEELIKD 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH +FW  M  N G       ++  I  +FGSFE FK   
Sbjct: 61  LDSIPEDVRGVVRNNGGGHVNHTMFWQIMGPNGGGEP-TGEIAAQIKADFGSFEDFKKKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
               + QFGSGWGWL  K GKLEI  T N +NPL  G  PILG DVWEHAYYL ++ +R 
Sbjct: 120 NETTAKQFGSGWGWLVFKGGKLEIVTTANQDNPLSQGLYPILGNDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +   N++NW  V +R+E A  
Sbjct: 180 DYLAA-WWNVINWAEVNKRFEHAKK 203


>gi|221310426|ref|ZP_03592273.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221314749|ref|ZP_03596554.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319672|ref|ZP_03600966.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221323949|ref|ZP_03605243.1| superoxide dismutase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|255767567|ref|NP_390381.3| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|321311986|ref|YP_004204273.1| superoxide dismutase [Bacillus subtilis BSn5]
 gi|254763458|sp|P54375|SODM_BACSU RecName: Full=Superoxide dismutase [Mn]; AltName: Full=General
           stress protein 24; Short=GSP24
 gi|3355882|dbj|BAA31974.1| superoxide dismutase [Bacillus subtilis]
 gi|225185195|emb|CAB14432.3| superoxide dismutase [Bacillus subtilis subsp. subtilis str. 168]
 gi|320018260|gb|ADV93246.1| superoxide dismutase [Bacillus subtilis BSn5]
          Length = 202

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|121998934|ref|YP_001003721.1| superoxide dismutase [Halorhodospira halophila SL1]
 gi|121590339|gb|ABM62919.1| Superoxide dismutase [Halorhodospira halophila SL1]
          Length = 200

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 80/201 (39%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP+LPY Y DL   +  +T+E HH  HH  Y        S  E     LE+++ + 
Sbjct: 1   MAYQLPDLPYDYGDLERSIDAQTMEIHHTKHHNTYVTKLNDAVSGTEHDGQRLEDLLARV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH+LFW  M  N G GK    L+ AID  FGSF++F+     AA 
Sbjct: 61  SNLPVAIRNNGGGHWNHDLFWRVMSPN-GGGKPSGDLAAAIDSAFGSFDQFREQFTQAAL 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
            +FGSGW WL   +  LEI+ T N +NPL++       P+LG+DVWEHAYYL ++ RR  
Sbjct: 120 GRFGSGWAWLIKTSRGLEITDTPNQDNPLMDVAPKQGTPLLGLDVWEHAYYLRYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYET 197
           Y+E+   ++VNW+ V +R+E 
Sbjct: 180 YVEA-WWDVVNWDEVTKRFEA 199


>gi|329575058|gb|EGG56610.1| superoxide dismutase, Mn [Enterococcus faecalis TX1467]
          Length = 202

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+  TN+VNW+ V E +  A 
Sbjct: 180 DYIEA-WTNVVNWDKVNELFAAAK 202


>gi|75675106|ref|YP_317527.1| manganese and iron superoxide dismutase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419976|gb|ABA04175.1| manganese and iron superoxide dismutase [Nitrobacter winogradskyi
           Nb-255]
          Length = 201

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 111/199 (55%), Positives = 139/199 (69%), Gaps = 2/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LPNLPYS+D L+P+MSKETLEYHHD HH+ Y  N        E    SLE+I+  S
Sbjct: 1   MTFTLPNLPYSHDALAPHMSKETLEYHHDKHHQAYVTNGNNAIKGTEFEGKSLEDIVRSS 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +G +A +  FNNA Q+YNH  FW  MK N G  K+P  L   I ++FGS EKFK+D   A
Sbjct: 61  YGKSASVGVFNNAGQHYNHLHFWNWMKPNGGGDKLPGRLEKKIIEDFGSLEKFKADFAAA 120

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            + QFGSGW WL VKNGKLE+SKT NAENPLI+ A PILG DVWEH+YY+D++ RR  Y+
Sbjct: 121 GAGQFGSGWAWLQVKNGKLEVSKTPNAENPLIHNATPILGCDVWEHSYYIDYRNRRPDYL 180

Query: 179 ESFITNLVNWEYVCERYET 197
           ++F+ +LVNW+YV + Y  
Sbjct: 181 KAFLDHLVNWDYVDQLYSK 199


>gi|163858403|ref|YP_001632701.1| putative superoxide dismutase [Bordetella petrii DSM 12804]
 gi|163262131|emb|CAP44433.1| putative superoxide dismutase [Bordetella petrii]
          Length = 255

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 113/206 (54%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P++   T+E H+  HH+ Y +N       A +      + ++  
Sbjct: 52  MPYVLPELPYAYDALEPHIDALTMEIHYTKHHQTYINNLNAALEGAGLPSDEPVDALVAR 111

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             +        + NN   + NH+LFW  M    G GK    L+ AID + G  + F+   
Sbjct: 112 IDTLPEPVRGAVRNNGGGHANHSLFWTVMSP-QGGGKPQGRLAAAIDADLGGLDAFRDAF 170

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FGSGW WLSV   GKL +  T N ++PL+ G  P+LG+DVWEHAYYL ++ RR
Sbjct: 171 TKAALTRFGSGWAWLSVTSQGKLVVESTANQDSPLMQGNTPVLGLDVWEHAYYLKYQNRR 230

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N+++W  V  RY++A  
Sbjct: 231 PEYISAFF-NVIDWVEVSRRYDSAKA 255


>gi|318042181|ref|ZP_07974137.1| superoxide dismutase [Synechococcus sp. CB0101]
          Length = 199

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 91/200 (45%), Positives = 125/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  D L P++S++TLE+HH  HH  Y  N   L +  ++   SLE+ I   
Sbjct: 1   MAHTLPALPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNNLVAGTDLDGKSLEDTITAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W C+K   G      AL D I+ +FGSFEKF  +   A
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCIKPGGGGTP-SGALLDKINADFGSFEKFVEEFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLDKLVNWDFVAANLAAA 199


>gi|51892185|ref|YP_074876.1| superoxide dismutase [Symbiobacterium thermophilum IAM 14863]
 gi|51855874|dbj|BAD40032.1| superoxide dismutase [Symbiobacterium thermophilum IAM 14863]
          Length = 204

 Score =  213 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 81/206 (39%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY  + L PY+  +T+E HH  HH  Y +N          L     E +++ 
Sbjct: 1   MAFQLPALPYPTNALEPYIDAQTMEIHHGKHHAAYVNNLNAALEGHPELQSKSIEELLRG 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH L+W  M     K      L++AI+  FGSF+ FK + 
Sbjct: 61  IDSVPESIRTAVRNNGGGHANHTLYWEIMTPGGAKEP-GGELAEAINAAFGSFQNFKDEF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + +FGSGW WL V K+GKL +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 AKAGAGRFGSGWAWLVVTKDGKLAVYSTANQDSPLMQGDTPILGMDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI++F+ N++NW+ V ERY  A  
Sbjct: 180 PEYIQAFM-NVINWDKVAERYAAARK 204


>gi|313608781|gb|EFR84591.1| superoxide dismutase, Mn [Listeria monocytogenes FSL F2-208]
          Length = 202

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FGSF++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAP-TGELKSAIESEFGSFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|315641230|ref|ZP_07896307.1| superoxide dismutase [Enterococcus italicus DSM 15952]
 gi|315482997|gb|EFU73516.1| superoxide dismutase [Enterococcus italicus DSM 15952]
          Length = 202

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I S
Sbjct: 1   MTYTLPDLPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAVEKHPELAEKSVEELISS 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +  N G       L  AID+ FGSF+  K++ 
Sbjct: 61  MSTVPEDIQTAVRNNGGGHANHSFFWEILAPNAGGEP-TGDLKAAIDETFGSFDDLKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL + NG L+++ T N ++PL+ G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVLDNGTLKVTSTANQDSPLMEGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  NLVNWE   E +  A 
Sbjct: 180 DYIEAF-WNLVNWEKANEIFSAAK 202


>gi|116620199|ref|YP_822355.1| superoxide dismutase [Candidatus Solibacter usitatus Ellin6076]
 gi|116223361|gb|ABJ82070.1| Superoxide dismutase [Candidatus Solibacter usitatus Ellin6076]
          Length = 202

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P++ K T+E HH  HH  Y  N  K    A  L     E ++ +
Sbjct: 1   MPFTLPPLPYAPDALEPHIDKMTMEIHHGKHHNAYVTNLNKALESAPELADKNIEELLAN 60

Query: 61  HG------SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
           +           + NN   + NH++FW  M  N G   V   ++ AI   FGSF+ FK  
Sbjct: 61  NCAIVPEKIRTAVRNNGGGHINHSMFWKIMGPNGGGAPVGN-VAQAITGAFGSFDAFKEK 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A   +FGSGW WL   +  +EI+ T N ++P++ G +P+ G DVWEHAYYL ++ RR
Sbjct: 120 FNAAGVGRFGSGWAWLLKTSSGVEITSTANQDSPIMEGKVPVFGCDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYET 197
             Y+ +   N+VNW+ + +R+  
Sbjct: 180 PDYLAA-WWNVVNWKEIEDRFNA 201


>gi|226310606|ref|YP_002770500.1| superoxide dismutase [Mn] [Brevibacillus brevis NBRC 100599]
 gi|226093554|dbj|BAH41996.1| superoxide dismutase [Mn] [Brevibacillus brevis NBRC 100599]
          Length = 202

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+++ L P++  +T+E HH  HH  Y +N          L     E +I  
Sbjct: 1   MAHQLPALPYAHNALEPHIDAQTMEIHHGRHHATYVNNLNAALEAHADLQGKSIEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  M  N G       L+DAI+  FGSF+ FK++ 
Sbjct: 61  LDALPESIRTAVRNNGGGHANHTLFWEIMSPNGGGAP-TGELADAINAAFGSFDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL+ + GK+ IS T N ++P++ G  PILG+DVWEHAYYL+++ +R 
Sbjct: 120 AKAATTRFGSGWAWLTAEGGKVAISSTPNQDSPIMEGKTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +R+  A 
Sbjct: 180 DYIGAF-WNVVNWDEVSKRFAAAK 202


>gi|296333339|ref|ZP_06875792.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675156|ref|YP_003866828.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296149537|gb|EFG90433.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413400|gb|ADM38519.1| superoxide dismutase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 202

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL+D I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALADDINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V   Y  A 
Sbjct: 180 DYISAF-WNVVNWDEVARLYSEAK 202


>gi|323479601|gb|ADX79040.1| superoxide dismutase (Mn) [Enterococcus faecalis 62]
          Length = 202

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWEIMASNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NG LEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGNLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N+VNW+ V E +  A 
Sbjct: 180 DYIEAF-WNVVNWDKVNELFAAAK 202


>gi|223043219|ref|ZP_03613266.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus capitis SK14]
 gi|242373858|ref|ZP_04819432.1| superoxide dismutase [Staphylococcus epidermidis M23864:W1]
 gi|222443430|gb|EEE49528.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus capitis SK14]
 gi|242348412|gb|EES40014.1| superoxide dismutase [Staphylococcus epidermidis M23864:W1]
          Length = 199

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N    +    + D I + +GS ++FK +  
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLSPNS---EEKGEVVDKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y+ A 
Sbjct: 178 YISAF-WNVVNWEKVDELYKAAK 199


>gi|313677069|ref|YP_004055065.1| manganese/iron superoxide dismutase [Marivirga tractuosa DSM 4126]
 gi|312943767|gb|ADR22957.1| Manganese/iron superoxide dismutase [Marivirga tractuosa DSM 4126]
          Length = 201

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/202 (43%), Positives = 126/202 (62%), Gaps = 8/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++  +T+E HH  HH  Y           +M   SL E ++K+
Sbjct: 1   MAFELPALPYAKDALEPHIDAKTMEIHHGKHHNGYVTKLNGAVEGTDMEGKSL-EELLKN 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +  N  + NN   +YNH+LFW  M   DG G+   AL+DAI+  +GSF+KFK +   AA+
Sbjct: 60  NSDNKAVRNNGGGHYNHSLFWTVMSP-DGGGEPSGALADAINAAYGSFDKFKEEFSNAAA 118

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V + GK+E+  + N +NP++        PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCVHSGGKVEVCSSPNQDNPIMPNVGCGGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N++NW+ V +RYE 
Sbjct: 179 DYISAFF-NVINWDEVSKRYEA 199


>gi|1303851|dbj|BAA12507.1| YqgD [Bacillus subtilis]
          Length = 226

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 86/200 (43%), Positives = 113/200 (56%), Gaps = 7/200 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERY 195
            YI +F  N+VNW+ V   Y
Sbjct: 180 DYISAF-WNVVNWDEVARLY 198


>gi|317128360|ref|YP_004094642.1| Manganese/iron superoxide dismutase-like protein [Bacillus
           cellulosilyticus DSM 2522]
 gi|315473308|gb|ADU29911.1| Manganese/iron superoxide dismutase-like protein [Bacillus
           cellulosilyticus DSM 2522]
          Length = 202

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M F LP LPY++D L+P++ +ET++ HH  HH  Y           +++   SLEE++  
Sbjct: 1   MAFTLPELPYAHDALTPHIDEETMKIHHGKHHNTYVTKLNDALEGHSDLQGKSLEELLSN 60

Query: 60  SHGSNAGLF----NNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                  +     NN   ++NH LFW  M  N G       L+DAI+  FGSF+KFK + 
Sbjct: 61  LDALPESIHGAVRNNGGGHFNHTLFWEIMSPNGGGEP-TGELADAINSAFGSFDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V  GKL ++ T N + P++ G   ILG+DVWEHAYYL ++  R 
Sbjct: 120 KNAALTRFGSGWAWLVVDGGKLTVTSTPNQDTPIMEGKTAILGVDVWEHAYYLKYQNLRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
           +Y+++F  N+VNWE V +R+  A 
Sbjct: 180 NYVDAFF-NVVNWEEVAKRFSAAK 202


>gi|163790995|ref|ZP_02185417.1| superoxide dismutase, Mn [Carnobacterium sp. AT7]
 gi|159873734|gb|EDP67816.1| superoxide dismutase, Mn [Carnobacterium sp. AT7]
          Length = 202

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ + T+E+HHD HH  Y +           L     E ++  
Sbjct: 1   MTYELPKLPYAYDALEPHIDQATMEFHHDKHHATYVEKTNAALEKYPELAEKTIEELVTD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +  N G      AL + ID  FGSF+K K  +
Sbjct: 61  LNSVPEEIRTAIRNNGGGHANHSFFWEILSPNGGGEP-TGALKEDIDATFGSFDKVKEAI 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TA + QFGSGW WL + NGKLE++ T N ++PL +G  P+ G+DVWEHAYYL+++ +R 
Sbjct: 120 ETAGAGQFGSGWAWLVLNNGKLEVTATANQDSPLTDGKTPLFGVDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++ + N+VNWE V +RYE A 
Sbjct: 180 AYLKA-VWNVVNWEEVAKRYEAAK 202


>gi|328544593|ref|YP_004304702.1| Superoxide dismutase [polymorphum gilvum SL003B-26A1]
 gi|326414335|gb|ADZ71398.1| Superoxide dismutase [Polymorphum gilvum SL003B-26A1]
          Length = 199

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 111/198 (56%), Positives = 143/198 (72%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L PYMS ETLEYHHD HH  Y  N   L  D+ +   S+EE++ +S
Sbjct: 1   MSFQLPDLPYAYDALGPYMSAETLEYHHDKHHLAYVSNGNNLLKDSGLEGKSVEEVVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA Q+YNH  FW  MK N G  K+P AL+  ID + G ++KF++D I A  
Sbjct: 61  FGKNPGLFNNAGQHYNHIHFWKWMKPNGGGTKLPGALASKIDSDLGGYDKFRADFINAGI 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL++K+GKL I KT N ENPL++GA P+LG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWLALKDGKLAIMKTPNGENPLVHGAAPLLGVDVWEHSYYIDYRNLRPKYLEA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLVNW+YV E YE A
Sbjct: 181 FVDNLVNWDYVLEMYEAA 198


>gi|298249536|ref|ZP_06973340.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
 gi|297547540|gb|EFH81407.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
          Length = 204

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 80/203 (39%), Positives = 115/203 (56%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY Y  L PY+  +T++ HHD HH  Y  N        E   L++E+++ + 
Sbjct: 1   MAFQLPPLPYDYQALEPYIDTQTMQIHHDKHHATYVSNLNAALEGHEFASLAVEQVLARL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW  M     K      L+ AI   FGSF+ FK+   
Sbjct: 61  NEVPEAKRTAVRNNGGGHANHTLFWETMTPGGSKEPTGT-LAQAITSTFGSFDAFKAAFN 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A + +FGSGW WL + KNG+LE++ T N ++PL++  +P+LG DVWEHAYYL ++ RR 
Sbjct: 120 DAGAKRFGSGWAWLVLNKNGQLEVTSTPNQDSPLLDSNVPLLGNDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+ +   N+VNW+ V  R+E A
Sbjct: 180 EYLSA-WWNVVNWDIVGRRFEQA 201


>gi|298207220|ref|YP_003715399.1| superoxide dismutase [Croceibacter atlanticus HTCC2559]
 gi|83849856|gb|EAP87724.1| superoxide dismutase [Croceibacter atlanticus HTCC2559]
          Length = 202

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 83/202 (41%), Positives = 120/202 (59%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++ ++T+  HH  HH+ Y +         ++   ++E I+   
Sbjct: 1   MSFELPKLKYAHDALEPHIDEKTMTIHHGKHHQGYTNKLNAAIEGTDLEGKTIENILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   ++NH LFW  M   DG GK    L++AID  FGSFE FK +  + A 
Sbjct: 61  EMSNTAVRNNGGGFFNHRLFWEVMSP-DGGGKPTGELAEAIDAKFGSFEAFKDEFSSQAG 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V+  GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVQEGGKVEVCSTANQDNPLMPGIGCGGYPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N+++W  V +RY  
Sbjct: 180 DYVNAFF-NVIDWTEVSKRYAE 200


>gi|308188788|ref|YP_003932919.1| superoxide dismutase, manganese [Pantoea vagans C9-1]
 gi|308059298|gb|ADO11470.1| superoxide dismutase, manganese [Pantoea vagans C9-1]
          Length = 205

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 120/209 (57%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L ++E+I K 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFANLPVDELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ +  
Sbjct: 61  DQLPADKKGPLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIEKDFGSVEKFQEEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N +NPL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAAATRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAVAGVSGFPIIGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  N+VNW+    R+ +A 
Sbjct: 178 QNKRPDYIKAF-WNVVNWDEAAARFASAK 205


>gi|149504973|ref|XP_001519389.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 312

 Score =  212 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 98/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 116 HTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEERYKEALAKG--DVTTQVA 173

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSFEKFK  L   +   
Sbjct: 174 LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELLEAIKRDFGSFEKFKEKLTAVSVGV 232

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       +L ++   N +      G +P+LGIDVWEHAYYL +K  R  Y++
Sbjct: 233 QGSGWGWLGFDQEQGRLRVAACSNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYLK 292

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+++WE V ERY+    
Sbjct: 293 A-IWNVISWENVTERYQACKK 312


>gi|317121027|ref|YP_004101030.1| Manganese/iron superoxide dismutase [Thermaerobacter marianensis
           DSM 12885]
 gi|315591007|gb|ADU50303.1| Manganese/iron superoxide dismutase [Thermaerobacter marianensis
           DSM 12885]
          Length = 204

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 111/205 (54%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY Y+ L P++ ++T+  HHD HH  Y +N          L     E +++ 
Sbjct: 1   MAYQLPPLPYDYNALEPHIDEQTMRIHHDRHHATYVNNVNAALEKYPALQNKPIEELLRQ 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  M    G      AL++AI+ +FGSF+ FK   
Sbjct: 61  IDQVPEDIRTAVRNNGGGHANHSLFWEIMSPRGGGQP-SGALAEAINRSFGSFDAFKDQF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A+T FGSGW WL V    +L++    N ++P + G  PILG+DVWEHAYYL ++ +R
Sbjct: 120 TKTATTHFGSGWAWLVVDEKGELQVYSLPNQDSPYMKGHTPILGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +   N+VNW+ V  RY+ A 
Sbjct: 180 PDYIAA-WWNVVNWDEVARRYQQAR 203


>gi|120437698|ref|YP_863384.1| superoxide dismutase [Mn] [Gramella forsetii KT0803]
 gi|117579848|emb|CAL68317.1| superoxide dismutase [Mn] [Gramella forsetii KT0803]
          Length = 202

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y           +M   ++E I+   
Sbjct: 1   MSFELPKLKYAFDALEPHIDAKTMEIHHGKHHAGYTKKLNAAIEGTDMDGKNIENILKNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH+LFW  M   DG GK    L+ AID  +GSFE FK +   AA+
Sbjct: 61  DKSNKAVRNNGGGFYNHSLFWEIMSP-DGGGKPEGELASAIDAAYGSFEAFKEEFSKAAA 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V N GK+E+  T N +NPL+        PILG+DVWEHAYYL+++ +R 
Sbjct: 120 GQFGSGWAWLCVHNGGKVEVCSTPNQDNPLMPEVGCGGAPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+++W+ V  RY  A 
Sbjct: 180 EYIDAFF-NVIDWKEVSSRYAKAK 202


>gi|125616872|gb|ABN46889.1| manganese superoxide dismutase [Bacillus subtilis subsp. natto]
          Length = 202

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 86/202 (42%), Positives = 112/202 (55%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL++ I   FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALAEEISSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N+VNW+ V   Y  
Sbjct: 180 DYISAF-WNVVNWDEVARLYSE 200


>gi|90109118|pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109119|pdb|2CDY|B Chain B, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109120|pdb|2CDY|C Chain C, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109121|pdb|2CDY|D Chain D, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109137|pdb|2CE4|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
 gi|90109138|pdb|2CE4|B Chain B, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus
           Radiodurans
          Length = 231

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 122/211 (57%), Gaps = 14/211 (6%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I +  
Sbjct: 22  AYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLD 81

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ---ALSDAIDDNFGSFEKFKSD 114
                    L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK  
Sbjct: 82  RVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQK 141

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYL 168
              AA T+FGSGW WL VK+GKL++  T N +NPL+          PILG+DVWEHAYYL
Sbjct: 142 FEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYYL 201

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           +++ RR  Y+ +F  N+VNW+ V +RY  A 
Sbjct: 202 NYQNRRPDYLAAF-WNVVNWDEVSKRYAAAK 231


>gi|56963480|ref|YP_175211.1| manganese superoxide dismutase [Bacillus clausii KSM-K16]
 gi|56909723|dbj|BAD64250.1| manganese superoxide dismutase [Bacillus clausii KSM-K16]
          Length = 202

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+ + L P++ + T+  HH  HH  Y  N          L     E ++  
Sbjct: 1   MAYKLPELPYAANALEPHIDEATMNIHHGKHHNTYVTNLNAALEGHAALAEKSIEDLVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  +  N G      AL++ I   FGS E+FK+  
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHTFFWQILSPNGGGEP-TGALAEDIKSTFGSVEEFKNKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA  +FGSGW WL V NG LEI+ T N + PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 ADAAKGRFGSGWAWLVVNNGNLEITSTPNQDTPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +RYE A 
Sbjct: 180 DYIAAF-WNVVNWDEVSKRYEAAK 202


>gi|114705427|ref|ZP_01438335.1| probable superoxide dismutase fe protein [Fulvimarina pelagi
           HTCC2506]
 gi|114540212|gb|EAU43332.1| probable superoxide dismutase fe protein [Fulvimarina pelagi
           HTCC2506]
          Length = 200

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 109/198 (55%), Positives = 141/198 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY+YD L PYMS ETLEYHHD HH  Y     +LA +A M   S+EE++  S
Sbjct: 1   MAFELPDLPYAYDALGPYMSAETLEYHHDKHHNAYVTKGNELAKEAGMDGKSVEEVVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HGSN  LFNNA+Q+YNH  FW  MK N G   +P +L  A D + G ++KFK+D   A +
Sbjct: 61  HGSNQPLFNNAAQHYNHIHFWKWMKPNGGGKNLPGSLKTAFDRDLGGYDKFKADFEAAGA 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++V+NGKLEI KT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+ +
Sbjct: 121 GQFGSGWAWVAVENGKLEIMKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLSA 180

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWE+V E Y  A
Sbjct: 181 FVDNLINWEHVEEMYRQA 198


>gi|296445863|ref|ZP_06887815.1| Superoxide dismutase [Methylosinus trichosporium OB3b]
 gi|296256691|gb|EFH03766.1| Superoxide dismutase [Methylosinus trichosporium OB3b]
          Length = 199

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 1/200 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+YD L PY+SKE+ EYHHD HH  Y  NA  L    E     +EE+I+ S
Sbjct: 1   MSFTLPDLPYAYDALQPYLSKESFEYHHDKHHATYVTNANNLVKGTEFEGKPIEEVIVAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  +FNN +Q YNH+ +W  +K N G G +P  +  AI ++FGS +KFK +  T   
Sbjct: 61  YGKNVPVFNNVAQIYNHSEYWKWLKPN-GGGALPAKVEKAIVESFGSVDKFKEEFQTQGL 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL VK+GKL + KT NAENPL+ GA P+L  DVWEHAYY+D++ RRA ++++
Sbjct: 120 GQFGSGWVWLEVKDGKLAVRKTPNAENPLVFGAKPLLVADVWEHAYYIDYRNRRADFLKA 179

Query: 181 FITNLVNWEYVCERYETAML 200
           F+ +LVNWEYV E YE A  
Sbjct: 180 FLEHLVNWEYVEECYEAATK 199


>gi|291615660|ref|YP_003518402.1| SodA [Pantoea ananatis LMG 20103]
 gi|291150690|gb|ADD75274.1| SodA [Pantoea ananatis LMG 20103]
          Length = 210

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 119/209 (56%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E   L ++E+I K 
Sbjct: 6   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFADLPVDELITKL 65

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ +  
Sbjct: 66  DQLPADKKGPLRNNAGGHANHSLFWKGLKT---GTTLQGELKAAIEKDFGSVEKFQEEFE 122

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N +NPL+          PI+G+DVWEHAYYL +
Sbjct: 123 KAATTRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAVAGVSGYPIIGLDVWEHAYYLKY 182

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  N+VNW+    R+ +A 
Sbjct: 183 QNKRPDYIKAF-WNVVNWDEAAARFASAK 210


>gi|327402915|ref|YP_004343753.1| Manganese/iron superoxide dismutase [Fluviicola taffensis DSM
           16823]
 gi|327318423|gb|AEA42915.1| Manganese/iron superoxide dismutase [Fluviicola taffensis DSM
           16823]
          Length = 199

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 82/202 (40%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E H+  HH+ YA N     +  +M   S  E I+++
Sbjct: 1   MAFELPKLGYAYDALEPHIDARTMEIHYTKHHQAYATNLNNAIAGTDMEGKS-IEYILQN 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NHNLFW  M  N G       L+ AI+D FG+FE FK +   A +
Sbjct: 60  CKDKPAVRNNGGGFWNHNLFWEVMAPNAGGTP-TGELAQAINDAFGTFEHFKEEFSKAGA 118

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI---PILGIDVWEHAYYLDFKYRRAHY 177
           T+FGSGW WL V+ GKL +  T N +NPL+       PIL +DVWEHAYYL+++ RR  Y
Sbjct: 119 TRFGSGWAWLCVEGGKLVVCSTANQDNPLMGEGCKGTPILAMDVWEHAYYLNYQNRRPDY 178

Query: 178 IESFITNLVNWEYVCERYETAM 199
           + +F  N++NW+ V +++  A 
Sbjct: 179 MNAFF-NVINWDVVAKKFAAAK 199


>gi|326798487|ref|YP_004316306.1| superoxide dismutase [Sphingobacterium sp. 21]
 gi|326549251|gb|ADZ77636.1| Superoxide dismutase [Sphingobacterium sp. 21]
          Length = 203

 Score =  211 bits (538), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 122/205 (59%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P++ KET+E HH  HH+ Y DN  K  +  +   LS+EEII   
Sbjct: 1   MAFSLPALPYASDALEPHIDKETMEIHHGKHHQAYVDNLNKAIAGTDAESLSIEEIIKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   +YNH+LFW  +   D +      L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYPAAVRNNGGGHYNHSLFWTILSP-DAQTTPSGELATAIDETFGSFDELKKKLQDAGA 119

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V    KL+++ T N ++PL++       PILGIDVWEHAYYL ++ +R 
Sbjct: 120 TRFGSGWSWLVVDASGKLQVTSTPNQDSPLMDVAEVKGTPILGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+E+   N++ W+ V ERY  A  
Sbjct: 180 AYLEAIF-NVICWKSVGERYANAKK 203


>gi|148240078|ref|YP_001225465.1| superoxide dismutase [Synechococcus sp. WH 7803]
 gi|147848617|emb|CAK24168.1| Superoxide dismutase [Fe] [Synechococcus sp. WH 7803]
          Length = 199

 Score =  211 bits (538), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I   
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVISAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL D I+ +FGS++ F      A
Sbjct: 61  SGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-SGALLDKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL V+NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLIVENGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|295696984|ref|YP_003590222.1| Superoxide dismutase [Bacillus tusciae DSM 2912]
 gi|295412586|gb|ADG07078.1| Superoxide dismutase [Bacillus tusciae DSM 2912]
          Length = 204

 Score =  211 bits (538), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 82/206 (39%), Positives = 116/206 (56%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+++ L PY+   T+E HHD HH  Y +N          L     E +++ 
Sbjct: 1   MAHQLPPLPYAFNALEPYIDALTMEIHHDRHHGTYVNNLNAALEGHPDLEAKSIEDLLRG 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH++FW  MK   G      AL+DAI+  FGSF+ FK   
Sbjct: 61  INSVPENIRTAVRNNGGGHANHSMFWQIMKPGGGGQP-TGALADAINSTFGSFDSFKDQF 119

Query: 116 ITAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+ +FGSGW WL +K  GKLEI+ T N ++P ++G  PILG+DVWEHAYYL ++ +R
Sbjct: 120 SKAAAGRFGSGWAWLVMKPGGKLEITSTPNQDSPYMDGDYPILGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +   N+VNW+ V +R+  A  
Sbjct: 180 PEYIAA-WWNVVNWDAVAKRFAEAKA 204


>gi|325286155|ref|YP_004261945.1| Superoxide dismutase [Cellulophaga lytica DSM 7489]
 gi|324321609|gb|ADY29074.1| Superoxide dismutase [Cellulophaga lytica DSM 7489]
          Length = 225

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 88/202 (43%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++   T+E HH  HH  Y           ++    +E+I+   
Sbjct: 24  MAFELPKLPYAYDALEPHIDARTMEIHHTKHHNGYTTKLNGAIEGTDLAGKPIEDILTNL 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH+LFW  M  N G       L+ AI+D +GSF+ FK    TAA+
Sbjct: 84  DMSNGAVRNNGGGFYNHSLFWEVMSPNGGGEP-TGELATAINDAYGSFDAFKEAFSTAAA 142

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  + N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 143 TRFGSGWAWLCVHKGGKVEVCSSPNQDNPLMPGVGCGGFPILGLDVWEHAYYLNYQNRRP 202

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI  F  N++NWE V E Y +
Sbjct: 203 DYIGGFF-NVINWEKVSELYAS 223


>gi|258510972|ref|YP_003184406.1| Superoxide dismutase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477698|gb|ACV58017.1| Superoxide dismutase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 204

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 82/206 (39%), Positives = 112/206 (54%), Gaps = 7/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+YD L P++   T+  H++ HH  Y +N  K       L     E +I  
Sbjct: 1   MPHQLPPLPYAYDALEPHIDAATMNVHYNGHHAAYVNNLNKALEGHPDLESKTVEQLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI + FGSFE FK   
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWPLLSPNGGGEP-TGKLADAIRETFGSFEAFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL + NGKL +  T N +NPL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TQVATARFGSGWAWLVLDNGKLALMSTANQDNPLMEGKKPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            YI++   N+VNW+   + YE A+  
Sbjct: 180 EYIKA-WWNVVNWDQANKNYEAALNG 204


>gi|218289796|ref|ZP_03493996.1| Superoxide dismutase [Alicyclobacillus acidocaldarius LAA1]
 gi|218240087|gb|EED07272.1| Superoxide dismutase [Alicyclobacillus acidocaldarius LAA1]
          Length = 204

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 112/206 (54%), Gaps = 7/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+YD L P++   T+  H++ HH  Y +N  K       L     E +I  
Sbjct: 1   MPHQLPPLPYAYDALEPHIDAATMNVHYNGHHAAYVNNLNKALEGHPDLESKTVEQLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI D FGSFE FK   
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWPLLSPNGGGEP-TGKLADAIRDTFGSFEAFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ +FGSGW WL + NGKL +  T N +NPL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TQVATARFGSGWAWLVLDNGKLALMSTANQDNPLMEGKKPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            YI++   N+VNW+   + YE A+  
Sbjct: 180 EYIKA-WWNVVNWDQANKNYEAALNG 204


>gi|254420417|ref|ZP_05034141.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Brevundimonas sp. BAL3]
 gi|196186594|gb|EDX81570.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Brevundimonas sp. BAL3]
          Length = 203

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 123/204 (60%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLA-SDAEMLHLSLEEIIIK 59
           M F LP LPY+YD L P + KET+ +HHD HH+ Y DN  K   + A++   SLEEI   
Sbjct: 1   MAFTLPPLPYAYDALEPAIDKETMTFHHDKHHQTYVDNLNKAIDAAADLQGKSLEEIFTS 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              +   + NN   ++NH+LFW  +   D  G+    L  AID + G  +KFK D   A 
Sbjct: 61  ISTAPKAVRNNGGGHWNHSLFWELLAPADQTGEPSAELKAAIDSDLGGMDKFKEDFNAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           + QFGSGW WL V+NGKL+I+ T N +NPL++        +LG DVWEHAYYL ++ RRA
Sbjct: 121 AAQFGSGWAWLIVQNGKLKITSTPNQDNPLMDVVEERGEVVLGADVWEHAYYLKYQNRRA 180

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y++SF  ++VNW  V E Y  A+
Sbjct: 181 DYLKSF-WSVVNWNKVNELYAAAV 203


>gi|75529095|sp|Q8VQ15|SODM_STAEP RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|18378721|gb|AAL68691.1|AF462457_1 superoxide dismutase [Staphylococcus epidermidis]
          Length = 199

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 83/203 (40%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY++D L P++ KET+E HHD HH  Y      +    ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAFDALEPHIDKETMEIHHDKHHNTYVTKLNAVVEGTDLEAKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N    +    + + I + +GS ++FK +  
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLTPNS---EEKGEVVEKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y  A 
Sbjct: 178 YISAF-WNVVNWEKVDELYNAAK 199


>gi|149278272|ref|ZP_01884410.1| superoxide dismutase, manganese [Pedobacter sp. BAL39]
 gi|149231038|gb|EDM36419.1| superoxide dismutase, manganese [Pedobacter sp. BAL39]
          Length = 219

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ K T+E HH  HH+ Y  N  K          S+E+I+   
Sbjct: 19  MAFELPALPYATDALEPHIDKLTMEIHHGKHHQAYVTNLNKALEGKPEATQSIEDIVKNI 78

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH+LFW  +  N G       L++AI+  FGSF  FK+    A +
Sbjct: 79  SKFPAAVRNNGGGHFNHSLFWEVLAPNKGGEP-KGELAEAINAAFGSFADFKTKFADAGA 137

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V  + KL ++ T N +NPL++       PILG+DVWEHAYYL ++ +R 
Sbjct: 138 TRFGSGWAWLIVTADHKLAVTSTPNQDNPLMDIAEVKGTPILGMDVWEHAYYLKYQNKRP 197

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+VNW+ V ER++ A
Sbjct: 198 DYIAAF-WNVVNWDAVAERFKKA 219


>gi|315122318|ref|YP_004062807.1| superoxide dismutase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495720|gb|ADR52319.1| superoxide dismutase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 206

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 163/205 (79%), Positives = 181/205 (88%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD LSPYMS ETL+YHH VHHK YADNALKLASDAEMLH  LEEIIIKS
Sbjct: 1   MAFELPNLPYDYDALSPYMSPETLKYHHGVHHKTYADNALKLASDAEMLHSPLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +GSNAGLFNNASQYYNHNLFW CMKKN G  K+PQ LSDAI+ NFGS+EKFKSD ITAA 
Sbjct: 61  YGSNAGLFNNASQYYNHNLFWLCMKKNGGGEKIPQVLSDAINSNFGSYEKFKSDFITAAC 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQF SGW WLSVKNGKLEISKTQNAENPLINGA PILGIDVWEHAYYLDF+Y+R+ Y+E+
Sbjct: 121 TQFASGWTWLSVKNGKLEISKTQNAENPLINGATPILGIDVWEHAYYLDFQYKRSSYVEN 180

Query: 181 FITNLVNWEYVCERYETAMLAQKVT 205
           F+++L+NWEYV ERYE+ +L QK +
Sbjct: 181 FVSHLINWEYVHERYESTILTQKSS 205


>gi|327395927|dbj|BAK13349.1| superoxide dismutase [Mn] SodA [Pantoea ananatis AJ13355]
          Length = 210

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 119/209 (56%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E   L ++E+I K 
Sbjct: 6   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFADLPVDELITKL 65

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ +  
Sbjct: 66  DQLPADKKGPLRNNAGGHANHSLFWKGLKT---GTALQGELKAAIEKDFGSVEKFQEEFE 122

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N +NPL+          PI+G+DVWEHAYYL +
Sbjct: 123 KAATTRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAVAGVSGYPIIGLDVWEHAYYLKY 182

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  N+VNW+    R+ +A 
Sbjct: 183 QNKRPDYIKAF-WNVVNWDEAAARFASAK 210


>gi|328957652|ref|YP_004375038.1| superoxide dismutase [Carnobacterium sp. 17-4]
 gi|328673976|gb|AEB30022.1| superoxide dismutase [Carnobacterium sp. 17-4]
          Length = 207

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY YD L P++ + T+E+HHD HH  Y +           L     E ++  
Sbjct: 6   MTYELPKLPYGYDALEPHIDQATMEFHHDKHHATYVEKTNAALEKYPELAKKSIEELVAD 65

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +  N G       L + I+  FGSF+KFK  +
Sbjct: 66  LNSVPEEIRTAIRNNGGGHANHSFFWEILSPNGGGEPTGT-LKEDIEATFGSFDKFKEAI 124

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TA + QFGSGW WL + NGKLE++ T N ++PL +G  P+ G+DVWEHAYYL+++ +R 
Sbjct: 125 ETAGAGQFGSGWAWLVLNNGKLEVTSTANQDSPLTDGKTPLFGVDVWEHAYYLNYQNKRP 184

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++ + N+VNW  V +RYE A 
Sbjct: 185 AYLKA-VWNVVNWNEVAKRYEAAK 207


>gi|239637635|ref|ZP_04678607.1| superoxide dismutase [Staphylococcus warneri L37603]
 gi|239596853|gb|EEQ79378.1| superoxide dismutase [Staphylococcus warneri L37603]
 gi|330685990|gb|EGG97613.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU121]
          Length = 199

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 115/203 (56%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY++D L P++ KET+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAFDALEPHIDKETMEIHHDKHHNTYVTKLNAAVEGTDLEAKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N    +    + D I + +GS ++FK +  
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLTPNS---EEKGEVVDKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y  A 
Sbjct: 178 YISAF-WNVVNWEKVDELYNAAK 199


>gi|257869654|ref|ZP_05649307.1| manganese superoxide dismutase [Enterococcus gallinarum EG2]
 gi|257803818|gb|EEV32640.1| manganese superoxide dismutase [Enterococcus gallinarum EG2]
          Length = 202

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+ +ET+  HHD HH  Y  N          L     E ++  
Sbjct: 1   MSYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEELLAD 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH+ FW  +  N G      A+ +AI++ FGSF  FK + 
Sbjct: 61  FDSVPEDIKTAVRNNGGGHANHSFFWEILAPNAGGEP-TGAIKEAIEETFGSFADFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL +K+GKL I+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVIKDGKLAITSTANQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  ++VNW+ V + Y  A 
Sbjct: 180 DYINAF-WSVVNWDKVNDFYAKAK 202


>gi|319787055|ref|YP_004146530.1| superoxide dismutase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465567|gb|ADV27299.1| Manganese/iron superoxide dismutase-like protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 203

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  ET++ HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPELPYAYDALEPHIDTETMKIHHTKHHQTYINNVNAALEGTEYADLPVEELVKKT 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M  N G       ++ AI+ + G FEKFK    
Sbjct: 61  KSLPENLQGVVRNNGGGHANHSLFWTVMAPNAGGAP-KGDIAKAIEQDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    K+ +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKVVVESSANQDSPLMDGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V  RY+ A+ 
Sbjct: 180 EYIGAFF-NVVNWDEVERRYQEAVK 203


>gi|86134594|ref|ZP_01053176.1| iron/manganese superoxide dismutase [Polaribacter sp. MED152]
 gi|85821457|gb|EAQ42604.1| iron/manganese superoxide dismutase [Polaribacter sp. MED152]
          Length = 202

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++  +T+E HH  HH  Y           ++   S+E+I+   
Sbjct: 1   MAFELPELGYAHDALEPHIDAKTMEIHHGKHHNGYTTKLNNAIEGTDLEGKSIEDILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN+ + NN   +YNH+LFW  M   + +G +   L DAI+  FGS E F      AA+
Sbjct: 61  DMSNSAVRNNGGGFYNHSLFWTVMNP-EDRGYLSGELKDAIEAEFGSKEAFMDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F   ++NW  V  RY  A 
Sbjct: 180 DYIDAFF-KVINWNEVERRYAEAK 202


>gi|168988704|pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988705|pdb|2RCV|B Chain B, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988706|pdb|2RCV|C Chain C, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988707|pdb|2RCV|D Chain D, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988708|pdb|2RCV|E Chain E, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988709|pdb|2RCV|F Chain F, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988710|pdb|2RCV|G Chain G, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
 gi|168988711|pdb|2RCV|H Chain H, Crystal Structure Of The Bacillus Subtilis Superoxide
           Dismutase
          Length = 202

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 86/202 (42%), Positives = 113/202 (55%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++ KET+  HH  HH  Y  N  K       L     E ++  
Sbjct: 1   MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +  N G      AL++ I+  FGSF+KFK   
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEP-TGALAEEINSVFGSFDKFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N+VNW+ V   Y  
Sbjct: 180 DYISAF-WNVVNWDEVARLYSE 200


>gi|297584608|ref|YP_003700388.1| Superoxide dismutase [Bacillus selenitireducens MLS10]
 gi|297143065|gb|ADH99822.1| Superoxide dismutase [Bacillus selenitireducens MLS10]
          Length = 202

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+++ L P++ +ET++ HH  HH  Y        S    L     E ++K+
Sbjct: 1   MAFTLPELPYAHNALEPHIDEETMKIHHGKHHNTYVTKLNDAISGHADLESKSIEDLVKN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH +FW  M  N G       ++ AID+ FGSF+KFK + 
Sbjct: 61  LNSLPDSVKGPVRNNGGGHLNHTMFWTLMSPNGGGAP-TGDVAAAIDEAFGSFDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA T+FGSGW WL V NGKLE++ T N +NP+ +G  PILG+DVWEHAYYL ++ +R 
Sbjct: 120 KNAALTRFGSGWAWLVVNNGKLEVTSTPNQDNPITDGKTPILGVDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++F  N+VNW+ V E Y+ A 
Sbjct: 180 DYVDAFF-NVVNWDKVNELYKDAK 202


>gi|315158809|gb|EFU02826.1| superoxide dismutase, Mn [Enterococcus faecalis TX0312]
          Length = 197

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 87/198 (43%), Positives = 113/198 (57%), Gaps = 7/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L PY+  ET+  HHD HH  Y  N          L     E +I  
Sbjct: 1   MTYTLPELPYAYDALEPYIDVETMHLHHDKHHNTYVTNLNAAIEKHPELGEKSVEDLISD 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH  FW  M  N G      A+ +AID+ FGSF++ K+  
Sbjct: 61  MNAIPEDIRTAVRNNGGGHANHTFFWKIMAPNAGGQP-TGAIKEAIDETFGSFDEMKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            TAA+ +FGSGW WL V NGKLEI+ T N ++PL++G  P+LG+DVWEHAYYL +K  R 
Sbjct: 120 KTAATGRFGSGWAWLVVNNGKLEITSTPNQDSPLMDGQTPVLGLDVWEHAYYLKYKNVRP 179

Query: 176 HYIESFITNLVNWEYVCE 193
            YIE+F  N+VNW+ V E
Sbjct: 180 DYIEAF-WNVVNWDKVNE 196


>gi|315282330|ref|ZP_07870762.1| superoxide dismutase, Mn [Listeria marthii FSL S4-120]
 gi|313614023|gb|EFR87735.1| superoxide dismutase, Mn [Listeria marthii FSL S4-120]
          Length = 202

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPENIRGAVRNHGGGHANHTLFWSILSPNGGGAP-TGDLKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V  GKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNGGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|217977839|ref|YP_002361986.1| Superoxide dismutase [Methylocella silvestris BL2]
 gi|217503215|gb|ACK50624.1| Superoxide dismutase [Methylocella silvestris BL2]
          Length = 199

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 143/198 (72%), Gaps = 1/198 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PYMSKETLEYHHD HH+ Y  N   L  D+ +   SLE+I+ +S
Sbjct: 1   MSFTLPELPYAYEALQPYMSKETLEYHHDKHHQAYVTNGNNLLKDSGLEGKSLEDIVKES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  +K N G G +P  L  AI D+ GS EK K+DLI A  
Sbjct: 61  FGKNAGLFNNAAQHYNHLHFWNWLKPN-GGGAIPGELEKAIIDSLGSVEKAKADLIQAGV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL+VK+GK+ +SK+ N ENPL+ GA PILG+DVWEH+YY+D++ RR  Y+++
Sbjct: 120 TQFGSGWAWLAVKDGKIIVSKSANGENPLVQGATPILGVDVWEHSYYIDYRNRRPDYLKA 179

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NL+NWEY  E Y  A
Sbjct: 180 FVDNLINWEYAAELYAKA 197


>gi|217964413|ref|YP_002350091.1| superoxide dismutase (Mn) [Listeria monocytogenes HCC23]
 gi|217333683|gb|ACK39477.1| superoxide dismutase (Mn) [Listeria monocytogenes HCC23]
 gi|307571022|emb|CAR84201.1| iron/manganese superoxide dismutase [Listeria monocytogenes L99]
          Length = 202

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAP-TGDLKSAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|163760499|ref|ZP_02167581.1| superoxide dismutase, Fe-Mn family protein [Hoeflea phototrophica
           DFL-43]
 gi|162282450|gb|EDQ32739.1| superoxide dismutase, Fe-Mn family protein [Hoeflea phototrophica
           DFL-43]
          Length = 200

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 103/199 (51%), Positives = 133/199 (66%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY YD L+PYMS+ETLE+HHD HH+ Y     +L   +     S+EEI   +
Sbjct: 1   MALELPALPYDYDALAPYMSRETLEFHHDKHHQAYVTKGNELLEGSAHAGKSIEEICKAA 60

Query: 61  HGSNAG-LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              N   L NN  Q+YNH  FW  MKK  G  K+P AL  AI  + G F+KF++D I A 
Sbjct: 61  FAENNAGLINNVGQHYNHMHFWNWMKKGGGGSKMPGALEKAIASDLGGFDKFRADFIAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             QFGSGW WL+VKNGKLE+ KT N ENPL++GA P+LG DVWEH+YY+D++  R  Y+E
Sbjct: 121 VGQFGSGWAWLAVKNGKLEVMKTPNGENPLMHGATPVLGCDVWEHSYYIDYRNARPKYLE 180

Query: 180 SFITNLVNWEYVCERYETA 198
           +FI N++NW+YV E Y+ A
Sbjct: 181 AFIDNMINWDYVAELYDAA 199


>gi|46907667|ref|YP_014056.1| superoxide dismutase, Mn [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47092729|ref|ZP_00230515.1| superoxide dismutase, Mn [Listeria monocytogenes str. 4b H7858]
 gi|226224040|ref|YP_002758147.1| superoxide dismutase [Listeria monocytogenes Clip81459]
 gi|254824502|ref|ZP_05229503.1| superoxide dismutase [Listeria monocytogenes FSL J1-194]
 gi|254852065|ref|ZP_05241413.1| superoxide dismutase [Listeria monocytogenes FSL R2-503]
 gi|254932624|ref|ZP_05265983.1| superoxide dismutase [Listeria monocytogenes HPB2262]
 gi|254993243|ref|ZP_05275433.1| superoxide dismutase [Listeria monocytogenes FSL J2-064]
 gi|255522265|ref|ZP_05389502.1| superoxide dismutase [Listeria monocytogenes FSL J1-175]
 gi|300765581|ref|ZP_07075560.1| superoxide dismutase, Mn [Listeria monocytogenes FSL N1-017]
 gi|46880935|gb|AAT04233.1| superoxide dismutase, Mn [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018917|gb|EAL09664.1| superoxide dismutase, Mn [Listeria monocytogenes str. 4b H7858]
 gi|225876502|emb|CAS05211.1| superoxide dismutase [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258605362|gb|EEW17970.1| superoxide dismutase [Listeria monocytogenes FSL R2-503]
 gi|293584183|gb|EFF96215.1| superoxide dismutase [Listeria monocytogenes HPB2262]
 gi|293593740|gb|EFG01501.1| superoxide dismutase [Listeria monocytogenes FSL J1-194]
 gi|300513682|gb|EFK40750.1| superoxide dismutase, Mn [Listeria monocytogenes FSL N1-017]
 gi|328465484|gb|EGF36713.1| superoxide dismutase [Listeria monocytogenes 1816]
 gi|328474956|gb|EGF45750.1| superoxide dismutase [Listeria monocytogenes 220]
 gi|332311880|gb|EGJ24975.1| Superoxide dismutase [Listeria monocytogenes str. Scott A]
          Length = 202

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S+EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V +GKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|260584214|ref|ZP_05851962.1| superoxide dismutase, Mn [Granulicatella elegans ATCC 700633]
 gi|260158840|gb|EEW93908.1| superoxide dismutase, Mn [Granulicatella elegans ATCC 700633]
          Length = 202

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP L Y +  L P++   T+E HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYELPKLAYEFSALEPHVDALTMEIHHDKHHNAYVTNLNAAVEKHPALFEKSVEELVAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+ AID  FG F+ FK   
Sbjct: 61  LASVPEDIRGAVRNNGGGHANHSLFWTVISPNGGGQP-TGELAAAIDTKFGGFDAFKQAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LE+  T N +NPL +G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 SQAAATRFGSGWAWLVVSNGELEVVSTPNQDNPLTDGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+V+W  V  RYE A 
Sbjct: 180 DYIAAF-WNVVDWNEVARRYEAAK 202


>gi|33340234|gb|AAQ14590.1| manganese superoxide dismutase [Tatumella ptyseos]
          Length = 205

 Score =  211 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 119/209 (56%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  KET+E HH  HH+ Y +NA       E   L +EE+I K 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALEGTEFASLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS E F+++  
Sbjct: 61  DQVPADKKTALRNNAGGHANHSLFWKGLKT---GTTLQGELKAAIEKDFGSVENFQAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  +  KL +  T N ++PL+          PILG+DVWEHAYYL F
Sbjct: 118 KAAATRFGSGWAWLVKQGDKLAVVSTANQDSPLMGEAVSGTSGFPILGLDVWEHAYYLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  N+VNW+    R+ +A 
Sbjct: 178 QNKRPDYIKAF-WNVVNWDEAAARFASAK 205


>gi|313903627|ref|ZP_07837017.1| Manganese/iron superoxide dismutase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313466180|gb|EFR61704.1| Manganese/iron superoxide dismutase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 204

 Score =  211 bits (536), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 77/205 (37%), Positives = 110/205 (53%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY Y+ L P++ ++T+  HHD HH  Y +N          L     + +++ 
Sbjct: 1   MAYQLPPLPYDYNALEPHIDEQTMRIHHDRHHATYVNNVNAALEKYPELQDKPIDQLLRQ 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  M  N G      AL+DAI+  FGSFE FK   
Sbjct: 61  IDQVPEDIRTAVRNNGGGHANHSLFWEIMSPNGGGQP-TGALADAINKAFGSFETFKDQF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A+T FGSGW WL V     L++    N ++P + G  PILG+DVWEHAYYL ++ +R
Sbjct: 120 TKTATTHFGSGWAWLVVDEKGDLQLYSLPNQDSPYMKGHTPILGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             Y+ +   N+VNW+ V  RY+ A 
Sbjct: 180 PDYVAA-WWNVVNWDEVARRYQQAR 203


>gi|16803479|ref|NP_464964.1| superoxide dismutase [Listeria monocytogenes EGD-e]
 gi|47095390|ref|ZP_00233000.1| superoxide dismutase, Mn [Listeria monocytogenes str. 1/2a F6854]
 gi|224501620|ref|ZP_03669927.1| superoxide dismutase [Listeria monocytogenes FSL R2-561]
 gi|254898395|ref|ZP_05258319.1| superoxide dismutase [Listeria monocytogenes J0161]
 gi|254912113|ref|ZP_05262125.1| superoxide dismutase [Listeria monocytogenes J2818]
 gi|254936441|ref|ZP_05268138.1| superoxide dismutase [Listeria monocytogenes F6900]
 gi|134667|sp|P28764|SODM_LISMO RecName: Full=Superoxide dismutase [Mn]
 gi|149683|gb|AAA25292.1| superoxide dismutase [Listeria monocytogenes]
 gi|16410868|emb|CAC99517.1| superoxide dismutase [Listeria monocytogenes EGD-e]
 gi|47016211|gb|EAL07134.1| superoxide dismutase, Mn [Listeria monocytogenes str. 1/2a F6854]
 gi|258609033|gb|EEW21641.1| superoxide dismutase [Listeria monocytogenes F6900]
 gi|293590083|gb|EFF98417.1| superoxide dismutase [Listeria monocytogenes J2818]
          Length = 202

 Score =  210 bits (535), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V +GKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YIE+F  N++NW+   +R++ A 
Sbjct: 180 EYIETF-WNVINWDEANKRFDAAK 202


>gi|182414181|ref|YP_001819247.1| superoxide dismutase [Opitutus terrae PB90-1]
 gi|177841395|gb|ACB75647.1| Superoxide dismutase [Opitutus terrae PB90-1]
          Length = 261

 Score =  210 bits (535), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 81/203 (39%), Positives = 114/203 (56%), Gaps = 7/203 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            F LP L Y YD L P++   T+E HH  HH+ Y +NA K  ++   L       +++  
Sbjct: 60  PFTLPQLGYGYDALEPHIDARTMEIHHTKHHQAYINNANKALAEYPHLRTRTAAELLRDL 119

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NN   + NH  FW  +    G G+    L+ A++  FGS + F++   
Sbjct: 120 PALPEKVRTTLRNNVGGHANHTFFWEVLSP-QGGGEPGSELATALNKAFGSLDAFRTQFT 178

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA  +FGSGW WLSVK+G L++  T N ++PLI GA P+LGIDVWEHAYYL ++ RRA 
Sbjct: 179 EAAMKRFGSGWAWLSVKDGTLQVHSTANQDSPLIEGARPVLGIDVWEHAYYLHYQNRRAD 238

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+++F  N+VNW  V   Y  A+
Sbjct: 239 YVKAF-WNVVNWNQVATNYRAAL 260


>gi|224499709|ref|ZP_03668058.1| superoxide dismutase [Listeria monocytogenes Finland 1988]
 gi|254827727|ref|ZP_05232414.1| superoxide dismutase [Listeria monocytogenes FSL N3-165]
 gi|254829802|ref|ZP_05234457.1| superoxide dismutase [Listeria monocytogenes 10403S]
 gi|255026332|ref|ZP_05298318.1| superoxide dismutase [Listeria monocytogenes FSL J2-003]
 gi|284801826|ref|YP_003413691.1| superoxide dismutase [Listeria monocytogenes 08-5578]
 gi|284994968|ref|YP_003416736.1| superoxide dismutase [Listeria monocytogenes 08-5923]
 gi|258600106|gb|EEW13431.1| superoxide dismutase [Listeria monocytogenes FSL N3-165]
 gi|284057388|gb|ADB68329.1| superoxide dismutase [Listeria monocytogenes 08-5578]
 gi|284060435|gb|ADB71374.1| superoxide dismutase [Listeria monocytogenes 08-5923]
          Length = 202

 Score =  210 bits (535), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V +GKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|312891106|ref|ZP_07750629.1| Superoxide dismutase [Mucilaginibacter paludis DSM 18603]
 gi|311296414|gb|EFQ73560.1| Superoxide dismutase [Mucilaginibacter paludis DSM 18603]
          Length = 203

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++ K T+E HH  HH+ Y  N  K          ++E+II   
Sbjct: 1   MAFELPALPYATDALEPHIDKLTMEIHHGKHHQAYVTNLNKALEGKPEASSTIEDIIHNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   +YNH  FW  +  N G       L +AI   FGSF +FK+    A +
Sbjct: 61  SKFPPAVRNNGGGHYNHTFFWTILTPNGGGEP-TGELEEAIKSTFGSFSEFKTKFSEAGA 119

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V    KL I+ T N +N L++       P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 TRFGSGWAWLIVTPDKKLAITSTPNQDNTLMDIAEVKGTPVLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW +V + Y+ A+ 
Sbjct: 180 DYIAAFF-NVINWAHVADLYKKAIA 203


>gi|16800546|ref|NP_470814.1| superoxide dismutase [Listeria innocua Clip11262]
 gi|20140103|sp|Q92BR6|SODM_LISIN RecName: Full=Superoxide dismutase [Mn]
 gi|16413951|emb|CAC96709.1| superoxide dismutase [Listeria innocua Clip11262]
 gi|313618918|gb|EFR90773.1| superoxide dismutase, Mn [Listeria innocua FSL S4-378]
 gi|313623771|gb|EFR93907.1| superoxide dismutase, Mn [Listeria innocua FSL J1-023]
          Length = 202

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  S    L     E ++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMELHYTKHHNTYVTKLNEAVSGHPELAEKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F+ FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAP-TGDLKSAIESEFGTFDDFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+VNW+   +R++ A 
Sbjct: 180 EYIDTF-WNVVNWDEANKRFDAAK 202


>gi|319784588|ref|YP_004144064.1| Manganese/iron superoxide dismutase-like protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317170476|gb|ADV14014.1| Manganese/iron superoxide dismutase-like protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 199

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 152/199 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A +  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A+D + G ++KFK+D I A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +L+NW++V E YE A 
Sbjct: 181 FVDSLINWDHVLELYEKAK 199


>gi|91774742|ref|YP_544498.1| superoxide dismutase [Methylobacillus flagellatus KT]
 gi|91708729|gb|ABE48657.1| Superoxide dismutase [Methylobacillus flagellatus KT]
          Length = 204

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+Y DL P++  +T+E HH  HH+ Y +N              +E ++ K 
Sbjct: 1   MAYTLPPLDYAYTDLEPHIDAQTMEIHHTKHHQTYINNVNAALEGTPFADEPIEALVAKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M  N G      AL+DAI  + G F+ FK    
Sbjct: 61  DSLPENLRGPVRNNGGGHANHSLFWKVMSPNGGGEP-TGALADAIKSDIGGFDTFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL +G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKLIVESSANQDSPLSHGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYIGAFF-NVINWDEVARRYQEAIS 203


>gi|295397325|ref|ZP_06807417.1| superoxide dismutase [Aerococcus viridans ATCC 11563]
 gi|294974399|gb|EFG50134.1| superoxide dismutase [Aerococcus viridans ATCC 11563]
          Length = 201

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 88/203 (43%), Positives = 118/203 (58%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L PY  +ET+  HHD HH  Y  NA    +  ++   S EEI+   
Sbjct: 1   MAFELPELPYAYDALEPYFDEETMHLHHDKHHNTYVTNANAALAGTDLADKSAEEILSNF 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH LFW     N G      AL +AID  FGSF  F+    
Sbjct: 61  DAVPEDKKTAVRNNVGGHANHTLFWEQFAANAGGEP-TGALKEAIDAKFGSFADFQEAFK 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           TAA+ +FGSGW WL + NG++ I+ T N ++PL++G  P+LGIDVWEHAYYL +K  R  
Sbjct: 120 TAATGRFGSGWAWLVLANGEVAITSTPNQDSPLMDGQTPLLGIDVWEHAYYLKYKNVRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V +R++ A 
Sbjct: 180 YIAAF-WNIVNWDEVAKRFDAAK 201


>gi|314933725|ref|ZP_07841090.1| superoxide dismutase, Mn [Staphylococcus caprae C87]
 gi|313653875|gb|EFS17632.1| superoxide dismutase, Mn [Staphylococcus caprae C87]
          Length = 199

 Score =  210 bits (535), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 83/201 (41%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N    +    + D I + +GS ++FK +  
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWELLSPNS---EEKGEVVDKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNWE V E Y+ 
Sbjct: 178 YISAF-WNVVNWEKVDELYKA 197


>gi|163786809|ref|ZP_02181257.1| hypothetical protein FBALC1_16527 [Flavobacteriales bacterium
           ALC-1]
 gi|159878669|gb|EDP72725.1| hypothetical protein FBALC1_16527 [Flavobacteriales bacterium
           ALC-1]
          Length = 202

 Score =  210 bits (534), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 87/204 (42%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +   T+E HH  HH  Y +         ++   S+E I+   
Sbjct: 1   MAFELPKLKYAYDALEPNIDARTMEIHHSKHHNGYTNKLNAAIEGTDLEGKSIESILTNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N G+ NN   +YNH+LFW  M   + +G +   L DAI+  FGS + F      AA+
Sbjct: 61  DMNNKGVRNNGGGFYNHSLFWEVMNP-EDRGYLSGELKDAIEAEFGSKDAFIEAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW  V  RY  A 
Sbjct: 180 DYINAFF-NVINWNEVERRYAEAK 202


>gi|126311246|ref|XP_001381442.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 344

 Score =  210 bits (534), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 101/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 148 HSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNATEEKYKEALAKG--DVTSQVA 205

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSFEKFK  L   +   
Sbjct: 206 LQPALRFNGGGHINHTIFWTNLCPNGGGEP-KGELMEAIKRDFGSFEKFKEKLTAVSVGV 264

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 265 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 324

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 325 A-IWNVINWENVTERYSACKK 344


>gi|149182012|ref|ZP_01860498.1| SodA [Bacillus sp. SG-1]
 gi|148850277|gb|EDL64441.1| SodA [Bacillus sp. SG-1]
          Length = 221

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P++ KET+  HH  HH  Y           E L     E ++  
Sbjct: 20  MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNAYVTKLNDALQGNEELLSKSVEEVVAN 79

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                 G+   + NN   + NH+LFW  +  N G       L+ AI+  FGSFEKFK + 
Sbjct: 80  LDAVPEGARTAVRNNGGGHANHSLFWTILSPNGGGNP-EGELASAIESKFGSFEKFKEEF 138

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LE++ T N ++PL++G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 139 AAAAAGRFGSGWAWLVVNNGELEVTSTLNQDSPLMDGKTPVLGLDVWEHAYYLNYQNRRP 198

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V +R+  A 
Sbjct: 199 DYINAF-WNVVNWDEVSKRFSAAK 221


>gi|3790114|emb|CAA05291.1| manganese superoxide dismutase [Bacillus licheniformis]
          Length = 202

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M +KLP LPY+YD L P++ KET+  HH  HH  Y     +  +  + L     E ++  
Sbjct: 1   MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI+  FGSF++FK D 
Sbjct: 61  LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGGGAP-TGELAEAINSKFGSFDQFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++PL  G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAARFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+VNW+ V   Y  A 
Sbjct: 180 DYIKAF-WNVVNWDEVAPLYSEAK 202


>gi|302384230|ref|YP_003820053.1| superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194858|gb|ADL02430.1| Superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 204

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 83/203 (40%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKL-ASDAEMLHLSLEEIIIK 59
           M F LP LPY+YD L P +  ET+ +HHD HH+ Y D   +  A+DA +   S+E+++  
Sbjct: 1   MAFTLPPLPYAYDALEPAIDSETMTFHHDKHHQAYVDKLNEAVAADASLADHSIEDLLKG 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
                  + NN   ++NH+LFW  +      G+    L+ AID + G  EKFK+D   A 
Sbjct: 61  VSKLPKAVRNNGGGHWNHSLFWELLAPVGQGGEPSAELAAAIDRDLGGLEKFKTDFNAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           + QFGSGW WL V++GKL+I+ T N +NPL++        +LG DVWEHAYYL ++ RR 
Sbjct: 121 AGQFGSGWAWLIVQDGKLKITSTPNQDNPLMDVADEKGAVVLGADVWEHAYYLKYQNRRP 180

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+++F   +VNW    E Y  A
Sbjct: 181 DYLKAF-WTVVNWNKANELYAAA 202


>gi|86143640|ref|ZP_01062016.1| manganese superoxide dismutase [Leeuwenhoekiella blandensis MED217]
 gi|85829683|gb|EAQ48145.1| manganese superoxide dismutase [Leeuwenhoekiella blandensis MED217]
          Length = 202

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+ D L P++  +T+E HHD HH  Y           ++   ++E I+I  
Sbjct: 1   MSFQLPELKYAKDALEPHIDAKTMEIHHDKHHAGYTSKLNAAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   +YNH+LFW  M   DG G+    L++AI+  FGSFE FK    +AA 
Sbjct: 61  DMTNKAVRNNGGGFYNHSLFWDVMSP-DGGGEPTGELAEAINAAFGSFEAFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V   GK+E+  T N +NPL+        PILGIDVWEHAYYL ++ +R 
Sbjct: 120 TQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPEVGCGGTPILGIDVWEHAYYLKYQNQRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI++F  N++NW+ V  RY  
Sbjct: 180 AYIDAFF-NVINWQEVSSRYAQ 200


>gi|290894106|ref|ZP_06557079.1| superoxide dismutase [Listeria monocytogenes FSL J2-071]
 gi|290556361|gb|EFD89902.1| superoxide dismutase [Listeria monocytogenes FSL J2-071]
          Length = 202

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +   E+   S EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAP-TGDLKSAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++TA 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDTAK 202


>gi|292490108|ref|YP_003533003.1| superoxide dismutase, manganese [Erwinia amylovora CFBP1430]
 gi|291555550|emb|CBA24118.1| superoxide dismutase, manganese [Erwinia amylovora CFBP1430]
 gi|312174301|emb|CBX82554.1| superoxide dismutase, manganese [Erwinia amylovora ATCC BAA-2158]
          Length = 205

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 118/209 (56%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L +EE+I K 
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+ FW  +K     G     L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGG---DLKAAIERDFGSVDAFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIIGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  ++VNW+   E +  A 
Sbjct: 178 QNKRPDYIKAF-WDVVNWDRAAENFAAAK 205


>gi|260462419|ref|ZP_05810627.1| Superoxide dismutase [Mesorhizobium opportunistum WSM2075]
 gi|259031913|gb|EEW33181.1| Superoxide dismutase [Mesorhizobium opportunistum WSM2075]
          Length = 199

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 152/199 (76%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A +  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A+D + G ++KFK+D I A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +L+NW++V E YE A 
Sbjct: 181 FVDSLINWDHVLEMYEKAK 199


>gi|322434069|ref|YP_004216281.1| Superoxide dismutase [Acidobacterium sp. MP5ACTX9]
 gi|321161796|gb|ADW67501.1| Superoxide dismutase [Acidobacterium sp. MP5ACTX9]
          Length = 203

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L P++ + T++ HHD HH+ Y  N          L     E ++K 
Sbjct: 1   MAFELPPLPYAYDALEPFIDEATMKLHHDKHHQTYVTNLNGAVEKYPDLGKKTPEELVKD 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + NN   + NH +FW  MK   G       +   I  +FGSFE FK   
Sbjct: 61  LASIPEDVRKVVQNNGGGHVNHTMFWQIMKPQGGGEPTGN-IGLQITTDFGSFEDFKKKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
               + QFG+GWGWL  K GKLEI  T N ++PL  G  PILG DVWEHAYYL ++ +R 
Sbjct: 120 NETTAKQFGAGWGWLVFKGGKLEILTTANQDSPLSQGLYPILGNDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +   + VNWE + +R+ETA  
Sbjct: 180 DYLAA-WWSTVNWEEINKRFETAQK 203


>gi|312131615|ref|YP_003998955.1| manganese/iron superoxide dismutase [Leadbetterella byssophila DSM
           17132]
 gi|311908161|gb|ADQ18602.1| Manganese/iron superoxide dismutase [Leadbetterella byssophila DSM
           17132]
          Length = 203

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 123/204 (60%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L  LPY+ D L P+   +T+E HHD HH  Y  N     +  E+ + S+EEI+   
Sbjct: 1   MAFTLAPLPYANDALEPHFDAKTMEIHHDRHHNAYVTNLNAAIAGTELDNQSIEEILANV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             ++  + NN   +YNH+LFW  +      G++   L  AI+  FGS E+FK+    AA+
Sbjct: 61  SKASPAVRNNGGGHYNHDLFWNILAPAGKGGELSGDLKSAIEAAFGSVEEFKAQFKAAAT 120

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           ++FGSGW WL VK +G L ++ T N +NPL++       PILG+DVWEHAYYL ++ +R 
Sbjct: 121 SRFGSGWAWLIVKADGNLAVTSTPNQDNPLMDIAEVKGTPILGLDVWEHAYYLHYQNKRP 180

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++F  N+VNW+ V +RY +A 
Sbjct: 181 DYVDAF-WNVVNWDEVAKRYASAK 203


>gi|220907079|ref|YP_002482390.1| Superoxide dismutase [Cyanothece sp. PCC 7425]
 gi|219863690|gb|ACL44029.1| Superoxide dismutase [Cyanothece sp. PCC 7425]
          Length = 199

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 118/200 (59%), Gaps = 4/200 (2%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+ P LPY    L PY MS  T E+H+  HH  Y  N   L  D E+   SLEE+I  
Sbjct: 1   MAFEQPPLPYDPGALEPYGMSARTFEFHYGKHHAAYVTNLNNLTKDTELADKSLEEVIKV 60

Query: 60  SHGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           +       G+FNNA+Q +NH  FW  +K   G       L+  ID  FGSF+KFK +  T
Sbjct: 61  TFKDPGKVGVFNNAAQVWNHTFFWNSLKPGGGGTP-SGDLAAKIDSAFGSFDKFKEEFKT 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL  G   +L +DVWEHAYY+D++ RR  +
Sbjct: 120 AAATQFGSGWAWLVEDGGSLKVIKTPNAENPLAYGQKSLLTLDVWEHAYYIDYQNRRPDF 179

Query: 178 IESFITNLVNWEYVCERYET 197
           I++F+  LVNW++V +    
Sbjct: 180 IQNFLDQLVNWDFVAQNLAA 199


>gi|332879152|ref|ZP_08446853.1| superoxide dismutase, Mn [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332682952|gb|EGJ55848.1| superoxide dismutase, Mn [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 202

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 99/202 (49%), Positives = 121/202 (59%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y  L PY+   T+E HH  HH  Y  N     + A +   S+EEI+   
Sbjct: 1   MAFTLPKLPYAYQALEPYIDARTMEIHHTKHHNAYTTNLNAALAPAGVEGKSIEEILQNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +NA L NNA  YYNHNLFW  M  N G GK    L+ AID+ FGSFE FK     AA+
Sbjct: 61  DMNNAALRNNAGGYYNHNLFWEVMSSN-GGGKPTGELAKAIDEAFGSFEGFKEAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+E+  T N +NPL+        PILG+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGTGCSGQPILGLDVWEHAYYLHYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YIE+F  N++NWE V   Y  
Sbjct: 180 DYIEAFF-NVINWEKVAALYAA 200


>gi|315498070|ref|YP_004086874.1| manganese/iron superoxide dismutase-like protein [Asticcacaulis
           excentricus CB 48]
 gi|315416082|gb|ADU12723.1| Manganese/iron superoxide dismutase-like protein [Asticcacaulis
           excentricus CB 48]
          Length = 239

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 119/205 (58%), Gaps = 7/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIKS 60
            F LP LPY+ + L P +  ET+  HHD HHK Y D   K L     +   SL E++  +
Sbjct: 35  AFTLPALPYAANALEPAIDAETMTIHHDRHHKAYVDTLNKALNETPALKGKSLAELLASA 94

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NNA  ++NH+ FW  +      GK   AL+ AI D +GS + FK++   A +
Sbjct: 95  GSLPMVVRNNAGGHWNHSFFWQSLTPPAQSGKPSAALAKAIADQWGSLDAFKAEFKKAGT 154

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V K+GKL I+ T N +NPL++       PILG D+WEHAYYL ++ +RA
Sbjct: 155 GRFGSGWAWLIVGKDGKLAITSTPNQDNPLMDVAEVKGTPILGNDLWEHAYYLKYQNKRA 214

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+++F   +VNW+ V +RY  A+ 
Sbjct: 215 DYLDAF-WQVVNWKAVSDRYAEAIK 238


>gi|87125508|ref|ZP_01081353.1| superoxide dismutase [Synechococcus sp. RS9917]
 gi|86166808|gb|EAQ68070.1| superoxide dismutase [Synechococcus sp. RS9917]
          Length = 199

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 123/200 (61%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I   
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNAYVANLNKAIEGTDLDGKSLEEVITAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL + I+ +FGS++ F      A
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-SGALLEKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGSLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 STYLDKLVNWDFVAANLAAA 199


>gi|227538658|ref|ZP_03968707.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241577|gb|EEI91592.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 203

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 125/205 (60%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY+ D L P++ KET+E HHD HH+ Y DN  K  +  +  +LSLEEI+   
Sbjct: 1   MAFQLEALPYASDALEPHIDKETMEIHHDRHHQAYVDNLNKAIAGTDAENLSLEEIVKNV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH LFW+ +  N G       L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYSPAVRNNGGGHFNHGLFWSVLGANAGGQP-TGELAAAIDETFGSFDELKKKLQEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V  +GKL ++ T N +NPL++       P+LGIDVWEHAYYL ++ +R 
Sbjct: 120 GRFGSGWSWLIVGADGKLAVTSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+E+   N++NW+ V ERY  A  
Sbjct: 180 AYLEAIF-NVINWDAVAERYAAAKK 203


>gi|189346617|ref|YP_001943146.1| superoxide dismutase [Chlorobium limicola DSM 245]
 gi|189340764|gb|ACD90167.1| Superoxide dismutase [Chlorobium limicola DSM 245]
          Length = 200

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 86/201 (42%), Positives = 130/201 (64%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+ + L P++S +T+ +H+  HH  Y +N   L +      +S+EE+I  +
Sbjct: 1   MAYQQPALPYAENALEPHISAKTIGFHYGKHHAAYVNNFNNLVTGTPFDSMSIEEVICTT 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G     G+FNN +Q +NH+ +W C+  N G GK    L+  ID +FGSF+KF  +L  A
Sbjct: 61  AGDAQKIGVFNNGAQAWNHSFYWNCLSAN-GGGKPSGELAAKIDGDFGSFDKFVEELKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L++ KT NA+ P+ +G  P+L +DVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVVKTGNAQTPITSGQTPLLCVDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
            + I NL+NW++  E Y++A 
Sbjct: 180 AATIENLLNWKFAEENYQSAK 200


>gi|87301162|ref|ZP_01084003.1| superoxide dismutase [Synechococcus sp. WH 5701]
 gi|87284130|gb|EAQ76083.1| superoxide dismutase [Synechococcus sp. WH 5701]
          Length = 199

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY  + L P++S+ TLE+HH  HH  Y  N  KL    ++   SLE++I   
Sbjct: 1   MAHTLPALPYDINALEPHISQTTLEFHHGKHHAAYVANLNKLLDGTDLDGKSLEDVITSV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL++ I+ +FGSFE F     TA
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-SGALAEKINADFGSFEAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +  G L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ +R  Y+
Sbjct: 120 GATQFGSGWAWLILDGGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNKRPDYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F+  LVNW++V      A
Sbjct: 180 TTFLEKLVNWDFVAANLAAA 199


>gi|116750838|ref|YP_847525.1| manganese and iron superoxide dismutase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699902|gb|ABK19090.1| manganese and iron superoxide dismutase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 241

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 81/196 (41%), Positives = 115/196 (58%), Gaps = 3/196 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
             +LP LPY+ + L P +S  TL +H+  HHK Y DN  KL +  E   + +E++I  + 
Sbjct: 44  AHELPPLPYAENALEPVLSSATLGFHYGKHHKAYLDNVNKLIAGTEFAQMPIEQVISSTA 103

Query: 62  G--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           G    A +FNNA+Q +NH  +W C+    G      AL   I+ +FGS +  + +L +AA
Sbjct: 104 GKSDKAAIFNNAAQTWNHTFYWKCLSPKGGGDP-QPALKQRIETSFGSLDACRKELASAA 162

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            T FGSGW WL +   KL++  T NA+NP+     P+L IDVWEHAYYLD++ RRA Y+ 
Sbjct: 163 VTCFGSGWAWLVLDGDKLKVVATSNADNPMTRNMKPLLTIDVWEHAYYLDYQNRRADYVN 222

Query: 180 SFITNLVNWEYVCERY 195
             I  L+NWE+V    
Sbjct: 223 GVIEKLINWEFVAANL 238


>gi|332974765|gb|EGK11681.1| superoxide dismutase [Desmospora sp. 8437]
          Length = 206

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 10/208 (4%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS------L 53
           M  ++LP LPY+ D L P+  KET+E HH  HHK Y D                     +
Sbjct: 1   MAKYELPALPYASDALEPHFDKETMEIHHGRHHKTYVDKLNGALEGQAAALQEMSVEDLM 60

Query: 54  EEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
           + I          + NN   + NH+LFW  +  N G       L+ AID  FGSFEKFK 
Sbjct: 61  KNIDQVPESIRTAVRNNGGGHANHSLFWKILSPNGGGQP-TGELATAIDSAFGSFEKFKE 119

Query: 114 DLITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKY 172
           +   AA  +FGSGW WL + K+G L I+ T N ++PL+ G  PILG+DVWEHAYYL ++ 
Sbjct: 120 EFTNAAVGRFGSGWAWLVLGKDGSLAITTTPNQDSPLMEGLQPILGLDVWEHAYYLKYQN 179

Query: 173 RRAHYIESFITNLVNWEYVCERYETAML 200
           +R  YI++F  N+VNW+ V +RYE A  
Sbjct: 180 KRPDYIKAF-WNVVNWDEVGKRYEEAKR 206


>gi|255036665|ref|YP_003087286.1| Superoxide dismutase [Dyadobacter fermentans DSM 18053]
 gi|254949421|gb|ACT94121.1| Superoxide dismutase [Dyadobacter fermentans DSM 18053]
          Length = 240

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 83/202 (41%), Positives = 112/202 (55%), Gaps = 6/202 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            FK   LPY +  L P + K T+E H+  HH  Y  N        E    SLE+II    
Sbjct: 41  PFKQAPLPYDFGALEPSIDKLTMEIHYGKHHTAYIKNLNDAVKGTEWEKKSLEDIIKGVS 100

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
            + A + NN   ++NH  FW  M           A++DAI+  FGSFEKFK +   AA+T
Sbjct: 101 KAPAAIRNNGGGHWNHTFFWEVMGPKKAAAP-SGAVADAINGQFGSFEKFKEEFGKAAAT 159

Query: 122 QFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAHY 177
           +FGSGW WL  K GKL +  T N +NPL++       PILGIDVWEHAYYL ++ +R  Y
Sbjct: 160 RFGSGWAWLVAKGGKLAVGSTPNQDNPLMDVSDFKGTPILGIDVWEHAYYLHYQNKRPDY 219

Query: 178 IESFITNLVNWEYVCERYETAM 199
           +++F  ++VNW+ V E  + A 
Sbjct: 220 VKAF-WDVVNWDKVAENLKKAK 240


>gi|330504562|ref|YP_004381431.1| superoxide dismutase [Pseudomonas mendocina NK-01]
 gi|328918848|gb|AEB59679.1| superoxide dismutase [Pseudomonas mendocina NK-01]
          Length = 193

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 92/198 (46%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLE+HHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEFHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFSKVSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V + Y  
Sbjct: 177 AF-WNLVNWDFVAQNYAA 193


>gi|218245306|ref|YP_002370677.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|257058341|ref|YP_003136229.1| superoxide dismutase [Cyanothece sp. PCC 8802]
 gi|218165784|gb|ACK64521.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|256588507|gb|ACU99393.1| Superoxide dismutase [Cyanothece sp. PCC 8802]
          Length = 200

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 133/200 (66%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LP+ Y  L P++SK TLE+HHD HH  Y +N     + +E+    +EE+I   
Sbjct: 1   MGYALPELPFGYTALEPHISKSTLEFHHDKHHAAYVNNYNNAVAGSELDAKPIEEVIKAI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AGLFNNA+Q +NH+ +W C+K N G      AL+D I+ +FGSFE+F +    A
Sbjct: 61  AGDSSKAGLFNNAAQAWNHSFYWNCIKPNGGGAP-TGALADKINQDFGSFEEFVTAFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NAENP+  G  P+L +DVWEHAYYLD++ +R  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTSNAENPMTAGQTPLLTMDVWEHAYYLDYQNKRPAYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+  L+NW++V E +  A
Sbjct: 180 DTFVEKLINWDFVAENFAKA 199


>gi|13476344|ref|NP_107914.1| superoxide dismutase [Mesorhizobium loti MAFF303099]
 gi|14027105|dbj|BAB54059.1| superoxide dismutase [Mesorhizobium loti MAFF303099]
          Length = 199

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 151/199 (75%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y+ L PYMSKETLEYHHD HHK Y DN  KLA++A M  LS+EE++ +S
Sbjct: 1   MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGMGDLSVEEVVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G NAGLFNNA+Q+YNH  FW  MKK  G  K+P AL  A D + G ++KFK+D + A +
Sbjct: 61  FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPAALQKAFDSDLGGYDKFKADFVAAGT 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W+SVK+GKL ISKT N ENPL++GA PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +L+NW++V E YE A 
Sbjct: 181 FVDSLINWDHVLELYEKAK 199


>gi|15599562|ref|NP_253056.1| superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|107100050|ref|ZP_01363968.1| hypothetical protein PaerPA_01001071 [Pseudomonas aeruginosa PACS2]
 gi|116052400|ref|YP_792711.1| superoxide dismutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893457|ref|YP_002442326.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
 gi|254238971|ref|ZP_04932294.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|254244824|ref|ZP_04938146.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|296391073|ref|ZP_06880548.1| superoxide dismutase [Pseudomonas aeruginosa PAb1]
 gi|313106895|ref|ZP_07793099.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
 gi|12230961|sp|P53641|SODF_PSEAE RecName: Full=Superoxide dismutase [Fe]
 gi|9950594|gb|AAG07754.1|AE004852_7 superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|115587621|gb|ABJ13636.1| iron superoxide dismutase' [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170902|gb|EAZ56413.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|126198202|gb|EAZ62265.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|218773685|emb|CAW29499.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
 gi|310879601|gb|EFQ38195.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
          Length = 193

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V + +  
Sbjct: 177 AF-WNLVNWDFVAKNFAA 193


>gi|88809143|ref|ZP_01124652.1| superoxide dismutase [Synechococcus sp. WH 7805]
 gi|88787085|gb|EAR18243.1| superoxide dismutase [Synechococcus sp. WH 7805]
          Length = 199

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 89/199 (44%), Positives = 123/199 (61%), Gaps = 3/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+ D L P++S+ TLE+HH  HH  Y  N  K     ++   SLEE+I   
Sbjct: 1   MAHTLPALPYALDALEPHISRSTLEFHHGKHHNGYVTNLNKAIEGTDLDGKSLEEVIAAV 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            S  S AG+FNNA+Q +NH+ +W CMK   G      AL D I+ +FGS++ F      A
Sbjct: 61  SSDSSKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-TGALLDKINADFGSYDAFVEQFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL +++G L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLIIEDGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYET 197
            +++  LVNW++V      
Sbjct: 180 STYLDKLVNWDFVAANLAA 198


>gi|292901114|ref|YP_003540483.1| superoxide dismutase [Erwinia amylovora ATCC 49946]
 gi|291200962|emb|CBJ48101.1| superoxide dismutase [Mn] [Erwinia amylovora ATCC 49946]
          Length = 208

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 118/209 (56%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L +EE+I K 
Sbjct: 4   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+ FW  +K     G     L  AI+ +FGS + FK++  
Sbjct: 64  DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGG---DLKAAIERDFGSVDAFKAEFE 120

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYYL +
Sbjct: 121 KAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIIGLDVWEHAYYLKY 180

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  ++VNW+   E +  A 
Sbjct: 181 QNKRPDYIKAF-WDVVNWDRAAENFAAAK 208


>gi|187929872|ref|YP_001900359.1| Superoxide dismutase [Ralstonia pickettii 12J]
 gi|187726762|gb|ACD27927.1| Superoxide dismutase [Ralstonia pickettii 12J]
          Length = 233

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 124/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 42  MEHTLPPLPYAQDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEDIVKKS 101

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 102 SG---GVFNNAAQVWNHTFYWNGLKPQGGGAP-TGALADAINAKWGSFDKFKEEFTKTAI 157

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 158 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 217

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V + + 
Sbjct: 218 AF-WNLVNWDFVAKNFA 233


>gi|116872872|ref|YP_849653.1| manganese superoxide dismutase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741750|emb|CAK20874.1| manganese superoxide dismutase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 202

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 80/204 (39%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  ++   L     E ++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVANHPELASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL +G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDEANKRFDAAK 202


>gi|16330619|ref|NP_441347.1| superoxide dismutase [Synechocystis sp. PCC 6803]
 gi|2500827|sp|P77968|SODF_SYNY3 RecName: Full=Superoxide dismutase [Fe]
 gi|1653111|dbj|BAA18027.1| superoxide dismutase [Synechocystis sp. PCC 6803]
          Length = 199

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 127/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LPNLPY Y  L P +SK TLE+HHD HH  Y +N     +  ++ + S+E++I   
Sbjct: 1   MAYALPNLPYDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDNQSIEDVIKAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL+D I+ +FGSF+ F      A
Sbjct: 61  AGDASKAGIFNNAAQAWNHSFYWNCMKPGGGGQP-SGALADKINADFGSFDAFVEAFKQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NAENP+  G  P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNAENPMTAGQTPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LVNW++V      A
Sbjct: 180 ADFLGKLVNWDFVAANLAAA 199


>gi|152986717|ref|YP_001350273.1| superoxide dismutase [Pseudomonas aeruginosa PA7]
 gi|150961875|gb|ABR83900.1| superoxide dismutase [Pseudomonas aeruginosa PA7]
          Length = 193

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V + +  
Sbjct: 177 AF-WNLVNWDFVAKNFAA 193


>gi|21231716|ref|NP_637633.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66768158|ref|YP_242920.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188991295|ref|YP_001903305.1| superoxidase dismutase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|76364224|sp|P0C0F9|SODM_XANC8 RecName: Full=Superoxide dismutase [Mn]
 gi|110287676|sp|P0C0F8|SODM_XANCP RecName: Full=Superoxide dismutase [Mn]
 gi|21113418|gb|AAM41557.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66573490|gb|AAY48900.1| superoxide dismutase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167733055|emb|CAP51253.1| superoxidase dismutase [Xanthomonas campestris pv. campestris]
          Length = 203

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVMSPNGGGEP-KGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    K+ +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALSRFGSGWAWLSVTPDKKVVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V  RY  A+ 
Sbjct: 180 DYIGAFY-NVVNWDEVERRYHAAIA 203


>gi|329298188|ref|ZP_08255524.1| superoxide dismutase [Plautia stali symbiont]
          Length = 205

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 120/209 (57%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L ++E+I K 
Sbjct: 1   MSYSLPSLPYAYDVLEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFANLPVDELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ +  
Sbjct: 61  DQLPADKKGSLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIEKDFGSVEKFQEEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N +NPL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAAATRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAIAGVSGFPIIGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  N+VNW+    R+ +A 
Sbjct: 178 QNKRPDYIKAF-WNVVNWDEAAARFASAK 205


>gi|330807548|ref|YP_004352010.1| superoxide dismutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375656|gb|AEA67006.1| superoxide dismutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 207

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 112/207 (54%), Gaps = 7/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MAFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVDGTEYAGWPVEKLVSSV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFW  M    G      AL+ AI+   G  E F+    
Sbjct: 61  EQLPASLQAAVINQGGGHANHSLFWEVMTPRGGGQP-DGALAAAIEAQLGGIEGFREAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMKGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            YI +F  N++NW  V  RY+ A+ + 
Sbjct: 180 EYISAFY-NVINWPEVARRYQAALASS 205


>gi|77457078|ref|YP_346583.1| manganese and iron superoxide dismutase [Pseudomonas fluorescens
           Pf0-1]
 gi|77381081|gb|ABA72594.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf0-1]
          Length = 203

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MAFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFAEWPVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFW  M    G GK   AL+ AID+  G  + FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWEVMVP-GGGGKPDGALAKAIDEQLGGLDSFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW  V  RY+ A++
Sbjct: 180 EYISAFY-NVINWPQVAARYQAALV 203


>gi|300770194|ref|ZP_07080073.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300762670|gb|EFK59487.1| superoxide dismutase, manganese [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 203

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 125/205 (60%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY+ D L P++ KET+E HHD HH+ Y DN  K  +  +  +LSLEEI+   
Sbjct: 1   MAFQLEALPYASDALEPHIDKETMEIHHDRHHQAYVDNLNKAIAGTDAENLSLEEIVKNV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH LFW+ +  N G       L+ AID+ FGSF++ K  L  A +
Sbjct: 61  SKYSPAVRNNGGGHFNHGLFWSVLGANAGGQP-TGELAAAIDEAFGSFDELKKKLQEAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V  +GKL ++ T N +NPL++       P+LGIDVWEHAYYL ++ +R 
Sbjct: 120 GRFGSGWSWLIVGADGKLAVTSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+E+   N++NW+ V ERY  A  
Sbjct: 180 AYLEAIF-NVINWDAVAERYAAAKK 203


>gi|329888169|ref|ZP_08266767.1| superoxide dismutase Mn [Brevundimonas diminuta ATCC 11568]
 gi|328846725|gb|EGF96287.1| superoxide dismutase Mn [Brevundimonas diminuta ATCC 11568]
          Length = 204

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLA-SDAEMLHLSLEEIIIK 59
           M F LP LPY+YD L P + KET+ +HHD HH+ Y DN  K   +  E    SLE+I   
Sbjct: 1   MAFTLPPLPYAYDALEPAIDKETMTFHHDKHHQTYVDNLNKFVDATPEAQGKSLEDIFAI 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
                  + NN    +NH+LFW  +      G+    L+  ID   G  +KFK+D   A 
Sbjct: 61  MSKLPKPIRNNGGGVWNHSLFWELLAPVGAGGEPSAELAAKIDAELGGMDKFKADFDAAG 120

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           + QFGSGW WL +++GKL+++ T N +NPL++        +L  DVWEHAYYL ++ RR 
Sbjct: 121 AGQFGSGWAWLILQDGKLKVTSTPNQDNPLMDDAAEKGAVLLAADVWEHAYYLKYQNRRV 180

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++F  ++VNW  V E YE A 
Sbjct: 181 DYLKAF-WSVVNWNKVNELYEAAK 203


>gi|298246032|ref|ZP_06969838.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
 gi|297553513|gb|EFH87378.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
          Length = 205

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 76/207 (36%), Positives = 114/207 (55%), Gaps = 7/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y  L PY+  +T++ HHD HH  Y  N        E  +L ++E++ + 
Sbjct: 1   MAFELPPLPYDYKALEPYIDTQTMQLHHDKHHATYVTNLNNALQGHEFANLPVDEVLRRI 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +     +   + NN   + NH +FW  M  N G       +++AI+  FGSF+ FK+   
Sbjct: 61  NEVPESARTAVRNNGGGHSNHTMFWQIMGPNAGGQP-TGEIANAINAKFGSFDNFKNAFN 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A + +FGSGW WL +     LE+  T N ++PL+    P++G DVWEHAYYL ++ RR 
Sbjct: 120 DAGAKRFGSGWAWLVIDRNGNLEVISTANQDSPLMESLFPVMGNDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            Y+ +   N+VNW  V +RY  A  A+
Sbjct: 180 EYLNA-WWNVVNWNEVNKRYAQARGAK 205


>gi|300867903|ref|ZP_07112543.1| Superoxide dismutase [Oscillatoria sp. PCC 6506]
 gi|300334040|emb|CBN57719.1| Superoxide dismutase [Oscillatoria sp. PCC 6506]
          Length = 252

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 113/203 (55%), Gaps = 8/203 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY Y+ L P++   T+++HHD HH  Y  N     +    L     E +++   
Sbjct: 51  FTLPPLPYEYNALEPHIDARTMQFHHDKHHAAYVKNLNDAINKHSQLKGKSAEALLRDIN 110

Query: 63  S-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S        + NN   + NH +FW  M    G G+   A++ AI+  FGS + FK     
Sbjct: 111 SVPEDIRTVVRNNGGGHVNHTMFWEIMSP-KGGGEPTGAIATAINQTFGSVDAFKQQFND 169

Query: 118 AASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A + +FGSGW WL   KNG+LEI+ T N ++PL+ G  PI+G DVWEHAYYL ++  R  
Sbjct: 170 AGTKRFGSGWVWLVRNKNGRLEITTTANQDSPLMEGNYPIMGNDVWEHAYYLKYQNLRGD 229

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+++   N+VNW  + +RYE A+
Sbjct: 230 YLKA-WWNVVNWPAINQRYEQAI 251


>gi|237798593|ref|ZP_04587054.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021446|gb|EGI01503.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 203

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y  N        E    S+E+++   
Sbjct: 1   MSYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYITNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G FE+FK    
Sbjct: 61  SQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPQGAIAAAIDEQLGGFERFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FG GW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGRGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW  V  RYE A+ 
Sbjct: 180 EYINAFY-NVINWNEVARRYEAALA 203


>gi|288958297|ref|YP_003448638.1| superoxide dismutase Fe-Zn [Azospirillum sp. B510]
 gi|288910605|dbj|BAI72094.1| superoxide dismutase Fe-Zn [Azospirillum sp. B510]
          Length = 197

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 100/199 (50%), Positives = 130/199 (65%), Gaps = 4/199 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L+PY+S ETL  HHD HH+ Y  N   L  D  +   SLEE+I  +
Sbjct: 1   MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLADASLEEVIKAA 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNNA+Q +NH  FW C+KK    GK+P AL   I  +FGS EKFK +L  A
Sbjct: 61  AGDASKVGIFNNAAQVWNHTFFWQCLKK--DGGKIPAALEQRIVADFGSVEKFKEELTQA 118

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL +   KL++ KT NA+ PL +G  P+  IDVWEHAYY+DF+ RRA ++
Sbjct: 119 ALTQFGSGWAWLYLDGDKLKVGKTGNADTPLAHGHKPLFTIDVWEHAYYVDFQNRRADFV 178

Query: 179 ESFITNLVNWEYVCERYET 197
           ++ I NL NW++  E+   
Sbjct: 179 KAVIDNLANWDFAAEQLAA 197


>gi|241663981|ref|YP_002982341.1| superoxide dismutase [Ralstonia pickettii 12D]
 gi|309781427|ref|ZP_07676163.1| superoxide dismutase [Fe] [Ralstonia sp. 5_7_47FAA]
 gi|240866008|gb|ACS63669.1| Superoxide dismutase [Ralstonia pickettii 12D]
 gi|308919840|gb|EFP65501.1| superoxide dismutase [Fe] [Ralstonia sp. 5_7_47FAA]
          Length = 233

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 124/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 42  MEHTLPPLPYAQDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEDIVKKS 101

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 102 SG---GVFNNAAQVWNHTFYWNGLKPQGGGAP-TGALADAINAKWGSFDKFKEEFTKTAI 157

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 158 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 217

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V + + 
Sbjct: 218 AF-WNLVNWDFVAKNFA 233


>gi|332519382|ref|ZP_08395849.1| Manganese/iron superoxide dismutase-like protein [Lacinutrix
           algicola 5H-3-7-4]
 gi|332045230|gb|EGI81423.1| Manganese/iron superoxide dismutase-like protein [Lacinutrix
           algicola 5H-3-7-4]
          Length = 202

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +   T+E HH  HH  Y           E+   ++E I++  
Sbjct: 1   MAFELPKLKYAYDALEPNIDARTMEIHHTKHHNGYTTKLNNAIEGTELEGKTIENILLNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH+LFW  M   + KG++   L DAI+  F S + FK     AA+
Sbjct: 61  DMENKAVRNNGGGFYNHSLFWDVMNP-EDKGRLSGELKDAIEAEFESVDAFKDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F   ++NW  V  RY  A 
Sbjct: 180 DYIDAFF-KVINWNEVERRYAEAK 202


>gi|114570445|ref|YP_757125.1| superoxide dismutase [Maricaulis maris MCS10]
 gi|114340907|gb|ABI66187.1| Superoxide dismutase [Maricaulis maris MCS10]
          Length = 201

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 93/201 (46%), Positives = 125/201 (62%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY+ D L+P++S +TL++HH  HH  Y      L    ++  LSLE++I K+
Sbjct: 1   MAFTLPDLPYAKDALAPHISSQTLDFHHGKHHNAYVGKLNGLVEGTDLAALSLEDVIKKT 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G+   AG+FNNA+Q +NH  +W  M+ N G       L+  ID +FGS + FK+    A
Sbjct: 61  AGNSAKAGIFNNAAQIWNHTFYWQSMRPNGGGAP-SGDLAAMIDRDFGSLDAFKTAFADA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WL +  GKLE+ KT NAE PL      P+L +DVWEHAYYLDF+ RR  Y
Sbjct: 120 GATQFGSGWAWLVLAGGKLEVRKTLNAETPLTEDGVTPLLTMDVWEHAYYLDFQNRRPDY 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I +F+  LVNWE+  E    A
Sbjct: 180 ITTFLDKLVNWEFAAENLAAA 200


>gi|315303173|ref|ZP_07873835.1| superoxide dismutase, Mn [Listeria ivanovii FSL F6-596]
 gi|313628457|gb|EFR96928.1| superoxide dismutase, Mn [Listeria ivanovii FSL F6-596]
          Length = 202

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +    L     E ++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NWE   +R++ A 
Sbjct: 180 EYIDTF-WNVINWEEANKRFDAAK 202


>gi|289434723|ref|YP_003464595.1| superoxide dismutase, Mn [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170967|emb|CBH27509.1| superoxide dismutase, Mn [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|313633255|gb|EFS00122.1| superoxide dismutase, Mn [Listeria seeligeri FSL N1-067]
          Length = 202

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +    L     E ++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKTAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NWE   +R++ A 
Sbjct: 180 EYIDTF-WNVINWEEANKRFDAAK 202


>gi|241896766|dbj|BAH79725.1| alcohol oxidase [Paenibacillus sp. AIU 311]
          Length = 205

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 115/203 (56%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY  D L P++  +T+E HHD HH  Y  N      +A  L     E +I  
Sbjct: 1   MAFQLPPLPYPNDALEPHIDAQTMEIHHDRHHNTYVTNLNAALENAPELQNKSLEELISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +    G  K    L+ AID   G  +KFK + 
Sbjct: 61  LDSVPENIRTAVRNNGGGHANHSLFWEIIAP-KGGDKPNGLLAQAIDSELGGLDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V KNGKL ++ T N +NPL+ G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVDKNGKLAVTSTPNQDNPLMEGQTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYET 197
             YI +F  N++NW+ V +RY+ 
Sbjct: 180 PDYIAAF-WNVLNWDVVSKRYQE 201


>gi|86131066|ref|ZP_01049665.1| Superoxide dismutase [Dokdonia donghaensis MED134]
 gi|85818477|gb|EAQ39637.1| Superoxide dismutase [Dokdonia donghaensis MED134]
          Length = 202

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 84/202 (41%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P +  +T+E HH  HH  Y +         ++   ++E I+I  
Sbjct: 1   MSFTLPELPYAKDALEPNIDAKTMEIHHGKHHAGYTNKLNNAIEGTDLEGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH LFW  M   DG G+    L++AI+  +G+FE FK    +AA 
Sbjct: 61  DMSNTAVRNNGGGFYNHRLFWEVMSP-DGGGEPTGELAEAINAAYGNFESFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V   GK+E+  T N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPKVGCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NWE V   Y  
Sbjct: 180 DYVNAFF-NVINWEKVSALYAQ 200


>gi|237847750|gb|ACR23311.1| manganese superoxide dismutase [Hemibarbus mylodon]
 gi|237847752|gb|ACR23312.1| manganese superoxide dismutase [Hemibarbus mylodon]
          Length = 224

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 102/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++  E ++ HH  HH  Y +N        +   +     +     
Sbjct: 28  HTLPDLPYDYGALEPHICAEIMQLHHSKHHATYVNNLNVTEEKYQEALVKG--DVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A    
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLEAIKRDFGSFQKMKEKMSAATVAV 144

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  +  NG+L I+   N +      G +P+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGFNKDNGRLRIAACPNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYVK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+VNWE V ER++TA  
Sbjct: 205 A-IWNVVNWENVNERFQTAKK 224


>gi|134640|sp|P23744|SODF_METJ RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|95281|pir||A38461 superoxide dismutase (EC 1.15.1.1) (Fe/Mn) - Methylomonas sp
          Length = 202

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            + LP L Y+Y  L P++  +T+E HH  HH+ Y +N           +  +E ++ K  
Sbjct: 1   AYTLPPLDYAYTALEPHIDAQTMEIHHTKHHQTYINNVNAALEGTSFANEPVEALLQKLD 60

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                    + NN   + NH+LFW  +  N G      AL+DAI  + G  + FK     
Sbjct: 61  SLPENLRGPVRNNGGGHANHSLFWKVLTPNGGGEP-KGALADAIKSDIGGLDTFKEAFTK 119

Query: 118 AASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           AA T+FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR  
Sbjct: 120 AALTRFGSGWAWLSVTPEKKLVVESTGNQDSPLSTGNTPILGLDVWEHAYYLKYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI +F  N+VNW+ V  RY+ A+ 
Sbjct: 180 YIGAFF-NVVNWDEVSRRYQEALA 202


>gi|300869320|ref|ZP_07113911.1| Superoxide dismutase (Fe) [Oscillatoria sp. PCC 6506]
 gi|300332697|emb|CBN59109.1| Superoxide dismutase (Fe) [Oscillatoria sp. PCC 6506]
          Length = 201

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 100/201 (49%), Positives = 130/201 (64%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLS-PYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP LPY  + L    MS +T  +HHD HH  Y  N  KL    E+   SLEEI+  
Sbjct: 1   MAFELPPLPYPDNALESGNMSAKTFSFHHDKHHAAYVTNLNKLIEGTELADKSLEEIVSA 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW+C+K   G G    AL+D I  +FGSF+KFK +   
Sbjct: 61  SFKDSSKAGIFNNAAQVWNHTFFWSCLKP-GGGGVPTGALADKITADFGSFDKFKEEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL + NG L+++KT NAENPL++G  P+L +DVWEHAYYLDF+ RR  +
Sbjct: 120 AAATQFGSGWAWLVLDNGTLKVTKTANAENPLVHGQTPLLTLDVWEHAYYLDFQNRRPDF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I +F+ NL NW++  E    A
Sbjct: 180 IANFLDNLANWDFAAENLAKA 200


>gi|171910681|ref|ZP_02926151.1| Superoxide dismutase [Verrucomicrobium spinosum DSM 4136]
          Length = 201

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 106/203 (52%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY    L P++  +T+E HH  HH  Y  N     +    L     + + K+
Sbjct: 1   MAHTLPPLPYDKAALEPHIDAQTMEIHHGRHHNAYVTNLNNAIAGNAQLEALSIDELNKN 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                 G    + NN   ++NH  FW  M  N G       L+ AID  FGSF+ FK   
Sbjct: 61  INSVPEGIRTAVRNNGGGHWNHTFFWNIMAPNAGGAP-KGELAAAIDAAFGSFDAFKEAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN-GAIPILGIDVWEHAYYLDFKYRR 174
             A   +FGSGW WL  K+GK+ I+ T N +NPL++    P+LGIDVWEHAYYL ++ +R
Sbjct: 120 AKAGVGRFGSGWAWLVKKDGKVAITSTPNQDNPLMDGSGTPLLGIDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYET 197
             YI +   N+VNW+ V ER+  
Sbjct: 180 PDYIAA-WWNVVNWDAVAERFAA 201


>gi|108758510|ref|YP_632987.1| superoxide dismutase, Fe [Myxococcus xanthus DK 1622]
 gi|108462390|gb|ABF87575.1| superoxide dismutase, Fe [Myxococcus xanthus DK 1622]
          Length = 193

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 103/196 (52%), Positives = 138/196 (70%), Gaps = 4/196 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY  D L+P+MS ETLE+HHD HH  Y +N  KL       + SLEE+I+ S
Sbjct: 1   MSFTLPDLPYKKDALAPHMSAETLEFHHDKHHAAYVNNLNKLLDGKPEANKSLEEVILSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW CMK   G GK    L+ AID +FGSFEKFK +  TAA+
Sbjct: 61  DG---GVFNNAAQVWNHTFFWQCMKP-AGGGKPTGELAAAIDRDFGSFEKFKEEFSTAAA 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL ++ GKL+++KT NA+ P+ +G   +L IDVWEHAYY+DF+  R  +IE+
Sbjct: 117 TQFGSGWAWLVLEGGKLKVTKTGNADLPMKHGQKALLTIDVWEHAYYIDFRNARPKFIET 176

Query: 181 FITNLVNWEYVCERYE 196
           F+T+LVNW++V + ++
Sbjct: 177 FLTHLVNWDFVAQNFK 192


>gi|308067487|ref|YP_003869092.1| superoxide dismutase [Paenibacillus polymyxa E681]
 gi|305856766|gb|ADM68554.1| Superoxide dismutase [Paenibacillus polymyxa E681]
          Length = 204

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 84/206 (40%), Positives = 118/206 (57%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+ D L P++   T+E HHD HH  Y  N       A  L     E +I  
Sbjct: 1   MAFQLPELPYAKDALEPHIDALTVEIHHDRHHNTYVTNLNAALESAPELQSKSLEDLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+LFW  +  N G      A+++AI++  G ++KFK D 
Sbjct: 61  LDSVPESIRTAVRNNGGGHHNHSLFWEVIAPNGGGQP-TGAIAEAINNELGGYDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V K+GKL I+ T N ++PL  G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVGKDGKLAITSTPNQDSPLFEGLTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N++NW+ V +RY  A  
Sbjct: 180 PDYIAAFY-NVINWDEVNKRYAAAKK 204


>gi|146308342|ref|YP_001188807.1| superoxide dismutase [Pseudomonas mendocina ymp]
 gi|145576543|gb|ABP86075.1| Superoxide dismutase [Pseudomonas mendocina ymp]
          Length = 193

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFSKVSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V + Y  
Sbjct: 177 AF-WNLVNWDFVAQNYAA 193


>gi|313637839|gb|EFS03174.1| superoxide dismutase, Mn [Listeria seeligeri FSL S4-171]
          Length = 202

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  +    L     E ++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSIPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGN-LKTAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NWE   +R++ A 
Sbjct: 180 EYIDTF-WNVINWEEANKRFDAAK 202


>gi|304366258|gb|ADM26563.1| manganese superoxide dismutase [Hypophthalmichthys nobilis]
          Length = 224

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 71/200 (35%), Positives = 100/200 (50%), Gaps = 7/200 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGS 63
            LP+LPY Y  L P++  E ++ HH  HH  Y +N        +         +      
Sbjct: 29  TLPDLPYDYGALEPHICAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTTQVSL 86

Query: 64  NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQF 123
              L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A     
Sbjct: 87  QPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLEAIKRDFGSFQKMKEKMSAATVAVQ 145

Query: 124 GSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           GSGWGWL  +  +G+L I+   N +      G +P+LGIDVWEHAYYL +K  R  Y+++
Sbjct: 146 GSGWGWLGFNKDSGRLRIAACANQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYVKA 205

Query: 181 FITNLVNWEYVCERYETAML 200
            I N+VNWE V ER++ A  
Sbjct: 206 -IWNVVNWENVNERFQAAKK 224


>gi|225873861|ref|YP_002755320.1| superoxide dismutase, Mn [Acidobacterium capsulatum ATCC 51196]
 gi|225794318|gb|ACO34408.1| superoxide dismutase, Mn [Acidobacterium capsulatum ATCC 51196]
          Length = 203

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY Y  L P++  ET++ HHD HH+ Y +N          L     E +++ 
Sbjct: 1   MAHELPPLPYDYSALEPHIDAETMKLHHDKHHQAYINNLNAALEKHPDLASKSAEDLLRD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH +FW  MK N G      A++  I+ +FG+FE FK+  
Sbjct: 61  LNSVPEDIRTAVRNNGGGHVNHTMFWKIMKPNGGGAP-TGAIAQQIEKDFGTFEDFKTAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
              A+ QFGSGWGWL    GKL+I  T N ++PL  G  PILG DVWEHAYYL ++ +R 
Sbjct: 120 NGTAAKQFGSGWGWLIWDGGKLKIISTPNQDSPLSQGFFPILGNDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +   N VNW+ V  R+E A  
Sbjct: 180 DYLAA-WWNTVNWDEVNHRFEHAKK 203


>gi|110636534|ref|YP_676741.1| superoxide dismutase, manganese [Cytophaga hutchinsonii ATCC 33406]
 gi|110279215|gb|ABG57401.1| superoxide dismutase, manganese [Cytophaga hutchinsonii ATCC 33406]
          Length = 209

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 84/201 (41%), Positives = 112/201 (55%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P + + T+E HH  HH  Y  N        +   LS+EEI    
Sbjct: 1   MAFELPALPYATNALEPNIDQATMEIHHGKHHNAYVTNLNNAIKGTDAESLSIEEICKNI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH+LFW  +  N G       L+ AID  FGSF+ FK     A +
Sbjct: 61  SKYTPAIRNNGGGHFNHSLFWTVIGPNAGGTP-TGELATAIDKAFGSFDAFKEQFAAAGA 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL V NG+L+I+ T N +NPL++       PILG+DVWEHAYYL ++ RR  
Sbjct: 120 TRFGSGWAWLVVANGELKITSTPNQDNPLMDIAEVKGTPILGLDVWEHAYYLKYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNW  V   Y  
Sbjct: 180 YIAAF-WNVVNWSKVSALYSA 199


>gi|226355653|ref|YP_002785393.1| superoxide dismutase [Deinococcus deserti VCD115]
 gi|226317643|gb|ACO45639.1| putative superoxide dismutase [Deinococcus deserti VCD115]
          Length = 207

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 122/209 (58%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+YD L P++   T+E HH  HH+ Y DNA K    +E+  L +EE+I K 
Sbjct: 1   MAYELPQLPYAYDALEPHIDTRTMEIHHTKHHQAYVDNANKALEGSELASLPVEELIQKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +      G+    L +AI+  FGSFE FK+   
Sbjct: 61  DQVPADKKTALRNNAGGHANHSLFW-QVMGPGQGGQPSGELMEAINAAFGSFEAFKTKFE 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA T+FGSGW WL VK+G L +  T N +NPL+          P+LG+DVWEHAYYL++
Sbjct: 120 DAAKTRFGSGWAWLVVKDGSLTVVSTANQDNPLMGEAIAGVSGTPVLGVDVWEHAYYLNY 179

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  Y+ +F  N+VNW+ V  RY  A 
Sbjct: 180 QNKRPDYLTAF-WNVVNWDEVSRRYAAAR 207


>gi|289550676|ref|YP_003471580.1| Manganese superoxide dismutase ; Superoxide dismutase (Fe)
           [Staphylococcus lugdunensis HKU09-01]
 gi|315658171|ref|ZP_07911043.1| superoxide dismutase [Staphylococcus lugdunensis M23590]
 gi|289180208|gb|ADC87453.1| Manganese superoxide dismutase ; Superoxide dismutase (Fe)
           [Staphylococcus lugdunensis HKU09-01]
 gi|315496500|gb|EFU84823.1| superoxide dismutase [Staphylococcus lugdunensis M23590]
          Length = 200

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 111/204 (54%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY  D L P++ KET+E HHD HH  Y           ++   S+EEII   
Sbjct: 1   MAFELPKLPYEADALEPHIDKETMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS ++FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWEFLTPNSEEKGTVV---DKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NGKLEI  T N +NPL  G  PIL IDVWEHAYYL ++ +R  
Sbjct: 118 DKAAGRFGSGWAWLVVNNGKLEIVTTPNQDNPLTEGKTPILCIDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI +F  N++NWE V E Y  A  
Sbjct: 178 YISAF-WNVINWEKVDELYNEAQK 200


>gi|294664935|ref|ZP_06730250.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605305|gb|EFF48641.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 203

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV   K L +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKRLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|33320069|gb|AAQ05797.1|AF478456_1 Fe-superoxide dismutase [Thalassiosira weissflogii]
          Length = 201

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 124/202 (61%), Gaps = 8/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY++D L P +   T+E HHD HH  Y        +  ++   S+ E ++  
Sbjct: 1   MAFELPDLPYAFDALEPNIDARTMEIHHDKHHAGYTSKLNGAVAGTDLEGKSI-EALLAD 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +  N  + NN   YYNHNLFW  M   DG G+    L+DAI++  GSF++FK+    AA+
Sbjct: 60  NSDNGAIRNNGGGYYNHNLFWTVMSP-DGGGEPTGELADAINEACGSFDEFKTAFSNAAA 118

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V+  GK+E+  + N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 119 TRFGSGWAWLCVQAGGKVEVCSSANQDNPLMPGIGCGGTPILGLDVWEHAYYLNYQNRRP 178

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N++NW+ V  RY  
Sbjct: 179 DYINAFF-NVINWDEVARRYAA 199


>gi|310640254|ref|YP_003945012.1| superoxide dismutase [Paenibacillus polymyxa SC2]
 gi|309245204|gb|ADO54771.1| Superoxide dismutase [Paenibacillus polymyxa SC2]
          Length = 204

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 84/206 (40%), Positives = 117/206 (56%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+ D L P+    T+E HHD HH  Y  N       A  L     E +I  
Sbjct: 1   MAFQLPELPYAKDALEPHFDALTMEIHHDRHHNTYVTNLNAALESAPELQSKSLEDLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+LFW  +  N G      A+++AI++  G ++KFK D 
Sbjct: 61  LDSVPESIRTAVRNNGGGHHNHSLFWEVIGPNGGGQP-TGAIAEAINNELGGYDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WL V K+GKL I+ T N ++PL  G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 TKAATTRFGSGWAWLVVGKDGKLAITSTPNQDSPLFEGLTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N++NW+ V +RY  A  
Sbjct: 180 PDYIAAFY-NVINWDEVNKRYAAAKK 204


>gi|228476019|ref|ZP_04060727.1| superoxide dismutase [Staphylococcus hominis SK119]
 gi|314936326|ref|ZP_07843673.1| superoxide dismutase, Mn [Staphylococcus hominis subsp. hominis
           C80]
 gi|228269842|gb|EEK11322.1| superoxide dismutase [Staphylococcus hominis SK119]
 gi|313654945|gb|EFS18690.1| superoxide dismutase, Mn [Staphylococcus hominis subsp. hominis
           C80]
          Length = 200

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY+ D L P++ KET+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYAADALEPHIDKETMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS ++FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NGKLEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGKLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI +F  N+VNWE V E Y  A  
Sbjct: 178 YISAF-WNVVNWEKVDELYNAATK 200


>gi|328950929|ref|YP_004368264.1| Manganese/iron superoxide dismutase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451253|gb|AEB12154.1| Manganese/iron superoxide dismutase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 205

 Score =  208 bits (528), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 84/204 (41%), Positives = 117/204 (57%), Gaps = 8/204 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            FKLP L Y+YD L P++   T+E HH  HH+ Y +N          LH +  E +++  
Sbjct: 4   PFKLPELGYAYDALEPHIDARTMEIHHTKHHQAYVNNLNAALEKHPYLHGAGLEALLRNL 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +     +     AL+ AI + FGSFE FK    
Sbjct: 64  AALPEEIQTAVRNNGGGHANHSLFWEVIAPGGSREP-TGALAQAIQETFGSFEAFKERFA 122

Query: 117 TAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA+T+FGSGW WL+V   GKL +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 123 KAAATRFGSGWAWLAVDAFGKLHVFSTANQDSPLMQGFTPILGLDVWEHAYYLKYQNRRP 182

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+VNW+ V ++YE A 
Sbjct: 183 EYIQAF-WNVVNWDVVAQKYEAAK 205


>gi|116073363|ref|ZP_01470625.1| superoxide dismutase [Synechococcus sp. RS9916]
 gi|116068668|gb|EAU74420.1| superoxide dismutase [Synechococcus sp. RS9916]
          Length = 199

 Score =  208 bits (528), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 91/200 (45%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPYS D L P++S+ TLE+HH  HH  Y  N  K     E+   SLE++I   
Sbjct: 1   MAHTLPQLPYSLDALEPHISRSTLEFHHGKHHNAYVTNLNKAIEGTELDGKSLEDVIAAV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G      AL + I+ +FGS++ F     TA
Sbjct: 61  AGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGQP-SGALLEKINADFGSYDAFVEQFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+I+KT NA+ PL +G   +L +DVWEHAYYLD++ RR  Y+
Sbjct: 120 GATQFGSGWAWLVLDNGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYM 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +++  LVNW++V      A
Sbjct: 180 TTYLEKLVNWDFVAANLAAA 199


>gi|27468158|ref|NP_764795.1| superoxide dismutase SodA [Staphylococcus epidermidis ATCC 12228]
 gi|57867086|ref|YP_188695.1| superoxide dismutase [Staphylococcus epidermidis RP62A]
 gi|242242825|ref|ZP_04797270.1| superoxide dismutase SodA [Staphylococcus epidermidis W23144]
 gi|251810970|ref|ZP_04825443.1| superoxide dismutase SodA [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876021|ref|ZP_06284888.1| superoxide dismutase, Mn [Staphylococcus epidermidis SK135]
 gi|293366486|ref|ZP_06613163.1| superoxide dismutase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|81674475|sp|Q5HNZ5|SODM_STAEQ RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|82583696|sp|P0C0Q6|SODM_STAES RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|15825381|gb|AAL09677.1|AF410177_1 superoxide dismutase [Staphylococcus epidermidis]
 gi|27315704|gb|AAO04839.1|AE016748_73 superoxide dismutase SodA [Staphylococcus epidermidis ATCC 12228]
 gi|57637744|gb|AAW54532.1| superoxide dismutase [Staphylococcus epidermidis RP62A]
 gi|242233726|gb|EES36038.1| superoxide dismutase SodA [Staphylococcus epidermidis W23144]
 gi|251805480|gb|EES58137.1| superoxide dismutase SodA [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295046|gb|EFA87573.1| superoxide dismutase, Mn [Staphylococcus epidermidis SK135]
 gi|291319255|gb|EFE59624.1| superoxide dismutase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319400889|gb|EFV89108.1| superoxide dismutase [Mn] [Staphylococcus epidermidis FRI909]
 gi|329725361|gb|EGG61844.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU144]
 gi|329735276|gb|EGG71568.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU045]
 gi|329737118|gb|EGG73372.1| superoxide dismutase, Mn [Staphylococcus epidermidis VCU028]
          Length = 199

 Score =  208 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 83/201 (41%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY+YD L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYAYDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLEAKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N    +    + D I + +GS ++FK +  
Sbjct: 61  DSVPSNIQTAVRNNGGGHLNHSLFWELLSPNS---EEKGEVVDKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNWE V E Y  
Sbjct: 178 YINAF-WNVVNWEKVNELYNA 197


>gi|159464723|ref|XP_001690591.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gi|158280091|gb|EDP05850.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gi|257071857|gb|ACV41089.1| chloroplast Fe superoxide dismutase 1 precursor [Chlamydomonas
           reinhardtii]
          Length = 234

 Score =  208 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 95/202 (47%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
             +L + PY+ D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S 
Sbjct: 34  ALELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLASW 93

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
             G    +FNNA+Q +NH  FW  MK N G      AL++AI  +FGS +KFK +   A 
Sbjct: 94  NNGQPTPVFNNAAQVWNHTFFWESMKPNGGGAP-TGALAEAITRDFGSLDKFKEEFKQAG 152

Query: 120 STQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            TQFGSGW WL+  K GKL ISK+ NA NP++ G  PIL +DVWEHAYY+D + RR  YI
Sbjct: 153 MTQFGSGWAWLNADKTGKLSISKSPNAVNPVVEGKTPILTVDVWEHAYYIDVQNRRPDYI 212

Query: 179 ESFITNLVNWEYVCERYETAML 200
            +F+  L+NW+ V +RY  A  
Sbjct: 213 TTFMEKLINWDAVAQRYAAATK 234


>gi|21243120|ref|NP_642702.1| superoxidase dismutase [Xanthomonas axonopodis pv. citri str. 306]
 gi|325928097|ref|ZP_08189310.1| superoxide dismutase [Xanthomonas perforans 91-118]
 gi|21108638|gb|AAM37238.1| superoxidase dismutase [Xanthomonas axonopodis pv. citri str. 306]
 gi|325541595|gb|EGD13124.1| superoxide dismutase [Xanthomonas perforans 91-118]
          Length = 203

 Score =  208 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|302185318|ref|ZP_07261991.1| superoxide dismutase [Pseudomonas syringae pv. syringae 642]
          Length = 203

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPKGAVASAIDEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYISAFY-NVINWDEVSRRYQAALA 203


>gi|289676075|ref|ZP_06496965.1| superoxide dismutase [Pseudomonas syringae pv. syringae FF5]
 gi|330981122|gb|EGH79225.1| superoxide dismutase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 203

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPSGAVASAIDEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|296112862|ref|YP_003626800.1| superoxide dismutase A [Moraxella catarrhalis RH4]
 gi|295920556|gb|ADG60907.1| superoxide dismutase A [Moraxella catarrhalis RH4]
 gi|326564552|gb|EGE14777.1| superoxide dismutase [Moraxella catarrhalis 12P80B1]
 gi|326564797|gb|EGE15009.1| superoxide dismutase [Moraxella catarrhalis 46P47B1]
 gi|326567555|gb|EGE17670.1| superoxide dismutase [Moraxella catarrhalis BC1]
 gi|326569403|gb|EGE19463.1| superoxide dismutase [Moraxella catarrhalis BC8]
 gi|326577387|gb|EGE27271.1| superoxide dismutase [Moraxella catarrhalis O35E]
          Length = 205

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 118/208 (56%), Gaps = 14/208 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP L YSYD L P+  KET+E HH  HH+ Y +NA  L    +    S EE+I   
Sbjct: 1   MAFTLPELGYSYDALEPHFDKETMEIHHSRHHQAYVNNANGLLEGTQWADKSAEEVIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                    G+ NNA  + NH+LFW  +K     G    +L DAI  +FGS E F+    
Sbjct: 61  DQIPADKRTGVRNNAGGHANHSLFWTILKTGTTLGG---SLKDAIVRDFGSVEAFQEQFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +  G L++  T N ++PL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAAASRFGSGWAWLVLDEGSLKVVSTANQDSPLMGEAVAGCKGYPIIGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETA 198
           + +R  YI++F   +VNW+   +R+++A
Sbjct: 178 QNKRPDYIKAF-WEVVNWDEAQKRFDSA 204


>gi|313107053|ref|ZP_07793256.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
 gi|310879758|gb|EFQ38352.1| superoxide dismutase [Pseudomonas aeruginosa 39016]
          Length = 203

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++   T+E HH  HH+ Y +N              +E ++ + 
Sbjct: 1   MPHALPPLPYAYDALEPHIDALTMEIHHSKHHQTYVNNLNAALEGTPYAEQPVESLLRQL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G+    L  AID+  G FE FK    
Sbjct: 61  AGLPEKLRTPVVNNGGGHANHSLFWTVMSP-QGGGRPDGDLGQAIDEQLGGFEAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV     L +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQGSLLVESSGNQDSPLMNGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWREVARRYAQALA 203


>gi|726293|gb|AAB04944.1| superoxide dismutase precursor [Chlamydomonas reinhardtii]
          Length = 234

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 95/202 (47%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
             +L + PY+ D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S 
Sbjct: 34  ALELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLASW 93

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
             G    +FNNA+Q +NH  FW  MK N G      AL++AI  +FGS +KFK +   A 
Sbjct: 94  NNGQPTPVFNNAAQVWNHTFFWESMKPNGGGAP-TGALAEAITRDFGSLDKFKEEFKQAG 152

Query: 120 STQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            TQFGSGW WL+  K GKL ISK+ NA NP++ G  PIL +DVWEHAYY+D + RR  YI
Sbjct: 153 MTQFGSGWAWLNADKTGKLSISKSPNAVNPVVEGKTPILTVDVWEHAYYIDVQNRRPDYI 212

Query: 179 ESFITNLVNWEYVCERYETAML 200
            +F+  L+NW+ V +RY  A  
Sbjct: 213 TTFMEKLINWDAVAQRYARATK 234


>gi|34558145|ref|NP_907960.1| superoxide dismutase [Wolinella succinogenes DSM 1740]
 gi|34483863|emb|CAE10860.1| SUPEROXIDE DISMUTASE [Wolinella succinogenes]
          Length = 232

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKS 60
            F L  LPY++D L P + KET++ HH  HH+ Y +N     +   E+  +SLE+I+ K 
Sbjct: 29  PFTLAPLPYAFDALEPAIDKETMQIHHGKHHQAYVNNLNAQVATYPELAKMSLEQIMAKI 88

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   +YNH LFW  M      G    AL+ AID +FGS +K K     A +
Sbjct: 89  SSYNMAVRNNGGGHYNHALFWTLMAPVGKGGTPSSALAKAIDRDFGSLDKMKEAFEKAGA 148

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW W+ V  + KL I+ T N +NPL++       PIL +DVWEHAYYL ++ RR 
Sbjct: 149 TRFGSGWAWVVVTADKKLAITSTPNQDNPLMDIAEVKGTPILALDVWEHAYYLKYQNRRG 208

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y++     +VNW  V + ++ A+ 
Sbjct: 209 DYLKE-WWKVVNWNEVNKLFDQAVK 232


>gi|58582335|ref|YP_201351.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624214|ref|YP_451586.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576182|ref|YP_001913111.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|1150790|gb|AAB47971.1| superoxide dismutase [Xanthomonas campestris]
 gi|58426929|gb|AAW75966.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368154|dbj|BAE69312.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520634|gb|ACD58579.1| superoxide dismutase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 203

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|53725863|ref|YP_103834.1| superoxide dismutase [Burkholderia mallei ATCC 23344]
 gi|52429286|gb|AAU49879.1| superoxide dismutase [Burkholderia mallei ATCC 23344]
          Length = 221

 Score =  207 bits (527), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 206 AF-WNIVNWDFAAKNFA 221


>gi|301154676|emb|CBW14139.1| superoxide dismutase, Mn [Haemophilus parainfluenzae T3T1]
          Length = 215

 Score =  207 bits (527), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 114/209 (54%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA  +          +       
Sbjct: 1   MSYTLPELGYAYDALEPHFDAQTMEIHHTKHHQAYVNNANAVLETLPAEFSEMCSGQLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
           ++          L NNA  + NH+LFW  +KK      +   L  AI+ +FGS E FK++
Sbjct: 61  QLDKIPAEKRTALRNNAGGHANHSLFWKSLKK---GTSLQGDLKAAIERDFGSVENFKAE 117

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYL 168
              AA+T+FGSGW WL +  GKL +  T N ++PL+          P+LG+DVWEHAYYL
Sbjct: 118 FEKAAATRFGSGWAWLVINQGKLSVVSTANQDSPLMGKEIAGCEGFPLLGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            F+ RR  YI+ F  N+VNW++V ER+  
Sbjct: 178 KFQNRRPDYIKEF-WNVVNWDFVAERFAK 205


>gi|148546228|ref|YP_001266330.1| superoxide dismutase [Pseudomonas putida F1]
 gi|148510286|gb|ABQ77146.1| Superoxide dismutase [Pseudomonas putida F1]
          Length = 241

 Score =  207 bits (527), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 39  MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAALEGTEWAEWPVEKLVAAV 98

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G   V Q L+ A+    G FE FK    
Sbjct: 99  KQLPENLRGAVTNHGGGHANHSLFWTVMSPQGGGEPVGQ-LAQAVTAQLGGFEAFKEAFT 157

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 158 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMHGNAPILGLDVWEHAYYLKYQNRRP 217

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 218 EYIGAFY-NVIDWVEVERRYLEALK 241


>gi|194334011|ref|YP_002015871.1| Superoxide dismutase [Prosthecochloris aestuarii DSM 271]
 gi|194311829|gb|ACF46224.1| Superoxide dismutase [Prosthecochloris aestuarii DSM 271]
          Length = 201

 Score =  207 bits (527), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 88/200 (44%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P+LPY+ + L PY+S  T+ +H+  HH  Y     ++ +   +   S+EE++   
Sbjct: 1   MAYQQPSLPYAENALEPYISANTISFHYGKHHATYVKKFNEMVAGTPLDQQSIEEVVKTV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH+ +W C+   DG GK   +L+D ID +FGS++ F+ +L  A
Sbjct: 61  AGDASKAGIFNNGAQAWNHSFYWNCLSP-DGGGKPSGSLADKIDQDFGSYDTFREELANA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+++KT NA+ P+  G  PIL IDVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVTKTANAQTPVTEGMTPILTIDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            S I NLVNW++    +E A
Sbjct: 180 ASLIDNLVNWDFATSNFEAA 199


>gi|71735545|ref|YP_276190.1| superoxide dismutase, Fe [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298488575|ref|ZP_07006605.1| Superoxide dismutase [Fe] [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|71556098|gb|AAZ35309.1| superoxide dismutase, Fe [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298156916|gb|EFH98006.1| Superoxide dismutase [Fe] [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322410|gb|EFW78503.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330122|gb|EFW86109.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330874913|gb|EGH09062.1| superoxide dismutase [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 193

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWECLAPNAGGEP-TGALAEAINTAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++E 
Sbjct: 177 AF-WNLVNWDFVAKQFEA 193


>gi|332686030|ref|YP_004455804.1| manganese superoxide dismutase [Melissococcus plutonius ATCC 35311]
 gi|332370039|dbj|BAK20995.1| manganese superoxide dismutase [Melissococcus plutonius ATCC 35311]
          Length = 203

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 112/204 (54%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP+LPY+YD L PY+  ET+  HHD HH  Y     +       L     E +I +
Sbjct: 1   MTYILPDLPYAYDALEPYIDTETMHLHHDKHHNTYVTKLNEAIEKHPELGNQSVEELITN 60

Query: 61  H-----GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  M  N G      A+ +AI+  FGSFEK K   
Sbjct: 61  MNAIPEDIRLAVRNNGGGHVNHSFFWKVMGPNAGGEP-TGAVKEAINQTFGSFEKMKEQF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+++FGSGW WL V KN KL I  T N ++PL+ G  PILG+DVWEHAYYL +K  R
Sbjct: 120 NAAAASRFGSGWAWLVVDKNKKLSILSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N+VNWE V   YE A
Sbjct: 180 PDYIAAF-WNVVNWEQVNRNYEAA 202


>gi|91215426|ref|ZP_01252397.1| SodA [Psychroflexus torquis ATCC 700755]
 gi|91186378|gb|EAS72750.1| SodA [Psychroflexus torquis ATCC 700755]
          Length = 202

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 88/202 (43%), Positives = 123/202 (60%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  L Y++D L P++  +T+E HH  HH  Y          +++   ++E I+I  
Sbjct: 1   MAFELQKLDYAHDALEPHIDAKTMEIHHGKHHAGYTQKLNTALEGSDLEGRTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NNA  +YNH+LFW  M    G GK    L+ AID++FGSF+ FK    TAA+
Sbjct: 61  DLSNNAVRNNAGGFYNHSLFWKVMSP-KGGGKPSGELAKAIDESFGSFDSFKDAFSTAAA 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL+V + GK+E+  T N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLTVHSGGKVEVCSTANQDNPLMPNVGQGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N++NWE V +RY  
Sbjct: 180 DYINAFF-NVINWEEVSKRYSE 200


>gi|330888626|gb|EGH21287.1| superoxide dismutase [Pseudomonas syringae pv. mori str. 301020]
 gi|330987086|gb|EGH85189.1| superoxide dismutase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 203

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAIEGTEFADWSVEKLVASI 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G ++ FK    
Sbjct: 61  KQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPKGAVALAIDEQLGGYDSFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPGKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|319952832|ref|YP_004164099.1| superoxide dismutase [Cellulophaga algicola DSM 14237]
 gi|319421492|gb|ADV48601.1| Superoxide dismutase [Cellulophaga algicola DSM 14237]
          Length = 202

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 92/202 (45%), Positives = 118/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+YD L P +   T+E HH  HH  Y  N     +  ++   S+E I+   
Sbjct: 1   MAFDLPKLPYAYDALEPNIDARTMEIHHTKHHNGYTTNLNNAIAGTDLESKSIETILDTL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SNA + NN   +YNH+LFW  M   DG GK    L+ AID  +GS E FK     AA+
Sbjct: 61  DMSNAAVRNNGGGFYNHSLFWEVMSP-DGGGKPTGELATAIDAAYGSLEAFKDAFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GK+EI  T N +NPL+     G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKVEICSTPNQDNPLMPGVGCGGFPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI +F  N++NW  V E Y  
Sbjct: 180 DYINAFF-NVINWNKVSELYAA 200


>gi|194366442|ref|YP_002029052.1| Superoxide dismutase [Stenotrophomonas maltophilia R551-3]
 gi|194349246|gb|ACF52369.1| Superoxide dismutase [Stenotrophomonas maltophilia R551-3]
          Length = 203

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P++   T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPKLSYAYDALEPHIDAATMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVRKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M  N G       ++ AID + G F+KFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVMAPNAGGNP-VGDVAKAIDKDLGGFDKFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    K+ +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKVVVESTGNQDSPLMEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY+ A+ 
Sbjct: 180 EYIGAFF-NVIDWNEVERRYQEAIA 203


>gi|83719621|ref|YP_441300.1| superoxide dismutase [Burkholderia thailandensis E264]
 gi|83653446|gb|ABC37509.1| superoxide dismutase [Burkholderia thailandensis E264]
          Length = 221

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 206 AF-WNIVNWDFAAKNFA 221


>gi|146263108|gb|ABQ15324.1| SodA [Yersinia rohdei]
          Length = 206

 Score =  207 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 84/210 (40%), Positives = 118/210 (56%), Gaps = 15/210 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASYSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+ FW  +K     G     L  AI+ +FGS EKF+ + 
Sbjct: 61  LDKVPADKRTFMRNNAGGHANHSFFWKGLKLGTSLGG---DLKAAIERDFGSVEKFQEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K+GKL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 FQNRRPDYIKAF-WNVVNWDEAAARFAQAK 206


>gi|66047379|ref|YP_237220.1| superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
 gi|4581922|gb|AAD24796.1|AF121078_2 manganese superoxide dismutase [Pseudomonas syringae pv. syringae]
 gi|63258086|gb|AAY39182.1| Superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AI++  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPTGAVASAINEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|238750257|ref|ZP_04611759.1| Superoxide dismutase [Mn] [Yersinia rohdei ATCC 43380]
 gi|238711490|gb|EEQ03706.1| Superoxide dismutase [Mn] [Yersinia rohdei ATCC 43380]
          Length = 208

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 84/210 (40%), Positives = 118/210 (56%), Gaps = 15/210 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASYSVEDLIKD 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+ FW  +K     G     L  AI+ +FGS EKF+ + 
Sbjct: 63  LDKVPADKRTFMRNNAGGHANHSFFWKGLKLGTSLGG---DLKAAIERDFGSVEKFQEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K+GKL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 180 FQNRRPDYIKAF-WNVVNWDEAAARFAQAK 208


>gi|76810291|ref|YP_332497.1| superoxide dismutase [Burkholderia pseudomallei 1710b]
 gi|76579744|gb|ABA49219.1| superoxide dismutase [Burkholderia pseudomallei 1710b]
          Length = 221

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L   +E  +L LEEI+ KS
Sbjct: 30  MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGSEFENLPLEEIVKKS 89

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 90  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 145

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 146 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 205

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 206 AF-WNIVNWDFAAKNFA 221


>gi|319944477|ref|ZP_08018751.1| superoxide dismutase [Lautropia mirabilis ATCC 51599]
 gi|319742438|gb|EFV94851.1| superoxide dismutase [Lautropia mirabilis ATCC 51599]
          Length = 210

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 82/212 (38%), Positives = 112/212 (52%), Gaps = 14/212 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P++  +T+E HH  HH+ Y +N       A +      E +I  
Sbjct: 1   MAYTLPKLGYAYDALEPHIDAQTMEIHHTKHHQTYVNNLNAALEGAGLPTDEPVEKLITR 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  M  N   GK   AL+ AID + G F+ FK   
Sbjct: 61  LDSLPEAIRGAVRNNGGGHANHTLFWTVMAPNK-GGKPTGALASAIDRDLGGFDAFKDAF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGA------IPILGIDVWEHAYYL 168
             AA T+FGSGW WLSV    KL +  + N ++PL+  A       P+LG+DVWEHAYYL
Sbjct: 120 TKAALTRFGSGWAWLSVSPEGKLVVESSANQDSPLMGKAAGASGNTPVLGLDVWEHAYYL 179

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI +F  N+VNW+ V  R++ A  
Sbjct: 180 HYQNRRPDYIAAFY-NVVNWDEVARRFDAAKA 210


>gi|289625675|ref|ZP_06458629.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647255|ref|ZP_06478598.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330870176|gb|EGH04885.1| superoxide dismutase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 193

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWECLAPNAGGEP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++E 
Sbjct: 177 AF-WNLVNWDFVAKQFEA 193


>gi|229093344|ref|ZP_04224453.1| Superoxide dismutase [Bacillus cereus Rock3-42]
 gi|228690068|gb|EEL43867.1| Superoxide dismutase [Bacillus cereus Rock3-42]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 115/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LP LPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPKLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|166711818|ref|ZP_02243025.1| superoxidase dismutase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AI+ + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAINKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|330937981|gb|EGH41764.1| superoxide dismutase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVGGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPSGAVASAIDEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|317405559|gb|EFV85863.1| superoxide dismutase [Achromobacter xylosoxidans C54]
          Length = 204

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 110/205 (53%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E HH  HH+ Y +N       A +      E ++  
Sbjct: 1   MAYTLPPLPYAYDALEPHIDALTMEIHHSKHHQTYVNNLNAALEGAGIATDEPVEALVAR 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW+ M    G G+   AL+ AID   G    F+   
Sbjct: 61  IDQLPEAVRGAVRNNGGGHANHSLFWSVMSP-RGGGEPDGALARAIDTELGGHAAFREAF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FGSGW WLSV    KL +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 TKAALTRFGSGWAWLSVTPAGKLAVESSANQDSPLMQGNTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+++W  V  RY  A+
Sbjct: 180 PEYIGAFY-NVIDWPEVARRYAAAV 203


>gi|172056895|ref|YP_001813355.1| superoxide dismutase [Exiguobacterium sibiricum 255-15]
 gi|171989416|gb|ACB60338.1| Superoxide dismutase [Exiguobacterium sibiricum 255-15]
          Length = 202

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/201 (42%), Positives = 118/201 (58%), Gaps = 6/201 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           F+LP L Y+YD L P++   T+E HH  HH  Y  N       +E    SLEE++     
Sbjct: 4   FELPELGYAYDALEPHIDARTMEIHHSKHHNTYVTNVNAALEGSEHEGKSLEELLQNLDS 63

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   ++NH+ FW  +KKNDG       L+ AID+ FGSF+ FK +   A
Sbjct: 64  LPANIQTAVRNNGGGHWNHSFFWKLLKKNDGAAP-TGELATAIDEAFGSFDAFKDEFTKA 122

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+T+FGSGW WL V  GKL +  T N + P++ G  PILG+DVWEHAYYL+++ RR  YI
Sbjct: 123 ATTRFGSGWAWLIVDGGKLAVVSTPNQDTPVMEGKTPILGLDVWEHAYYLNYQNRRPDYI 182

Query: 179 ESFITNLVNWEYVCERYETAM 199
            +F  N+V+W++V + Y  A 
Sbjct: 183 NAFF-NVVDWDHVAKLYADAK 202


>gi|297622786|ref|YP_003704220.1| Superoxide dismutase [Truepera radiovictrix DSM 17093]
 gi|297163966|gb|ADI13677.1| Superoxide dismutase [Truepera radiovictrix DSM 17093]
          Length = 198

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 118/198 (59%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP+LPY  D L P++  +T+E HHD HH  Y           E+  LS+EEI+ K 
Sbjct: 1   MAFNLPDLPYPTDALEPHIDAKTMEIHHDKHHGTYTTKLNDAVQGTELEGLSIEEILRKG 60

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           +    A + NN   YYNHNLFW  +    G G+    L++AI  +FGSF  FK     AA
Sbjct: 61  AENLPAAVRNNGGGYYNHNLFWEWLSP-QGGGEPTGELAEAIARDFGSFAAFKEKFSEAA 119

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           + +FGSGW WL  +NGKL I+ T N +NP++ G   ILG+DVWEHAYYL ++ RR  YI+
Sbjct: 120 ANRFGSGWAWLVSENGKLSITSTPNQDNPMMEGKHAILGLDVWEHAYYLKYQNRRPEYIQ 179

Query: 180 SFITNLVNWEYVCERYET 197
           +F  N+VNW  V E Y  
Sbjct: 180 AF-WNVVNWPKVSELYAQ 196


>gi|190575124|ref|YP_001972969.1| putative superoxide dismutase [Stenotrophomonas maltophilia K279a]
 gi|254523951|ref|ZP_05136006.1| superoxide dismutase [Mn] [Stenotrophomonas sp. SKA14]
 gi|190013046|emb|CAQ46678.1| putative superoxide dismutase [Mn] [Stenotrophomonas maltophilia
           K279a]
 gi|219721542|gb|EED40067.1| superoxide dismutase [Mn] [Stenotrophomonas sp. SKA14]
          Length = 203

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P++   T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPKLSYAYDALEPHIDAATMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVKKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M  N G       ++ AID + G F+KFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVMAPNAGGNP-VGDVAKAIDKDLGGFDKFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    K+ +  T N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKVVVESTGNQDSPLMEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY+ A+ 
Sbjct: 180 EYIGAFF-NVIDWNEVERRYQEAIA 203


>gi|319892606|ref|YP_004149481.1| superoxide dismutase [Staphylococcus pseudintermedius HKU10-03]
 gi|317162302|gb|ADV05845.1| superoxide dismutase [Staphylococcus pseudintermedius HKU10-03]
 gi|323464355|gb|ADX76508.1| superoxide dismutase [Staphylococcus pseudintermedius ED99]
          Length = 199

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPYSYD L P++ KET+E HH  HH  Y           E  + SLE++I   
Sbjct: 1   MAFELPKLPYSYDALEPHIDKETMEIHHSKHHNTYVTKLNAAVEGTEFENKSLEDLIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+++W  +  N    +    + D I + +GS ++FKS+  
Sbjct: 61  DSVPENLRTAVRNNGGGHLNHSIYWQILAPNS---EEKGEVVDKIKEQWGSLDEFKSEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NGKLEI  T N ++PL +G  PIL +DVWEHAYYL F+ +R  
Sbjct: 118 DKAAGRFGSGWAWLVVNNGKLEIVTTANQDSPLTDGLTPILALDVWEHAYYLKFQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y+ A 
Sbjct: 178 YISTF-WNVVNWEKVDELYKAAK 199


>gi|73535546|pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus
           Anthracis At 1.8a Resolution.
 gi|73535547|pdb|1XUQ|B Chain B, Crystal Structure Of Soda-1 (Ba4499) From Bacillus
           Anthracis At 1.8a Resolution
          Length = 212

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 10  MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 69

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 70  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 128

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 129 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 188

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 189 PDYIGAF-WNVVDWNAAEKRYQEAK 212


>gi|73662512|ref|YP_301293.1| superoxide dismutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123775360|sp|Q49XZ6|SODM_STAS1 RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|72495027|dbj|BAE18348.1| superoxide dismutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 199

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 112/203 (55%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY +D L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYGFDALEPHIDKQTMEIHHDKHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS + FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGNLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y  A 
Sbjct: 178 YISAF-WNVVNWEKVDELYNAAK 199


>gi|325921166|ref|ZP_08183035.1| superoxide dismutase [Xanthomonas gardneri ATCC 19865]
 gi|325548360|gb|EGD19345.1| superoxide dismutase [Xanthomonas gardneri ATCC 19865]
          Length = 203

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPVEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPEYLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|224476661|ref|YP_002634267.1| superoxide dismutase [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|75531945|sp|Q9F326|SODM_STACA RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|11121341|emb|CAC14833.1| superoxide dismutase [Staphylococcus carnosus]
 gi|222421268|emb|CAL28082.1| superoxide dismutase [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 201

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 117/205 (57%), Gaps = 9/205 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY +D L PY+ KET+E HHD HH  Y           ++ + S+EEI+   
Sbjct: 1   MAFELPNLPYEFDALEPYIDKETMEIHHDKHHNTYVTKLNAAIEGTDLENKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS +KFK +  
Sbjct: 61  DSVPSDIQTAVRNNGGGHLNHSLFWQLLTPNSEEKGTVI---DKIKEEWGSLDKFKDEFA 117

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A+ QFGSGW WL V K+GKLEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R 
Sbjct: 118 KKAAGQFGSGWAWLVVDKDGKLEIVSTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRP 177

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI++F  N+VNW  V E YE A  
Sbjct: 178 DYIDAF-WNVVNWNKVDELYEAATK 201


>gi|15599664|ref|NP_253158.1| superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|107099947|ref|ZP_01363865.1| hypothetical protein PaerPA_01000968 [Pseudomonas aeruginosa PACS2]
 gi|116052500|ref|YP_792813.1| superoxide dismutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893559|ref|YP_002442428.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
 gi|254238870|ref|ZP_04932193.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|254244718|ref|ZP_04938040.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|296391178|ref|ZP_06880653.1| superoxide dismutase [Pseudomonas aeruginosa PAb1]
 gi|2507402|sp|P53652|SODM_PSEAE RecName: Full=Superoxide dismutase [Mn]
 gi|9950704|gb|AAG07856.1|AE004860_12 superoxide dismutase [Pseudomonas aeruginosa PAO1]
 gi|1628613|gb|AAB17391.1| Mn superoxide dismutase [Pseudomonas aeruginosa]
 gi|115587721|gb|ABJ13736.1| superoxide dismutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170801|gb|EAZ56312.1| superoxide dismutase [Pseudomonas aeruginosa C3719]
 gi|126198096|gb|EAZ62159.1| superoxide dismutase [Pseudomonas aeruginosa 2192]
 gi|218773787|emb|CAW29601.1| superoxide dismutase [Pseudomonas aeruginosa LESB58]
          Length = 203

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++   T+E HH  HH+ Y +N              +E ++ + 
Sbjct: 1   MPHALPPLPYAYDALEPHIDALTMEIHHSKHHQTYVNNLNAALEGTPYAEQPVESLLRQL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G+    L  AID+  G FE FK    
Sbjct: 61  AGLPEKLRTPVVNNGGGHANHSLFWTVMSP-QGGGRPDGDLGRAIDEQLGGFEAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV     L +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQGSLLVESSGNQDSPLMNGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWREVARRYAQALA 203


>gi|325916979|ref|ZP_08179221.1| superoxide dismutase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536830|gb|EGD08584.1| superoxide dismutase [Xanthomonas vesicatoria ATCC 35937]
          Length = 203

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L ++E++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIDELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +    G G+    ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSP-KGGGEPKGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|254444538|ref|ZP_05058014.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Verrucomicrobiae bacterium DG1235]
 gi|198258846|gb|EDY83154.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Verrucomicrobiae bacterium DG1235]
          Length = 201

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 77/192 (40%), Positives = 113/192 (58%), Gaps = 6/192 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP L Y+YD L P++   T+E HH  HH+ Y +N   +    ++   S EE+I   
Sbjct: 1   MAYQLPELDYAYDALEPHIDARTMEIHHSKHHQTYINNVNGMIKGTDLESKSTEELIADL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                G  AG+ NNA  + NH+ FW  +  N G       L+ AID   G F+ FK    
Sbjct: 61  DAVPEGIRAGVRNNAGGHANHSFFWKIIGPNGGGAP-VGKLAAAIDAELGGFDAFKDAFA 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            A +T+FGSGW WL V++GKL +  T N ++P+++G  P+L +DVWEHAYYL+++ RR  
Sbjct: 120 KAGATRFGSGWAWLCVRDGKLCVCSTPNQDSPIMDGGKPVLALDVWEHAYYLNYQNRRPD 179

Query: 177 YIESFITNLVNW 188
           YI +F  ++VNW
Sbjct: 180 YIAAF-WSVVNW 190


>gi|317046317|ref|YP_004113965.1| Manganese/iron superoxide dismutase-like protein [Pantoea sp.
           At-9b]
 gi|316947934|gb|ADU67409.1| Manganese/iron superoxide dismutase-like protein [Pantoea sp.
           At-9b]
          Length = 208

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 83/212 (39%), Positives = 118/212 (55%), Gaps = 17/212 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD---AEMLHLSLEEII 57
           M + LP+LPY YD L P+  K+T+E HH  HH+ Y +NA          E   + +EE+I
Sbjct: 1   MSYSLPSLPYDYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLAGTEFDGIPVEELI 60

Query: 58  IKSHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
            K           L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ 
Sbjct: 61  AKLDKLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLQGELKAAIEKDFGSVEKFQE 117

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYY 167
           +   AA+T+FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYY
Sbjct: 118 EFEKAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           L ++ +R  YI++F  N+VNW+    R+ +A 
Sbjct: 178 LKYQNKRPDYIKAF-WNVVNWDEAAARFASAK 208


>gi|229180552|ref|ZP_04307894.1| Superoxide dismutase [Bacillus cereus 172560W]
 gi|228602976|gb|EEK60455.1| Superoxide dismutase [Bacillus cereus 172560W]
          Length = 203

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                  G    + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEGIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|113460609|ref|YP_718675.1| superoxide dismutase, manganese [Haemophilus somnus 129PT]
 gi|112822652|gb|ABI24741.1| superoxide dismutase, manganese [Haemophilus somnus 129PT]
          Length = 209

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 115/208 (55%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA        E   L   ++I K
Sbjct: 1   MAYTLPELGYAYDALEPHFDAQTMELHHSKHHQTYVNNANAALETLPEFTDLCPGQLITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +K       +   L DAI+ +FGS E F+++ 
Sbjct: 61  LVEVPADKRTAIRNNVGGHVNHSLFWKGLKT---GTTLQGPLKDAIERDFGSVESFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +  GKLE+  T N ++PL+          PIL +DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLNQGKLEVVSTANQDSPLMGKEIAGCEGFPILVLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  N+VNW+   ER+E 
Sbjct: 178 FQNRRPDYIKAF-WNVVNWDVAAERFEK 204


>gi|330950277|gb|EGH50537.1| superoxide dismutase [Pseudomonas syringae Cit 7]
          Length = 203

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M    G G    A++ AID+  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-GGGGLPTGAVALAIDEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPDKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|205373987|ref|ZP_03226787.1| hypothetical protein Bcoam_12417 [Bacillus coahuilensis m4-4]
          Length = 202

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/204 (41%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY+YD L P+  KET+  HH  HH  Y        +  + L     E +I  
Sbjct: 1   MAFELPQLPYAYDVLEPHFDKETMNIHHTKHHNAYVTKLNDALAGHDELLSKSVEEVIAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                  +   + NN   + NH+LFW  +  N G       L +AI++ FGSF++FKS  
Sbjct: 61  LDAVPESARTAVRNNGGGHANHSLFWTILSPNGGGNP-TGELGEAINNKFGSFDEFKSQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NG+LEI+ T N ++P++ G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 AAAAAGRFGSGWAWLIVNNGELEITSTPNQDSPIMEGKTPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N+V+W+ V  RY  A 
Sbjct: 180 DYIDAF-WNVVDWDAVNTRYNEAK 202


>gi|75532750|sp|Q9K4V3|SODM_STAXY RecName: Full=Superoxide dismutase [Mn/Fe]
 gi|8977980|emb|CAB95744.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861264|gb|AAS78514.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861270|gb|AAS78517.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861275|gb|AAS78520.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861278|gb|AAS78522.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861281|gb|AAS78524.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861284|gb|AAS78526.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861286|gb|AAS78527.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861289|gb|AAS78529.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 199

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 81/203 (39%), Positives = 111/203 (54%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY +D L P++ ++T+E HH  HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS + FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y  A 
Sbjct: 178 YISAF-WNVVNWEKVDELYNAAK 199


>gi|289665693|ref|ZP_06487274.1| superoxide dismutase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289671296|ref|ZP_06492371.1| superoxide dismutase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 203

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L ++E++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIDELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + +N   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRSNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|283787416|ref|YP_003367281.1| superoxide dismutase [Citrobacter rodentium ICC168]
 gi|282950870|emb|CBG90547.1| superoxide dismutase [Citrobacter rodentium ICC168]
          Length = 206

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 88/208 (42%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS EKFK + 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVEKFKEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|78048139|ref|YP_364314.1| superoxidase dismutase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|78036569|emb|CAJ24260.1| superoxidase dismutase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 203

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDVGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVERRYHAAIA 203


>gi|32474407|ref|NP_867401.1| Mn family superoxide dismutase [Rhodopirellula baltica SH 1]
 gi|32444945|emb|CAD74947.1| superoxide dismutase, Mn family [Rhodopirellula baltica SH 1]
          Length = 228

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 112/209 (53%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++   T+E HH  HH  Y        +  ++   S+EE+I   
Sbjct: 22  MAFTLPELPYAYDALEPHIDARTMEIHHSKHHNAYVTKTNDALAGTDLASKSIEEVISDL 81

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +      G     L+ AID+  GSF+ FK    
Sbjct: 82  SAVPDDKRGAVRNNGGGHANHSLFWT-VLGPGKGGSPSGDLAAAIDEACGSFDAFKEQFA 140

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL V  GKL +  T N ++PL+          PILG+DVWEHAYYL++
Sbjct: 141 NAAATRFGSGWAWLYVSGGKLHVGSTANQDSPLMGEAVAGIGGTPILGLDVWEHAYYLNY 200

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + RR  YI +F  N+V+W+ V  R+  A 
Sbjct: 201 QNRRPDYISAF-WNVVDWDAVATRFAAAK 228


>gi|170720167|ref|YP_001747855.1| superoxide dismutase [Pseudomonas putida W619]
 gi|169758170|gb|ACA71486.1| Superoxide dismutase [Pseudomonas putida W619]
 gi|313497284|gb|ADR58650.1| Superoxide dismutase [Pseudomonas putida BIRD-1]
          Length = 198

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 94/197 (47%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AF-WNLVNWAFVAEQFE 192


>gi|229592247|ref|YP_002874366.1| putative superoxide dismutase [Pseudomonas fluorescens SBW25]
 gi|229364113|emb|CAY51733.1| putative superoxide dismutase [Pseudomonas fluorescens SBW25]
          Length = 198

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|170076871|ref|YP_001733509.1| Mn-superoxide dismutase [Synechococcus sp. PCC 7002]
 gi|169884540|gb|ACA98253.1| Mn-superoxide dismutase [Synechococcus sp. PCC 7002]
          Length = 199

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP+LPY Y  L P++SK TLE+HHD HH +Y        +  +M   S+E++I   
Sbjct: 1   MGYELPSLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNDAVAGTDMDSKSIEDVIKAV 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               A    FNNA+Q +NH+ +W CMK   G      AL+D I+ +FGSF+KF     TA
Sbjct: 61  AADPAKAGLFNNAAQAWNHSFYWNCMKPGGGGQP-TGALADKINADFGSFDKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + NG L+++KT NA NP+  G  P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GGTQFGSGWAWLVLDNGTLKVTKTGNAGNPMTEGQTPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            +F+T+LVNW++V      A
Sbjct: 180 NTFLTSLVNWDFVAANLAAA 199


>gi|161505433|ref|YP_001572545.1| superoxide dismutase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866780|gb|ABX23403.1| hypothetical protein SARI_03588 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 210

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 87/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS EKFK + 
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVEKFKEEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAASRFGSGWAWLVLKGDKLSVVSTANQDSPLMGEVISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|330969681|gb|EGH69747.1| superoxide dismutase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 203

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 117/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E    S+E+++   
Sbjct: 1   MPYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFADWSVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH+LFW  M   DG G    A++ AI++  G +E FK    
Sbjct: 61  QQLPENLRPAVINQGGGHANHSLFWEVMVP-DGGGLPTGAVASAINEQLGGYESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW+ V  RY+ A+ 
Sbjct: 180 EYINAFY-NVINWDEVSRRYQAALA 203


>gi|58223330|gb|AAW69292.1| mitochondrial Mn superoxide dismutase [Haematococcus pluvialis]
 gi|62086773|gb|AAX63395.1| Mn superoxide dismutase [Haematococcus pluvialis]
          Length = 217

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/214 (37%), Positives = 108/214 (50%), Gaps = 13/214 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY++D L P++   T++ HH  HH+ Y  N          L       I K 
Sbjct: 1   MAFTLPALPYAFDALEPFVDATTMQIHHGKHHQAYVTNLNNALDKFPELKDLGIVDINKK 60

Query: 61  HGSNAGL-------FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
            G++A          NN   ++NH+ FW  M            L  A+D +FGS +  K 
Sbjct: 61  VGTDAIPKDIATVVRNNGGGHWNHSFFWKIMTAPTNSNGPSDELKAAVDASFGSMDVMKE 120

Query: 114 DLITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAI----PILGIDVWEHAYYL 168
               AA+ +FGSGW WL VK +G L I+ T N +NPL   A     P+LG+DVWEHAYYL
Sbjct: 121 KFNAAAAGRFGSGWAWLGVKADGSLGITSTPNQDNPLQGVADEALLPVLGLDVWEHAYYL 180

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAMLAQ 202
            ++ RR  YI +F  N+VNWE V E +  A    
Sbjct: 181 KYQNRRPEYIAAF-WNIVNWEQVSENFTAAKAGS 213


>gi|288550541|ref|ZP_05970846.2| hypothetical protein ENTCAN_09590 [Enterobacter cancerogenus ATCC
           35316]
 gi|288314739|gb|EFC53677.1| superoxide dismutase (Mn) [Enterobacter cancerogenus ATCC 35316]
          Length = 210

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 182 FQNRRPDYIKAF-WDVVNWDEAAARFAA 208


>gi|229086844|ref|ZP_04219006.1| Superoxide dismutase [Bacillus cereus Rock3-44]
 gi|228696488|gb|EEL49311.1| Superoxide dismutase [Bacillus cereus Rock3-44]
          Length = 203

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK++
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHVNHTFFWTILSPNGGGQP-VGELAAAIEAKFGSFDAFKAE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL ++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|77460707|ref|YP_350214.1| superoxide dismutase [Pseudomonas fluorescens Pf0-1]
 gi|77384710|gb|ABA76223.1| putative superoxide dismutase [Pseudomonas fluorescens Pf0-1]
          Length = 198

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 94/197 (47%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALAEAINAAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|146263098|gb|ABQ15319.1| SodA [Yersinia intermedia]
          Length = 206

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 117/210 (55%), Gaps = 15/210 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEELIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LDTTLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K+GKL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EAAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 FQNRRPDYIKAF-WNVVNWDEAAARFAQAK 206


>gi|110633218|ref|YP_673426.1| manganese and iron superoxide dismutase [Mesorhizobium sp. BNC1]
 gi|110284202|gb|ABG62261.1| manganese and iron superoxide dismutase [Chelativorans sp. BNC1]
          Length = 200

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 114/199 (57%), Positives = 148/199 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+LPY Y+ L PYMSKETLE+HHD HHK Y D   KLA++A + +LS+EEI+ +S
Sbjct: 1   MAFELPDLPYDYEALQPYMSKETLEFHHDKHHKAYVDTGNKLAAEAGLDNLSVEEIVKQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +G N  LFNNA Q++NH  FW  MKK  G   +P AL  AID + G ++KF++D + A  
Sbjct: 61  YGKNQPLFNNAGQHFNHVHFWKWMKKGGGGKSLPGALQTAIDSDLGGYDKFRNDFVQAGM 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW W++VKNGKLEI KT N ENPL++G  PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 TQFGSGWAWIAVKNGKLEIMKTPNGENPLVHGGAPILGVDVWEHSYYIDYRNARQKYLEA 180

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ NLVNW+YV E YE A 
Sbjct: 181 FVDNLVNWDYVLELYEKAR 199


>gi|262277969|ref|ZP_06055762.1| superoxide dismutase [Mn] [alpha proteobacterium HIMB114]
 gi|262225072|gb|EEY75531.1| superoxide dismutase [Mn] [alpha proteobacterium HIMB114]
          Length = 197

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 101/198 (51%), Positives = 132/198 (66%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP L Y+ D L+P MS+ETL+ HH  HH+ Y  N   L  D ++   SLE+II K 
Sbjct: 1   MAFELPKLNYANDALAPVMSQETLDLHHGKHHQTYVTNLNNLVKDTDLADASLEDIIKKT 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA Q++NH LFW CMK   G G +P  L   I  +FGS +KFK D I A
Sbjct: 61  AKDSSKAGIFNNAGQHWNHILFWKCMKP-KGGGAIPSELEKRIVSDFGSVDKFKEDFIQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL++ NGKL I+K+ NA NPL++   PILG DVWEH+YY+D++ RR  Y+
Sbjct: 120 GVTQFGSGWAWLAIDNGKLVITKSANASNPLVDNMKPILGCDVWEHSYYVDYRNRRPDYL 179

Query: 179 ESFITNLVNWEYVCERYE 196
           ++FI +LVNWE+V    +
Sbjct: 180 KAFINDLVNWEHVASLLD 197


>gi|78187086|ref|YP_375129.1| superoxide dismutase [Chlorobium luteolum DSM 273]
 gi|78166988|gb|ABB24086.1| Superoxide dismutase [Chlorobium luteolum DSM 273]
          Length = 200

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 86/201 (42%), Positives = 129/201 (64%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L P++S +TL +H+  HH  Y  N   L     +  + +E++I ++
Sbjct: 1   MAYQQPALPWAENALEPHISAKTLSFHYGKHHAAYVTNYNNLVGGTPLDEMPIEDVIAQT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  G+FNN +Q +NH+ +W C+  N G GK    L++AI+ +FG ++ F+ +L  A
Sbjct: 61  AGDSSKIGVFNNGAQAWNHSFYWNCLTPN-GGGKPSGELAEAIEKDFGGYDAFREELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL ++NG L+++KT NAE P+  G  PIL IDVWEHAYYLD++ RR  Y 
Sbjct: 120 AATQFGSGWAWLVLENGTLKVAKTANAETPMTKGMKPILTIDVWEHAYYLDYQNRRPDYT 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
            + I NL+NWE+  E Y  A 
Sbjct: 180 AAVIDNLINWEFAEENYTAAR 200


>gi|294624423|ref|ZP_06703112.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292601272|gb|EFF45320.1| superoxidase dismutase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 203

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N G       ++ AID + G FEKFK    
Sbjct: 61  KSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEP-KGEVAKAIDKDLGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N VNWE V  RY  A+ 
Sbjct: 180 EYIGAFY-NAVNWEEVDRRYHAAIA 203


>gi|148657343|ref|YP_001277548.1| superoxide dismutase [Roseiflexus sp. RS-1]
 gi|148569453|gb|ABQ91598.1| Superoxide dismutase [Roseiflexus sp. RS-1]
          Length = 201

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 112/203 (55%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY +  L P++   T++ HH  HH+ Y  N          L  +  E I+ +
Sbjct: 1   MAFTLPPLPYDFSALEPHIDTMTMQIHHGKHHQAYVTNLNAALEGHPSLQNATIEEILSN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH LFW  M  N G      AL+ AI+D FGSF +FK+ +
Sbjct: 61  INDVPESIRQAVINNGGGHHNHTLFWNIMGPNGGGEP-TGALARAINDTFGSFAEFKAKI 119

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A   +FGSGW WL   K+GKL I  T N ++PL+ G IPILG+DVWEHAYYL ++ RR
Sbjct: 120 KDAGIKRFGSGWAWLVKDKDGKLHIYSTPNQDSPLMQGHIPILGVDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYET 197
             YI++   N VNWE V  R+E 
Sbjct: 180 PDYIDA-WWNTVNWEAVAARFEQ 201


>gi|17226292|gb|AAL37717.1|AF413524_1 superoxide dismutase [Moraxella catarrhalis 7169]
 gi|326561096|gb|EGE11461.1| superoxide dismutase A [Moraxella catarrhalis 7169]
 gi|326566681|gb|EGE16820.1| superoxide dismutase A [Moraxella catarrhalis 103P14B1]
 gi|326571398|gb|EGE21413.1| superoxide dismutase A [Moraxella catarrhalis BC7]
 gi|326575321|gb|EGE25249.1| superoxide dismutase A [Moraxella catarrhalis CO72]
 gi|326576596|gb|EGE26503.1| superoxide dismutase A [Moraxella catarrhalis 101P30B1]
          Length = 205

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 117/208 (56%), Gaps = 14/208 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP L YSYD L P+  KET+E HH  HH+ Y +NA  L    +    S EE+I   
Sbjct: 1   MAFTLPELGYSYDALEPHFDKETMEIHHSRHHQAYVNNANGLLEGTQWADKSAEEVIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                    G+ NNA  + NH+LFW  +K     G    +L DAI  +FGS E F+    
Sbjct: 61  DQIPADKRTGVRNNAGGHANHSLFWTILKTGTTLGG---SLKDAIVRDFGSVEAFQEQFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +  G L++  T N ++PL+          PI+ +DVWEHAYYL +
Sbjct: 118 KAAASRFGSGWAWLVLDEGSLKVVSTANQDSPLMGEAVAGCKGYPIIVLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETA 198
           + +R  YI++F   +VNW+   +R+++A
Sbjct: 178 QNKRPDYIKAF-WEVVNWDEAQKRFDSA 204


>gi|152976708|ref|YP_001376225.1| superoxide dismutase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152025460|gb|ABS23230.1| Superoxide dismutase [Bacillus cytotoxicus NVH 391-98]
          Length = 203

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH+ FW  +  N G       L+ AI+  FGSF+ FK++
Sbjct: 61  NLNEVPEEIRTAVRNNGGGHANHSFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKAE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +++FGSGW WL V NG+LE++ T N ++PL  G  PI+G+DVWEHAYYL ++ RR
Sbjct: 120 FAKAGASRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPIIGLDVWEHAYYLHYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYISAF-WNVVDWNAAEKRYQEAK 203


>gi|2500831|sp|P77929|SODM_PSEPU RecName: Full=Superoxide dismutase [Mn]
 gi|1498062|gb|AAB06333.1| manganese superoxide dismutase [Pseudomonas putida]
          Length = 203

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 107/205 (52%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 1   MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAAIEGTEWAEWPVEKLVGAV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G     Q L+ AI    G F+ FK    
Sbjct: 61  KQLPESLRGAVTNHGGGHANHSLFWTVMSPQGGGEPHGQ-LAQAIASQLGGFDAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL+ G  PI G+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMFGNTPIFGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWAEVERRYLEALK 203


>gi|26987651|ref|NP_743076.1| superoxide dismutase [Pseudomonas putida KT2440]
 gi|148546197|ref|YP_001266299.1| superoxide dismutase [Pseudomonas putida F1]
 gi|34098495|sp|Q88PD5|SODF_PSEPK RecName: Full=Superoxide dismutase [Fe]
 gi|24982333|gb|AAN66540.1|AE016282_8 superoxide dismutase (Fe) [Pseudomonas putida KT2440]
 gi|148510255|gb|ABQ77115.1| Superoxide dismutase [Pseudomonas putida F1]
          Length = 198

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AF-WNLVNWAFVAEQFE 192


>gi|325277946|ref|ZP_08143483.1| superoxide dismutase [Pseudomonas sp. TJI-51]
 gi|324096920|gb|EGB95229.1| superoxide dismutase [Pseudomonas sp. TJI-51]
          Length = 198

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 96/197 (48%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    SLEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLSPNGGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AF-WNLVNWAFVAEQFE 192


>gi|330807973|ref|YP_004352435.1| superoxide dismutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376081|gb|AEA67431.1| Superoxide dismutase (Fe) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 198

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 126/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY +D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYPHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|153876311|ref|ZP_02003701.1| Superoxide dismutase [Beggiatoa sp. PS]
 gi|152067225|gb|EDN66299.1| Superoxide dismutase [Beggiatoa sp. PS]
          Length = 192

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 86/196 (43%), Positives = 120/196 (61%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY  + L P++SKETLE+H+  HH+ Y  N   L    E   +SLE+I+ KS
Sbjct: 1   MEHTLPALPYEKNALEPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFADMSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G       L+DAI+  FGSF+ FK++    A 
Sbjct: 61  SG---GIFNNAAQIWNHTFYWNSLSPNGGGQP-SGKLADAINSTFGSFDNFKAEFTKTAV 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGWGWL       L +  T NA NP+ +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TTFGSGWGWLVKNTDGSLALVSTSNAGNPMTSGQTPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERY 195
           +F  +LVNW++V + +
Sbjct: 177 AF-WSLVNWDFVAKNF 191


>gi|100284|pir||A39267 superoxide dismutase (EC 1.15.1.1) (Fe) - curled-leaved tobacco
          Length = 227

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 120/200 (60%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 27  FELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 86

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  MK N G       L + I+ +FGS++ F  +   AA+
Sbjct: 87  KGAPLPAFNNAAQAWNHQFFWESMKPNGGGEP-SGELLELINRDFGSYDAFVKEFKAAAA 145

Query: 121 TQFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K    KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 146 TQFGSGWAWLAYKPEEKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 205

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 206 SIFMEKLVSWEAVSSRLKAA 225


>gi|312962697|ref|ZP_07777186.1| superoxide dismutase (fe) [Pseudomonas fluorescens WH6]
 gi|311283072|gb|EFQ61664.1| superoxide dismutase (fe) [Pseudomonas fluorescens WH6]
          Length = 198

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 96/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL NG  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTNGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|228902798|ref|ZP_04066943.1| Superoxide dismutase [Bacillus thuringiensis IBL 4222]
 gi|228856807|gb|EEN01322.1| Superoxide dismutase [Bacillus thuringiensis IBL 4222]
          Length = 203

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQQAK 203


>gi|73540303|ref|YP_294823.1| superoxide dismutase [Ralstonia eutropha JMP134]
 gi|72117716|gb|AAZ59979.1| Superoxide dismutase [Ralstonia eutropha JMP134]
          Length = 193

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI  KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENATLEEITKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWESMKPNGGGQP-TGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLLSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNVVNWDFAAQNFA 192


>gi|312129996|ref|YP_003997336.1| superoxide dismutase [Leadbetterella byssophila DSM 17132]
 gi|311906542|gb|ADQ16983.1| Superoxide dismutase [Leadbetterella byssophila DSM 17132]
          Length = 229

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 79/206 (38%), Positives = 110/206 (53%), Gaps = 8/206 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F LP LPY+++ L P++  ET+E H+  HHK Y DN  K    +     SLEEII    
Sbjct: 27  AFTLPKLPYAFNALEPHIDAETMEIHYSRHHKAYVDNLNKALPGSGAEGKSLEEIIKNVS 86

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
             +  + NNA  ++NH  FW  +            L   I + F S +  K +   AA+ 
Sbjct: 87  KYSTAIRNNAGGHWNHTFFWEILSPKA--TSPNGKLLKKIQETFKSVDAMKEEFNKAAAG 144

Query: 122 QFGSGWGWLS-VKNGKLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRAH 176
           +FGSGW WL   KNG L+I  T N +NP +        PI+GIDVWEHAYYL ++ +RA 
Sbjct: 145 RFGSGWAWLILQKNGDLKIISTANQDNPYMDVVETQGCPIIGIDVWEHAYYLKYQNKRAD 204

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           Y+ +F  NLVNW+   + Y  A+  +
Sbjct: 205 YVNAF-WNLVNWDQAEKNYNAALKKK 229


>gi|186685532|ref|YP_001868728.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
 gi|186467984|gb|ACC83785.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
          Length = 259

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 117/203 (57%), Gaps = 8/203 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLA-SDAEMLHLSLEEIIIK- 59
             +LP L Y+Y+ L P++  +T+++HHD HH  Y  N         E+   ++EE++ K 
Sbjct: 55  AIQLPPLAYAYEALEPHIDAKTMQFHHDKHHATYVKNLNAALDKHPELKGKTIEELLQKL 114

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH++FW  MK   G       ++ AI+ +FGSF  FK    
Sbjct: 115 DSVPQDIRRTVRNNGGGHVNHSMFWEIMKPKGGGEPTGN-IASAINQSFGSFAAFKKQFN 173

Query: 117 TAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A +++FGSGW WL   K GKLE++ T N ++PL  G  PILG DVWEHAYYL+++ RRA
Sbjct: 174 EAGASRFGSGWVWLVRNKGGKLEVTTTANQDSPLSTGKYPILGNDVWEHAYYLNYQNRRA 233

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y+++   N+VNW+ + +R+  A
Sbjct: 234 DYLDA-WWNVVNWDEINKRFAAA 255


>gi|225010262|ref|ZP_03700734.1| Superoxide dismutase [Flavobacteria bacterium MS024-3C]
 gi|225005741|gb|EEG43691.1| Superoxide dismutase [Flavobacteria bacterium MS024-3C]
          Length = 202

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 118/202 (58%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y++D L P++   T+E HH  HH+ Y +N     + + M   S+E I+   
Sbjct: 1   MAFELPQLDYAHDALEPHVDARTMEIHHGKHHQGYTNNLNAAIAGSAMEGASIETILADL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   +YNHNLFW  M  N G       L+ AID +FGSF  FK     AA+
Sbjct: 61  DLNNGAVRNNGGGFYNHNLFWKSMAPNGGGTP-SGDLAAAIDASFGSFNAFKETFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V K GKLE+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TRFGSGWAWLCVHKGGKLEVCSTPNQDNPLMPGIGCGGFPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NW      +E 
Sbjct: 180 DYVNAFF-NVINWSNATALFEA 200


>gi|104780334|ref|YP_606832.1| superoxide dismutase [Pseudomonas entomophila L48]
 gi|95109321|emb|CAK14021.1| superoxide dismutase [Fe] [Pseudomonas entomophila L48]
          Length = 198

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI   FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALADAITAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|325954714|ref|YP_004238374.1| Manganese/iron superoxide dismutase [Weeksella virosa DSM 16922]
 gi|323437332|gb|ADX67796.1| Manganese/iron superoxide dismutase [Weeksella virosa DSM 16922]
          Length = 199

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 86/201 (42%), Positives = 122/201 (60%), Gaps = 7/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY++D L PY+  +T+E HHD HH  Y +N        ++ + ++EEI+ K 
Sbjct: 1   MSFELKKLPYAFDALEPYIDAKTMEIHHDKHHAAYTNNLNAAIEGTDLANATIEEILAKG 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   +YNHNLFW  M     K  V   ++ AID+ FGSF+ FK +   AA+
Sbjct: 61  T-DKPAVRNNGGGFYNHNLFWDIMTPGGSKQPVGN-VAKAIDEAFGSFDAFKDEFSKAAA 118

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL  K+GK+ +S T N +NPL+        PILGIDVWEHAYYL ++ +R  
Sbjct: 119 TRFGSGWAWLVKKDGKVVVSSTPNQDNPLMPVADVQGFPILGIDVWEHAYYLKYQNKRPD 178

Query: 177 YIESFITNLVNWEYVCERYET 197
           YIE+F  +++NW+ V E +  
Sbjct: 179 YIEAFF-SVINWDKVEELFNN 198


>gi|194288712|ref|YP_002004619.1| superoxide dismutase [Cupriavidus taiwanensis LMG 19424]
 gi|193222547|emb|CAQ68550.1| superoxide dismutase [Cupriavidus taiwanensis LMG 19424]
          Length = 193

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 91/197 (46%), Positives = 126/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI+ KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENATLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWDSLKPNGGGQP-TGALADAINAKWGSFDKFKEEFTKVAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNVVNWDFAGKNFA 192


>gi|1711435|sp|P50061|SODF_PLEBO RecName: Full=Superoxide dismutase [Fe]
 gi|608558|gb|AAA69954.1| superoxide dismutase [Leptolyngbya boryana]
          Length = 199

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 96/200 (48%), Positives = 125/200 (62%), Gaps = 4/200 (2%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+  D L PY M  ET +YH+  HH  Y  N  KL     M  LSLE++I +
Sbjct: 1   MAFTQPPLPFPKDALEPYGMKAETFDYHYGKHHAAYVTNLNKLVEGTPMESLSLEDVIKQ 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S G  S  G+FNNA+Q +NH  FW C+K   G G     L+  ID  FGS +KFK +   
Sbjct: 61  SFGDSSKVGVFNNAAQVWNHTFFWNCLKA-GGGGAPTGELAAKIDAAFGSLDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L+++KT NAENPL++G  P+L +DVWEHAYYLDF+  R  +
Sbjct: 120 AAATQFGSGWAWLVDDGGTLKVTKTPNAENPLVHGQKPLLTLDVWEHAYYLDFQNARPAF 179

Query: 178 IESFITNLVNWEYVCERYET 197
           I++F+ NLVNW++V +    
Sbjct: 180 IKNFLDNLVNWDFVAQNLAA 199


>gi|228941439|ref|ZP_04103990.1| Superoxide dismutase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228974370|ref|ZP_04134939.1| Superoxide dismutase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228980963|ref|ZP_04141266.1| Superoxide dismutase [Bacillus thuringiensis Bt407]
 gi|228778754|gb|EEM27018.1| Superoxide dismutase [Bacillus thuringiensis Bt407]
 gi|228785420|gb|EEM33430.1| Superoxide dismutase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228818220|gb|EEM64294.1| Superoxide dismutase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326942057|gb|AEA17953.1| superoxide dismutase (Mn) [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 203

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P++ KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHLDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|70732151|ref|YP_261907.1| superoxide dismutase (Fe) [Pseudomonas fluorescens Pf-5]
 gi|68346450|gb|AAY94056.1| superoxide dismutase (fe) [Pseudomonas fluorescens Pf-5]
          Length = 198

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALAEAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V E++E
Sbjct: 177 AF-WNLVNWKFVAEQFE 192


>gi|52141224|ref|YP_085605.1| superoxide dismutase, Mn [Bacillus cereus E33L]
 gi|51974693|gb|AAU16243.1| superoxide dismutase, Mn [Bacillus cereus E33L]
          Length = 203

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGYAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|325577800|ref|ZP_08148075.1| superoxide dismutase [Haemophilus parainfluenzae ATCC 33392]
 gi|325160545|gb|EGC72671.1| superoxide dismutase [Haemophilus parainfluenzae ATCC 33392]
          Length = 214

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 114/209 (54%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA  +          +       
Sbjct: 1   MSYTLPELGYAYDALEPHFDAQTMEIHHSKHHQAYVNNANAVLETLPAEFSEMCAGQLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
           ++          L NNA  + NH+LFW  +KK      +   L  AI+ +FGS E FK++
Sbjct: 61  QLDKIPAEKRTALRNNAGGHANHSLFWKSLKK---GTTLQGDLKAAIERDFGSVENFKAE 117

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYL 168
              AA+T+FGSGW WL +  GKL +  T N ++PL+          P+LG+DVWEHAYYL
Sbjct: 118 FEKAAATRFGSGWAWLVINQGKLSVVSTANQDSPLMGKEIAGCEGFPLLGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            F+ RR  YI+ F  N+VNW++V +R+  
Sbjct: 178 KFQNRRPDYIKEF-WNVVNWDFVADRFAK 205


>gi|45861260|gb|AAS78512.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 199

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 80/203 (39%), Positives = 110/203 (54%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY +D L P++ ++T+E HH  HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS + FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW  V E Y  A 
Sbjct: 178 YISAF-WNVVNWGKVDELYNAAK 199


>gi|225715222|gb|ACO13457.1| Superoxide dismutase, mitochondrial precursor [Esox lucius]
          Length = 226

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 67/201 (33%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HSLPDLTYDYGALEPHISAEIMQLHHSKHHATYVNNLNVAEDKYKEALAKG--DVTAQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L+ AI  +FGSF+  +  +  A    
Sbjct: 88  LQPALRFNGGGHINHSIFWTNLSPNGGGEP-KGELAAAIKRDFGSFQTMQDKMSAATVAV 146

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL ++     L I+   N +      G +P+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGLEKETGMLRITACPNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYVK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER+++A  
Sbjct: 207 A-IWNIINWENVSERFQSAKK 226


>gi|114320262|ref|YP_741945.1| superoxide dismutase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226656|gb|ABI56455.1| Superoxide dismutase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 202

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP+L Y Y+ L   +  +T+E HH  HH  Y        +      LSLE+++ K+
Sbjct: 1   MAFKLPDLAYDYNALDRAIDAQTMEIHHTKHHNTYVTKLNDAIAGKPEADLSLEDLLKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH  FW  +  N G       ++  ID  FGS+EKF+ +   AA 
Sbjct: 61  GQLGAPVRNNGGGHWNHTAFWQWLSPNGGGQP-QGEVAQQIDQAFGSYEKFREEFTNAAL 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V   G+L+++ T N +NPL++       PILG+DVWEHAYYL ++ RR 
Sbjct: 120 GRFGSGWAWLIVNGQGQLQVTSTPNQDNPLMDVAEVKGTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+E+F  ++VNW+ V +R   A 
Sbjct: 180 DYVEAF-WDVVNWDEVAKRLAEAK 202


>gi|229588420|ref|YP_002870539.1| superoxide dismutase [Pseudomonas fluorescens SBW25]
 gi|229360286|emb|CAY47143.1| superoxide dismutase [Mn] [Pseudomonas fluorescens SBW25]
          Length = 203

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MTYTLPALPYAYDALEPHIDAQTMEIHYSKHHQTYINNLNAAVEGTEFAGWPVEKLVSSV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFWA M    G GK   ALS AID+  G F+ FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWAVMSP-KGGGKPEGALSKAIDEQLGGFDSFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLLYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  +++NW  V +RY+ A+ 
Sbjct: 180 EYINAFY-SVINWPEVADRYQAAVA 203


>gi|22299062|ref|NP_682309.1| superoxide dismutase [Thermosynechococcus elongatus BP-1]
 gi|22295244|dbj|BAC09071.1| superoxide dismutase [Thermosynechococcus elongatus BP-1]
          Length = 200

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 92/201 (45%), Positives = 131/201 (65%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+    L PY MS +TLE+H+  HHK Y DN  KL  D E+   SLE++I  
Sbjct: 1   MAFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRT 60

Query: 60  SHGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           ++G     G+FNNA+Q +NH  FW  +K   G G     ++  I+  FGS+++FK+    
Sbjct: 61  TYGDAAKVGIFNNAAQVWNHTFFWNSLKP-GGGGVPTGDVAARINSAFGSYDEFKAQFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL ++ G L+++KT NAENPL++G +P+L IDVWEHAYYLD++ RR  +
Sbjct: 120 AAATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+  LVNW++V +    A
Sbjct: 180 IDNFLNQLVNWDFVAKNLAAA 200


>gi|170718933|ref|YP_001784101.1| superoxide dismutase [Haemophilus somnus 2336]
 gi|168827062|gb|ACA32433.1| Superoxide dismutase [Haemophilus somnus 2336]
          Length = 209

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 115/208 (55%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA        E   L   ++I K
Sbjct: 1   MAYTLPELGYAYDALEPHFDAQTMELHHSKHHQTYVNNANAALETLPEFTDLCPGQLITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +K       +   L DAI+ +FGS E F+++ 
Sbjct: 61  LVEVPADKRTAIRNNVGGHVNHSLFWKGLKT---GTTLQGPLKDAIERDFGSVESFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +  GKLE+  T N ++PL+          PIL +DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLNQGKLEVVSTANQDSPLMGKEIAGCEGFPILVLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  N+VNW+   ER+E 
Sbjct: 178 FQNRRPDYIKAF-WNVVNWDAAAERFEK 204


>gi|327541336|gb|EGF27878.1| manganese superoxide dismutase [Rhodopirellula baltica WH47]
          Length = 210

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 112/209 (53%), Gaps = 12/209 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++   T+E HH  HH  Y        +  ++   S+EE+I   
Sbjct: 4   MAFTLPELPYAYDALEPHIDARTMEIHHSKHHNAYVTKTNDALAGTDLASKSIEEVISDL 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +      G     L+ AID+  GSF+ FK    
Sbjct: 64  SAVPDDKRGAVRNNGGGHANHSLFWT-VLGPGKGGSPSGDLAAAIDEACGSFDAFKEQFA 122

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL V  GKL +  T N ++PL+          PILG+DVWEHAYYL++
Sbjct: 123 NAAATRFGSGWAWLYVSGGKLHVGSTANQDSPLMGEAVAGIGGTPILGLDVWEHAYYLNY 182

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + RR  YI +F  N+V+W+ V  R+  A 
Sbjct: 183 QNRRPDYISAF-WNVVDWDAVATRFAAAK 210


>gi|152988231|ref|YP_001350418.1| superoxide dismutase [Pseudomonas aeruginosa PA7]
 gi|150963389|gb|ABR85414.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Pseudomonas aeruginosa PA7]
          Length = 204

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 112/205 (54%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+YD L P++   T+E HH  HH+ Y +N              +E ++++ 
Sbjct: 1   MPHALPALPYAYDALEPHIDALTMEIHHSKHHQTYVNNLNAALEGTPYAGQPVESLLLQL 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
            G        + NN   + NH+LFW  M   +G G     L+ AID   G FE F+    
Sbjct: 61  AGLPENLRPAVINNGGGHANHSLFWTVMSP-EGGGHPEGDLARAIDQELGGFEAFREAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    +L +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQGRLLVESSGNQDSPLMNGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWREVARRYAQALA 203


>gi|238793191|ref|ZP_04636819.1| Superoxide dismutase [Mn] [Yersinia intermedia ATCC 29909]
 gi|238727564|gb|EEQ19090.1| Superoxide dismutase [Mn] [Yersinia intermedia ATCC 29909]
          Length = 208

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 117/210 (55%), Gaps = 15/210 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEELIKD 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 63  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LDTTLTGDLKAAIERDFGSVDSFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K+GKL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EAAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 180 FQNRRPDYIKAF-WNVVNWDEAAARFAQAK 208


>gi|229916297|ref|YP_002884943.1| Superoxide dismutase [Exiguobacterium sp. AT1b]
 gi|229467726|gb|ACQ69498.1| Superoxide dismutase [Exiguobacterium sp. AT1b]
          Length = 202

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 85/204 (41%), Positives = 125/204 (61%), Gaps = 7/204 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M  F+LP L Y+YD L P++   T+E HH  HH  Y  N        ++ + SLE+++ K
Sbjct: 1   MAKFELPQLDYAYDALEPHIDARTMEIHHTKHHNTYVTNVNNALEGKDVEYSSLEDLLQK 60

Query: 60  SHGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+ FW  +KKN+        L+ AID++FGSF+ FK + 
Sbjct: 61  IDSLPADIQTAVRNNGGGHWNHSFFWKLLKKNENGTP-SGDLAAAIDESFGSFDGFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL VKNGKLE++ T N ++P++ G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TKAATTRFGSGWAWLVVKNGKLEVTSTPNQDSPIMEGVTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  ++++W+YV   Y  A 
Sbjct: 180 DYINAFF-HVIDWDYVATLYADAK 202


>gi|30264347|ref|NP_846724.1| superoxide dismutase, Mn [Bacillus anthracis str. Ames]
 gi|42783401|ref|NP_980648.1| superoxide dismutase, Mn [Bacillus cereus ATCC 10987]
 gi|47529794|ref|YP_021143.1| superoxide dismutase, Mn [Bacillus anthracis str. 'Ames Ancestor']
 gi|47567837|ref|ZP_00238545.1| superoxide dismutase [Bacillus cereus G9241]
 gi|49187174|ref|YP_030426.1| superoxide dismutase, Mn [Bacillus anthracis str. Sterne]
 gi|49481287|ref|YP_038334.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|118479448|ref|YP_896599.1| superoxide dismutase, Mn [Bacillus thuringiensis str. Al Hakam]
 gi|165872090|ref|ZP_02216730.1| superoxide dismutase, Mn [Bacillus anthracis str. A0488]
 gi|167634664|ref|ZP_02392984.1| superoxide dismutase, Mn [Bacillus anthracis str. A0442]
 gi|167638653|ref|ZP_02396929.1| superoxide dismutase, Mn [Bacillus anthracis str. A0193]
 gi|170687376|ref|ZP_02878593.1| superoxide dismutase, Mn [Bacillus anthracis str. A0465]
 gi|170707468|ref|ZP_02897922.1| superoxide dismutase, Mn [Bacillus anthracis str. A0389]
 gi|177655047|ref|ZP_02936713.1| superoxide dismutase, Mn [Bacillus anthracis str. A0174]
 gi|190565979|ref|ZP_03018898.1| superoxide dismutase, Mn [Bacillus anthracis Tsiankovskii-I]
 gi|196034823|ref|ZP_03102230.1| superoxide dismutase, Mn [Bacillus cereus W]
 gi|196041617|ref|ZP_03108909.1| superoxide dismutase, Mn [Bacillus cereus NVH0597-99]
 gi|196046380|ref|ZP_03113606.1| superoxide dismutase, Mn [Bacillus cereus 03BB108]
 gi|206971213|ref|ZP_03232164.1| superoxide dismutase, Mn [Bacillus cereus AH1134]
 gi|206977997|ref|ZP_03238883.1| superoxide dismutase, Mn [Bacillus cereus H3081.97]
 gi|217961766|ref|YP_002340336.1| superoxide dismutase, Mn [Bacillus cereus AH187]
 gi|218235635|ref|YP_002369082.1| superoxide dismutase, Mn [Bacillus cereus B4264]
 gi|218899441|ref|YP_002447852.1| superoxide dismutase, Mn [Bacillus cereus G9842]
 gi|218905411|ref|YP_002453245.1| superoxide dismutase, Mn [Bacillus cereus AH820]
 gi|222097720|ref|YP_002531777.1| superoxide dismutase, mn [Bacillus cereus Q1]
 gi|225866257|ref|YP_002751635.1| superoxide dismutase, Mn [Bacillus cereus 03BB102]
 gi|227817051|ref|YP_002817060.1| superoxide dismutase, Mn [Bacillus anthracis str. CDC 684]
 gi|228910108|ref|ZP_04073928.1| Superoxide dismutase [Bacillus thuringiensis IBL 200]
 gi|228916908|ref|ZP_04080470.1| Superoxide dismutase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228923026|ref|ZP_04086319.1| Superoxide dismutase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228929319|ref|ZP_04092344.1| Superoxide dismutase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935595|ref|ZP_04098411.1| Superoxide dismutase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228947988|ref|ZP_04110274.1| Superoxide dismutase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228954558|ref|ZP_04116583.1| Superoxide dismutase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228960540|ref|ZP_04122189.1| Superoxide dismutase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228967342|ref|ZP_04128377.1| Superoxide dismutase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228987523|ref|ZP_04147642.1| Superoxide dismutase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229047992|ref|ZP_04193568.1| Superoxide dismutase [Bacillus cereus AH676]
 gi|229071777|ref|ZP_04204992.1| Superoxide dismutase [Bacillus cereus F65185]
 gi|229081533|ref|ZP_04214032.1| Superoxide dismutase [Bacillus cereus Rock4-2]
 gi|229098748|ref|ZP_04229686.1| Superoxide dismutase [Bacillus cereus Rock3-29]
 gi|229104906|ref|ZP_04235563.1| Superoxide dismutase [Bacillus cereus Rock3-28]
 gi|229111748|ref|ZP_04241296.1| Superoxide dismutase [Bacillus cereus Rock1-15]
 gi|229117773|ref|ZP_04247140.1| Superoxide dismutase [Bacillus cereus Rock1-3]
 gi|229123813|ref|ZP_04253007.1| Superoxide dismutase [Bacillus cereus 95/8201]
 gi|229129553|ref|ZP_04258524.1| Superoxide dismutase [Bacillus cereus BDRD-Cer4]
 gi|229141012|ref|ZP_04269555.1| Superoxide dismutase [Bacillus cereus BDRD-ST26]
 gi|229146860|ref|ZP_04275225.1| Superoxide dismutase [Bacillus cereus BDRD-ST24]
 gi|229152475|ref|ZP_04280667.1| Superoxide dismutase [Bacillus cereus m1550]
 gi|229157888|ref|ZP_04285962.1| Superoxide dismutase [Bacillus cereus ATCC 4342]
 gi|229186516|ref|ZP_04313678.1| Superoxide dismutase [Bacillus cereus BGSC 6E1]
 gi|229192484|ref|ZP_04319447.1| Superoxide dismutase [Bacillus cereus ATCC 10876]
 gi|229198402|ref|ZP_04325108.1| Superoxide dismutase [Bacillus cereus m1293]
 gi|229603736|ref|YP_002868565.1| superoxide dismutase, Mn [Bacillus anthracis str. A0248]
 gi|254684034|ref|ZP_05147894.1| superoxide dismutase, Mn [Bacillus anthracis str. CNEVA-9066]
 gi|254736383|ref|ZP_05194089.1| superoxide dismutase, Mn [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741420|ref|ZP_05199107.1| superoxide dismutase, Mn [Bacillus anthracis str. Kruger B]
 gi|254753943|ref|ZP_05205978.1| superoxide dismutase, Mn [Bacillus anthracis str. Vollum]
 gi|254757815|ref|ZP_05209842.1| superoxide dismutase, Mn [Bacillus anthracis str. Australia 94]
 gi|296504771|ref|YP_003666471.1| superoxide dismutase [Bacillus thuringiensis BMB171]
 gi|34395848|sp|Q81LW0|SODM1_BACAN RecName: Full=Superoxide dismutase [Mn] 1
 gi|30259005|gb|AAP28210.1| superoxide dismutase, Mn [Bacillus anthracis str. Ames]
 gi|42739330|gb|AAS43256.1| superoxide dismutase, Mn [Bacillus cereus ATCC 10987]
 gi|47504942|gb|AAT33618.1| superoxide dismutase, Mn [Bacillus anthracis str. 'Ames Ancestor']
 gi|47555514|gb|EAL13857.1| superoxide dismutase [Bacillus cereus G9241]
 gi|49181101|gb|AAT56477.1| superoxide dismutase, Mn [Bacillus anthracis str. Sterne]
 gi|49332843|gb|AAT63489.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|118418673|gb|ABK87092.1| superoxide dismutase, Mn [Bacillus thuringiensis str. Al Hakam]
 gi|164712221|gb|EDR17758.1| superoxide dismutase, Mn [Bacillus anthracis str. A0488]
 gi|167513501|gb|EDR88871.1| superoxide dismutase, Mn [Bacillus anthracis str. A0193]
 gi|167530116|gb|EDR92851.1| superoxide dismutase, Mn [Bacillus anthracis str. A0442]
 gi|170127712|gb|EDS96585.1| superoxide dismutase, Mn [Bacillus anthracis str. A0389]
 gi|170668571|gb|EDT19317.1| superoxide dismutase, Mn [Bacillus anthracis str. A0465]
 gi|172080308|gb|EDT65397.1| superoxide dismutase, Mn [Bacillus anthracis str. A0174]
 gi|190562898|gb|EDV16864.1| superoxide dismutase, Mn [Bacillus anthracis Tsiankovskii-I]
 gi|195992362|gb|EDX56323.1| superoxide dismutase, Mn [Bacillus cereus W]
 gi|196022850|gb|EDX61531.1| superoxide dismutase, Mn [Bacillus cereus 03BB108]
 gi|196027605|gb|EDX66220.1| superoxide dismutase, Mn [Bacillus cereus NVH0597-99]
 gi|206733985|gb|EDZ51156.1| superoxide dismutase, Mn [Bacillus cereus AH1134]
 gi|206743797|gb|EDZ55218.1| superoxide dismutase, Mn [Bacillus cereus H3081.97]
 gi|217063336|gb|ACJ77586.1| superoxide dismutase, Mn [Bacillus cereus AH187]
 gi|218163592|gb|ACK63584.1| superoxide dismutase, Mn [Bacillus cereus B4264]
 gi|218539777|gb|ACK92175.1| superoxide dismutase, Mn [Bacillus cereus AH820]
 gi|218542716|gb|ACK95110.1| superoxide dismutase, Mn [Bacillus cereus G9842]
 gi|221241778|gb|ACM14488.1| superoxide dismutase, Mn [Bacillus cereus Q1]
 gi|225789714|gb|ACO29931.1| superoxide dismutase, Mn [Bacillus cereus 03BB102]
 gi|227005397|gb|ACP15140.1| superoxide dismutase, Mn [Bacillus anthracis str. CDC 684]
 gi|228585102|gb|EEK43214.1| Superoxide dismutase [Bacillus cereus m1293]
 gi|228591061|gb|EEK48917.1| Superoxide dismutase [Bacillus cereus ATCC 10876]
 gi|228596947|gb|EEK54605.1| Superoxide dismutase [Bacillus cereus BGSC 6E1]
 gi|228625547|gb|EEK82300.1| Superoxide dismutase [Bacillus cereus ATCC 4342]
 gi|228631083|gb|EEK87720.1| Superoxide dismutase [Bacillus cereus m1550]
 gi|228636688|gb|EEK93153.1| Superoxide dismutase [Bacillus cereus BDRD-ST24]
 gi|228642445|gb|EEK98733.1| Superoxide dismutase [Bacillus cereus BDRD-ST26]
 gi|228654158|gb|EEL10025.1| Superoxide dismutase [Bacillus cereus BDRD-Cer4]
 gi|228659634|gb|EEL15280.1| Superoxide dismutase [Bacillus cereus 95/8201]
 gi|228665671|gb|EEL21146.1| Superoxide dismutase [Bacillus cereus Rock1-3]
 gi|228671742|gb|EEL27038.1| Superoxide dismutase [Bacillus cereus Rock1-15]
 gi|228678480|gb|EEL32700.1| Superoxide dismutase [Bacillus cereus Rock3-28]
 gi|228684592|gb|EEL38532.1| Superoxide dismutase [Bacillus cereus Rock3-29]
 gi|228701840|gb|EEL54327.1| Superoxide dismutase [Bacillus cereus Rock4-2]
 gi|228711372|gb|EEL63332.1| Superoxide dismutase [Bacillus cereus F65185]
 gi|228723449|gb|EEL74818.1| Superoxide dismutase [Bacillus cereus AH676]
 gi|228772255|gb|EEM20702.1| Superoxide dismutase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228792377|gb|EEM39944.1| Superoxide dismutase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228799140|gb|EEM46108.1| Superoxide dismutase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228805215|gb|EEM51809.1| Superoxide dismutase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228811678|gb|EEM58013.1| Superoxide dismutase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228824133|gb|EEM69949.1| Superoxide dismutase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228830333|gb|EEM75945.1| Superoxide dismutase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228836659|gb|EEM82007.1| Superoxide dismutase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228842732|gb|EEM87818.1| Superoxide dismutase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228849625|gb|EEM94459.1| Superoxide dismutase [Bacillus thuringiensis IBL 200]
 gi|229268144|gb|ACQ49781.1| superoxide dismutase, Mn [Bacillus anthracis str. A0248]
 gi|296325823|gb|ADH08751.1| superoxide dismutase (Mn) [Bacillus thuringiensis BMB171]
 gi|324328181|gb|ADY23441.1| superoxide dismutase, Mn [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 203

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|325109271|ref|YP_004270339.1| Manganese/iron superoxide dismutase [Planctomyces brasiliensis DSM
           5305]
 gi|324969539|gb|ADY60317.1| Manganese/iron superoxide dismutase [Planctomyces brasiliensis DSM
           5305]
          Length = 241

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/201 (40%), Positives = 112/201 (55%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           F+LP LPY+YD L   + ++T+  HHD HH+ Y +           L     E +++   
Sbjct: 43  FELPPLPYAYDALQKSIDEQTMHIHHDKHHQGYVNKLNAAVEGMPELQKHSVEDLLRNID 102

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                    + NN   + NH LFW  M  N G       L  AI   F SF  F+ +  +
Sbjct: 103 QVPKKIRQDVINNGGGHANHTLFWEVMGPNGGGEP-TGKLGQAIKKQFKSFSNFRDEFAS 161

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
            A + FGSGWGWL V +GKL+I KT N ++PL+ G  P+LG+DVWEHAYYL ++ RR  Y
Sbjct: 162 NAGSVFGSGWGWLIVDDGKLKIVKTSNQDSPLLKGKTPLLGLDVWEHAYYLKYQNRRPDY 221

Query: 178 IESFITNLVNWEYVCERYETA 198
           I+++  N+VNWE V +RYE A
Sbjct: 222 IQAWF-NVVNWENVGKRYEQA 241


>gi|229031924|ref|ZP_04187911.1| Superoxide dismutase [Bacillus cereus AH1271]
 gi|229174949|ref|ZP_04302469.1| Superoxide dismutase [Bacillus cereus MM3]
 gi|228608617|gb|EEK65919.1| Superoxide dismutase [Bacillus cereus MM3]
 gi|228729388|gb|EEL80378.1| Superoxide dismutase [Bacillus cereus AH1271]
          Length = 203

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVVGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|312958991|ref|ZP_07773510.1| superoxide dismutase, Mn [Pseudomonas fluorescens WH6]
 gi|311286761|gb|EFQ65323.1| superoxide dismutase, Mn [Pseudomonas fluorescens WH6]
          Length = 203

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 117/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MTYTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEFAGWPIEKLVSSV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFWA M   +G GK   AL  AI++  G F+ FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWAVMSP-EGGGKPEGALGKAIEEQLGGFDSFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLLYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  +++NW  V  RY+ A+ 
Sbjct: 180 EYINAFY-SVINWPEVAARYQAALA 203


>gi|146313695|ref|YP_001178769.1| superoxide dismutase [Enterobacter sp. 638]
 gi|145320571|gb|ABP62718.1| Superoxide dismutase [Enterobacter sp. 638]
          Length = 206

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS+EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFAELSVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDAFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 178 FQNRRPDYIKAF-WDVVNWDEAAARFAA 204


>gi|70728291|ref|YP_258040.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf-5]
 gi|68342590|gb|AAY90196.1| superoxide dismutase, Mn [Pseudomonas fluorescens Pf-5]
          Length = 203

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F LP LPY+YD L P++  +T+E H+  HH+ Y +N        E     +E+++   
Sbjct: 1   MSFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVEGTEWAGWEVEKLVASV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A + N    + NH+LFWA M    G G    AL  AI+   G FE FK    
Sbjct: 61  QQLPEKLRAAVINQGGGHANHSLFWAVMTP-AGGGHPQGALGQAIEQQLGGFESFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL+NG  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKLVVESSGNQDSPLMNGNTPILGLDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N++NW  V +RY+ AM 
Sbjct: 180 EYINAFY-NVINWPEVAQRYQAAMA 203


>gi|240949114|ref|ZP_04753462.1| manganese superoxide dismutase [Actinobacillus minor NM305]
 gi|240296509|gb|EER47141.1| manganese superoxide dismutase [Actinobacillus minor NM305]
          Length = 213

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 80/212 (37%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA        E+L     ++I  
Sbjct: 1   MAYTLPELGYAYDALEPHFDAKTMEIHHTKHHQAYINNANAALESYPELLEQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +  AL DAI  +FGS E F++  
Sbjct: 61  LEQVPAEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDAIVRDFGSVEAFQAQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL ++ GKL +  T N ++PL+          PILG+DVWEHAYYL+
Sbjct: 118 EQAAATRFGSGWAWLVLEEGKLAVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLN 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           ++ RR  YI++F  N+VNW+    R+E  +  
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEDKVKT 208


>gi|15839203|ref|NP_299891.1| superoxide dismutase [Xylella fastidiosa 9a5c]
 gi|9107839|gb|AAF85411.1|AE004068_7 superoxide dismutase (MN) [Xylella fastidiosa 9a5c]
          Length = 203

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 111/205 (54%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH  Y +N        E   L +EE++   
Sbjct: 1   MAYTLPILPYAYDALQPHIDAQTMEIHYTKHHATYINNLNAALEGTEYADLPIEELLRNL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN     NH+LFW  +    G GK    ++ AID   G FE FK    
Sbjct: 61  KSLPESLQGPVRNNGGGCVNHSLFWT-VMAQGGGGKPKGEVAKAIDQQLGGFETFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW  L+V   K L +  + N ++PL +G  PIL +DVWEHAYYL ++ RRA
Sbjct: 120 KAALSRFGSGWSLLNVTPSKTLVVESSANQDSPLCDGKTPILCLDVWEHAYYLHYQNRRA 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +F  N++NW+ V  RY  AM 
Sbjct: 180 DYVNAFY-NVINWDEVERRYVAAMS 203


>gi|257486400|ref|ZP_05640441.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289677768|ref|ZP_06498658.1| superoxide dismutase [Pseudomonas syringae pv. syringae FF5]
 gi|302189753|ref|ZP_07266426.1| superoxide dismutase [Pseudomonas syringae pv. syringae 642]
 gi|330895178|gb|EGH27516.1| superoxide dismutase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330945379|gb|EGH46986.1| superoxide dismutase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330950173|gb|EGH50433.1| superoxide dismutase [Pseudomonas syringae Cit 7]
 gi|330981173|gb|EGH79276.1| superoxide dismutase [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330989425|gb|EGH87528.1| superoxide dismutase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 193

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++  
Sbjct: 177 AF-WNLVNWDFVAKQFAA 193


>gi|134666|sp|P28763|SODM_LISIV RecName: Full=Superoxide dismutase [Mn]
 gi|44011|emb|CAA45406.1| superoxide dismutase [Listeria ivanovii]
          Length = 202

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M ++LP LPY+YD L P   KET+E H+  HH  Y     +  S  AE+     EE++  
Sbjct: 1   MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAVSGHAELASKPGEELVAN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH LFW+ +  N G       L  AI+  FG+F++FK   
Sbjct: 61  LDSVPEEIRGAVRNHGGGHANHTLFWSSLSPNGGGAPTGN-LKAAIESEFGTFDEFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+ +FGSGW WL V NGKLEI  T N ++PL  G  P+LG+DVWEHAYYL F+ RR 
Sbjct: 120 NAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI++F  N++NW+   +R++ A 
Sbjct: 180 EYIDTF-WNVINWDERNKRFDAAK 202


>gi|315499893|ref|YP_004088696.1| superoxide dismutase [Asticcacaulis excentricus CB 48]
 gi|315417905|gb|ADU14545.1| Superoxide dismutase [Asticcacaulis excentricus CB 48]
          Length = 203

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 95/198 (47%), Positives = 125/198 (63%), Gaps = 2/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  D L P+MS  T  +HH  HHK Y DN  KL    E    SL EI+  S
Sbjct: 1   MAFELPALPYPTDALEPHMSANTFSFHHAKHHKAYVDNLNKLIDGTEFADKSLVEIVKAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+N G+FNNA+Q +NH  FW  MK N G      A++D I+ +FGSF+ F     TA +
Sbjct: 61  EGTNPGVFNNAAQVWNHTFFWHSMKPNGGGQP-TGAIADKINADFGSFDAFVEAFKTAGA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL + ++GKL++ KT NAE P   G  PIL +DVWEHAYYLD++  R  +IE
Sbjct: 120 TQFGSGWAWLVLGQDGKLKVVKTGNAETPFTKGDKPILTLDVWEHAYYLDYQNLRPKFIE 179

Query: 180 SFITNLVNWEYVCERYET 197
           +++T+LVNW++     + 
Sbjct: 180 TYLTSLVNWDFANSNLDA 197


>gi|126657346|ref|ZP_01728505.1| superoxide dismutase [Cyanothece sp. CCY0110]
 gi|126621333|gb|EAZ92045.1| superoxide dismutase [Cyanothece sp. CCY0110]
          Length = 200

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 93/200 (46%), Positives = 127/200 (63%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY Y  L P++SK TLE+HHD HH +Y           +     +EE+I   
Sbjct: 1   MGYELPKLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNAAVEGTDHDSKPIEEVIKAI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S  GLFNNA+Q +NH+ +W CMK   G      AL+D I+ +FGSF+KF  +   A
Sbjct: 61  AGDASKQGLFNNAAQAWNHSFYWNCMKPGGGGQP-TGALADKINADFGSFDKFVEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L++ KT NAENP+ +G  P+L +DVWEHAYYLD++  R  YI
Sbjct: 120 GATQFGSGWAWLVLNNGTLKVVKTLNAENPITSGQTPLLTMDVWEHAYYLDYQNSRPGYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++FI NL+NW++V +    A
Sbjct: 180 DTFINNLINWDFVADNMSKA 199


>gi|146283459|ref|YP_001173612.1| superoxide dismutase [Pseudomonas stutzeri A1501]
 gi|145571664|gb|ABP80770.1| superoxide dismutase [Pseudomonas stutzeri A1501]
 gi|327481856|gb|AEA85166.1| superoxide dismutase [Pseudomonas stutzeri DSM 4166]
          Length = 193

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P+MS ETL+YHHD HH  Y  N   L    E     LE II  S
Sbjct: 1   MAFELPPLPYEKNALEPHMSAETLDYHHDKHHAAYVTNLNNLIPGTEFEGKDLESIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW C+  N G      AL+DAI+ +FGSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFFWNCLAPNAGGQP-TGALADAINASFGSFDKFKEEFTKTAI 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K+   L ++ T  A NP+  G  P+L  DVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKSDGSLGLASTIGAGNPMTAGDKPLLTCDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V + + 
Sbjct: 177 AF-WNLVNWDFVAKNFA 192


>gi|270264159|ref|ZP_06192426.1| superoxide dismutase [Serratia odorifera 4Rx13]
 gi|270041808|gb|EFA14905.1| superoxide dismutase [Serratia odorifera 4Rx13]
          Length = 206

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/208 (38%), Positives = 116/208 (55%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +I+ 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEALIQD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K     G     L  AI+ +FGS EKF+ + 
Sbjct: 61  LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGG---DLKAAIERDFGSVEKFQEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ +R  YI++F  N+VNW+    R+  
Sbjct: 178 YQNKRPDYIKAF-WNVVNWDEAAARFAA 204


>gi|206578994|ref|YP_002241209.1| superoxide dismutase (Mn) [Klebsiella pneumoniae 342]
 gi|288937845|ref|YP_003441904.1| superoxide dismutase [Klebsiella variicola At-22]
 gi|206568052|gb|ACI09828.1| superoxide dismutase (Mn) [Klebsiella pneumoniae 342]
 gi|288892554|gb|ADC60872.1| Superoxide dismutase [Klebsiella variicola At-22]
          Length = 206

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +LS EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 178 FQNRRPDYIKAF-WDVVNWDEAAARFAA 204


>gi|302383779|ref|YP_003819602.1| superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194407|gb|ADL01979.1| Superoxide dismutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 242

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 83/202 (41%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLH-LSLEEIIIKS 60
            F LP LPY++D L P +  ET++ HH  HHK Y DN     +    L  L++E+++ + 
Sbjct: 41  AFTLPALPYAFDALDPAIDAETMQIHHGRHHKAYVDNLNAAVAADPALAGLAIEDLLGRV 100

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH+LFW  +      G+    LS AI  +FGS E FK+    AA+
Sbjct: 101 STLPAAVRNNGGGHWNHSLFWTLLAPVGQGGEPSPELSAAITRDFGSMEAFKTAFNQAAT 160

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           T+FGSGW WL V NGKL+I+ T N +NPL++       P+L +DVWEHAYYL ++ +RA 
Sbjct: 161 TRFGSGWAWLIVANGKLQITSTPNQDNPLMDLAEVRGTPVLAVDVWEHAYYLKYQNKRAD 220

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+ +F   +VNW+ V   Y  A
Sbjct: 221 YLTAF-WTVVNWDSVNRLYADA 241


>gi|83749054|ref|ZP_00946060.1| Superoxide dismutase [Ralstonia solanacearum UW551]
 gi|207725156|ref|YP_002255553.1| superoxide dismutase [fe] protein [Ralstonia solanacearum MolK2]
 gi|207742512|ref|YP_002258904.1| superoxide dismutase [fe] protein [Ralstonia solanacearum IPO1609]
 gi|300703207|ref|YP_003744809.1| superoxide dismutase [Ralstonia solanacearum CFBP2957]
 gi|83724244|gb|EAP71416.1| Superoxide dismutase [Ralstonia solanacearum UW551]
 gi|206590388|emb|CAQ37349.1| superoxide dismutase [fe] protein [Ralstonia solanacearum MolK2]
 gi|206593904|emb|CAQ60831.1| superoxide dismutase [fe] protein [Ralstonia solanacearum IPO1609]
 gi|299070870|emb|CBJ42172.1| superoxide dismutase [Ralstonia solanacearum CFBP2957]
          Length = 192

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 91/197 (46%), Positives = 123/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W  +K N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GLFNNAAQVWNHTFYWNGLKPNGGGAP-TGALADAINAKWGSFDKFKEEFTKTAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGTLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++V   + 
Sbjct: 177 AF-WSLVNWDFVANNFA 192


>gi|331009889|gb|EGH89945.1| superoxide dismutase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 193

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGDP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++  
Sbjct: 177 AF-WNLVNWDFVAKQFAA 193


>gi|296105392|ref|YP_003615538.1| superoxide dismutase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059851|gb|ADF64589.1| superoxide dismutase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295095068|emb|CBK84158.1| Superoxide dismutase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 206

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 178 FQNRRPDYIKAF-WDVVNWDEAAARFAA 204


>gi|293393768|ref|ZP_06638075.1| superoxide dismutase [Serratia odorifera DSM 4582]
 gi|291423595|gb|EFE96817.1| superoxide dismutase [Serratia odorifera DSM 4582]
          Length = 208

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 121/208 (58%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L +  E+  LS+EE+I  
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEELIQD 62

Query: 60  SHG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ + 
Sbjct: 63  LDKVPADKRTFMRNNAGGHANHSLFWKGLKT---GTTLSGDLKAAIERDFGSVEKFQEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ +R  YI++F  N+VNW+    R+  
Sbjct: 180 YQNKRPDYIKAF-WNVVNWDEAAARFAA 206


>gi|28871499|ref|NP_794118.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970314|ref|ZP_03398444.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato T1]
 gi|301385466|ref|ZP_07233884.1| superoxide dismutase [Pseudomonas syringae pv. tomato Max13]
 gi|302063004|ref|ZP_07254545.1| superoxide dismutase [Pseudomonas syringae pv. tomato K40]
 gi|302135288|ref|ZP_07261278.1| superoxide dismutase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28854750|gb|AAO57813.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213924986|gb|EEB58551.1| superoxide dismutase, Fe [Pseudomonas syringae pv. tomato T1]
 gi|330877882|gb|EGH12031.1| superoxide dismutase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330966142|gb|EGH66402.1| superoxide dismutase [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331017974|gb|EGH98030.1| superoxide dismutase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 193

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 94/198 (47%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALAEAINTAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V ++Y  
Sbjct: 177 AF-WNLVNWDFVAKQYAA 193


>gi|306447497|gb|ADM87596.1| manganese superoxide dismutase [Bacillus sp. MHS47]
          Length = 203

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH LFW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTLFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|330973342|gb|EGH73408.1| superoxide dismutase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 193

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 93/198 (46%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++ +
Sbjct: 177 AF-WNLVNWDFVAKQFAS 193


>gi|322830775|ref|YP_004210802.1| Manganese/iron superoxide dismutase-like protein [Rahnella sp.
           Y9602]
 gi|321165976|gb|ADW71675.1| Manganese/iron superoxide dismutase-like protein [Rahnella sp.
           Y9602]
          Length = 206

 Score =  204 bits (520), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 114/210 (54%), Gaps = 15/210 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  KET+E HH  HH+ Y +NA         L     E +I  
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALESLPELAALPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDQVPADKKVALRNNAGGHANHSLFWKGLKT---GTTLQGELKSAIERDFGSVDAFKETF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K+GKL +  T N ++PL+          P+LG+DVWEHAYYL 
Sbjct: 118 EKAATTRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGASGYPLLGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAM 199
           ++ +R  YI++F   +VNW+   +R   A 
Sbjct: 178 YQNKRPDYIKAF-WAVVNWDEAAKRLAEAK 206


>gi|332291751|ref|YP_004430360.1| Superoxide dismutase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169837|gb|AEE19092.1| Superoxide dismutase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 202

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 84/202 (41%), Positives = 114/202 (56%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L P +  +T+E HH  HH  Y           ++   ++E I+I  
Sbjct: 1   MSFTLPELPYAKDALEPNIDTKTMEIHHGKHHAGYTSKLNTAIEGTDLSGKTIENILINL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN  + NN   +YNH LFW  M   DG G+    L++AI+  +G+FE FK    +AA 
Sbjct: 61  DMSNTAVRNNGGGFYNHRLFWEVMSP-DGGGEPTGELAEAINAAYGNFESFKDKFSSAAG 119

Query: 121 TQFGSGWGWLSVKN-GKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
            QFGSGW WL V   GK+E+  T N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 120 GQFGSGWAWLCVHEGGKVEVCSTPNQDNPLMPKVGCGGFPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F  N++NWE V   Y  
Sbjct: 180 DYVNAFF-NVINWEKVSALYAQ 200


>gi|325266859|ref|ZP_08133530.1| superoxide dismutase [Kingella denitrificans ATCC 33394]
 gi|324981600|gb|EGC17241.1| superoxide dismutase [Kingella denitrificans ATCC 33394]
          Length = 208

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 113/211 (53%), Gaps = 17/211 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS---DAEMLHLSLEEII 57
           M F LP L Y+YD L P+    T+E HH  HH+ Y +NA          E   LS +E+I
Sbjct: 1   MAFTLPELGYAYDALEPHFDARTMEIHHGKHHQTYVNNANAAVEALGMPEFSALSADEVI 60

Query: 58  IK----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKS 113
            +           + NN   + NH  FWA +KK    G    +L  AI+ +FGS + FK+
Sbjct: 61  SRIAELPADKQTAVRNNVGGHANHTFFWASLKKGTVLGG---SLKAAIERDFGSVDAFKA 117

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYY 167
           +   AA T+FGSGW WL  + GKL++  T N ++PL+          P+  +DVWEH+YY
Sbjct: 118 EFEKAAQTRFGSGWAWLVAEGGKLKVVSTPNQDSPLMGKEIAGCSGTPLFCLDVWEHSYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           L F+ RR  YI+ F  N+VNW+    R++ A
Sbjct: 178 LKFQNRRPDYIKEF-WNVVNWDEAQRRFDQA 207


>gi|311030797|ref|ZP_07708887.1| superoxide dismutase [Bacillus sp. m3-13]
          Length = 202

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY+YD L P++ KET+  HH  HH  Y             L     E +I +
Sbjct: 1   MAYELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTGINAALEGQAELQGKSVEELISN 60

Query: 61  HG-----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH+LFW  +    G       L+DA+   FGSFE FK + 
Sbjct: 61  MDAVPENIKTAVRNHGGGHANHSLFW-NILTPGGATSPNGELADALTSKFGSFENFKDEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL V NG+LEI+ T N ++PL+ G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 AKAAATRFGSGWAWLVVNNGELEITSTPNQDSPLMEGKTPVLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW+ V + Y  A 
Sbjct: 180 DYINAFF-NVINWDVVGKLYNEAK 202


>gi|222151447|ref|YP_002560603.1| superoxide dismutase SodA [Macrococcus caseolyticus JCSC5402]
 gi|222120572|dbj|BAH17907.1| superoxide dismutase SodA [Macrococcus caseolyticus JCSC5402]
          Length = 199

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 121/203 (59%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++ KET+E HH  HH  Y        +  E  ++S+E+++ + 
Sbjct: 1   MAFELPKLEYAYDALEPHIDKETMEIHHTKHHNTYVTKLNDAVAGTEFENVSIEDLMKRI 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   +YNH+LFW  +       +    + DAI+  FGS + FK +  
Sbjct: 61  DEVPADKKTAVVNNGGGHYNHSLFWTLLAP---GKEAKGEVVDAIESKFGSLDAFKQEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            AA+ +FGSGW WL V NG+LE++ T N ENPL+ G  PILG+DVWEHAYYL+++ +R  
Sbjct: 118 DAAAGRFGSGWAWLVVNNGELEVTSTPNQENPLMEGKTPILGLDVWEHAYYLNYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNW+ V E Y +A 
Sbjct: 178 YIAAF-WNVVNWDKVNELYLSAK 199


>gi|152112297|sp|Q4L6Q3|SODM_STAHJ RecName: Full=Superoxide dismutase [Mn/Fe]
          Length = 199

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 83/201 (41%), Positives = 113/201 (56%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY+ D L P++ K+T+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYATDALEPHIDKQTMEIHHDKHHNTYVTKLNSAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS ++FK +  
Sbjct: 61  DSVPEDIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNWE V E Y  
Sbjct: 178 YISAF-WNVVNWEKVDELYNA 197


>gi|290513071|ref|ZP_06552434.1| Fe-Mn family superoxide dismutase [Klebsiella sp. 1_1_55]
 gi|289774453|gb|EFD82458.1| Fe-Mn family superoxide dismutase [Klebsiella sp. 1_1_55]
          Length = 210

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +LS EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 182 FQNRRPDYIKAF-WDVVNWDEAAARFAA 208


>gi|260595953|ref|YP_003208524.1| superoxide dismutase [Cronobacter turicensis z3032]
 gi|260215130|emb|CBA26912.1| Superoxide dismutase [Mn] [Cronobacter turicensis z3032]
          Length = 206

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 88/208 (42%), Positives = 121/208 (58%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E+ +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPELANLPVEELIAK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS EKFK + 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVEKFKEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGYPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+ +
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAS 204


>gi|170769660|ref|ZP_02904113.1| superoxide dismutase (Mn) [Escherichia albertii TW07627]
 gi|170121468|gb|EDS90399.1| superoxide dismutase (Mn) [Escherichia albertii TW07627]
          Length = 206

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +LS+EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFANLSVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LEQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|330818107|ref|YP_004361812.1| Superoxide dismutase [Burkholderia gladioli BSR3]
 gi|327370500|gb|AEA61856.1| Superoxide dismutase [Burkholderia gladioli BSR3]
          Length = 192

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S ET+++H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISAETIQFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G      AL DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPQGGGAP-TGALGDAINAKWGSFDAFKEAFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|320182334|gb|EFW57235.1| Manganese superoxide dismutase [Shigella boydii ATCC 9905]
          Length = 206

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA++ FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASCFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|53803389|ref|YP_114872.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
 gi|53757150|gb|AAU91441.1| superoxide dismutase, Fe [Methylococcus capsulatus str. Bath]
          Length = 194

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 88/197 (44%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+   L P++S ETLEYH+  HH+ Y  N   L    E  +LSLEEII K+
Sbjct: 1   MTHELPALPYAKTALEPHISAETLEYHYGKHHQTYVTNLNNLIPGTEYENLSLEEIIRKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 +FNNA+Q +NH  +W  +  N G      AL++AI  +FGSFEKFK      A 
Sbjct: 61  PAGG--VFNNAAQVWNHTFYWNSLSPNGGGEP-TGALAEAIVKSFGSFEKFKEAFTQCAV 117

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL    +G L +  T NA  PL +   P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 118 TTFGSGWAWLVKNADGSLALVSTSNAGCPLTSDQTPLLTCDVWEHAYYIDYRNARPKYLE 177

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNWE+    + 
Sbjct: 178 AF-WNLVNWEFAAANFA 193


>gi|207859243|ref|YP_002245894.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|206711046|emb|CAR35418.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 206

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+ FW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSFFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|301779948|ref|XP_002925391.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 234

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 105/201 (52%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N   +              I     
Sbjct: 38  HSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNAIEEKYLEALEKG--DITAQVA 95

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              GL  N   + NH++FW  +    G G+    L +AI  +FGSFEKFK  L T +   
Sbjct: 96  LQPGLKFNGGGHINHSIFWTNLSP-KGGGEPKGELLEAIKRDFGSFEKFKEKLTTVSVGV 154

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 155 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 214

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 215 A-IWNVINWENVTERYMAGKK 234


>gi|323964261|gb|EGB59744.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli M863]
 gi|327250544|gb|EGE62252.1| superoxide dismutase [Escherichia coli STEC_7v]
          Length = 206

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGETISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|323174353|gb|EFZ59979.1| superoxide dismutase [Escherichia coli LT-68]
          Length = 206

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEEVITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|298243063|ref|ZP_06966870.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
 gi|297556117|gb|EFH89981.1| Superoxide dismutase [Ktedonobacter racemifer DSM 44963]
          Length = 257

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 81/203 (39%), Positives = 115/203 (56%), Gaps = 7/203 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP L Y+Y+ L PY+  +T++ HHD HH  Y  N      +     L +EE++ + + 
Sbjct: 56  FQLPPLGYAYNALEPYIDAQTMQLHHDKHHATYVKNLNDALKNHPFASLPIEEVLRRINE 115

Query: 63  S----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH++FW  MK   G G+    L+ AI  NFGSF  FK    T 
Sbjct: 116 LPENIRTAVRNNGGGHANHSMFWRIMKP-KGGGEPAGELASAIKANFGSFASFKEAFNTT 174

Query: 119 ASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
            S  FGSGW WL S K+GKL+I+   N ++PL+NG  P++G DVWEHAYYL  + RRA Y
Sbjct: 175 GSKVFGSGWVWLVSDKSGKLQITSAANQDSPLLNGLYPVMGNDVWEHAYYLKHQNRRADY 234

Query: 178 IESFITNLVNWEYVCERYETAML 200
           + +   N+ NW+ + +RY  A  
Sbjct: 235 LNA-WWNVTNWDEIAKRYGQAKN 256


>gi|215489240|ref|YP_002331671.1| superoxide dismutase [Escherichia coli O127:H6 str. E2348/69]
 gi|312969340|ref|ZP_07783542.1| superoxide dismutase [Mn] [Escherichia coli 2362-75]
 gi|215267312|emb|CAS11761.1| superoxide dismutase, Mn [Escherichia coli O127:H6 str. E2348/69]
 gi|281180979|dbj|BAI57309.1| superoxide dismutase [Escherichia coli SE15]
 gi|312285887|gb|EFR13805.1| superoxide dismutase [Mn] [Escherichia coli 2362-75]
 gi|323189670|gb|EFZ74949.1| superoxide dismutase [Escherichia coli RN587/1]
 gi|330908229|gb|EGH36748.1| manganese superoxide dismutase [Escherichia coli AA86]
          Length = 206

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|332290160|ref|YP_004421012.1| superoxide dismutase [Gallibacterium anatis UMN179]
 gi|330433056|gb|AEC18115.1| superoxide dismutase [Gallibacterium anatis UMN179]
          Length = 209

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 119/209 (56%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+YD L P+    T+E HH  HH+ Y +NA  L         ++       
Sbjct: 1   MAYTLPELGYAYDALEPHFDALTMEIHHSKHHQAYVNNANALLEGLSEELKAMCPGKLSA 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
            +         GL NNA  ++NH+LFW  +KK      +   L +AI+ +FGS + FK++
Sbjct: 61  NLDKVPAEKRTGLRNNAGGHFNHSLFWKSLKK---GTTLQGKLKEAIERDFGSVDAFKAE 117

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYL 168
              AA+T+FGSGW WL +K+GKL +  T N +NPL+          P++G+DVWEHAYYL
Sbjct: 118 FEKAAATRFGSGWAWLVLKDGKLSVVSTANQDNPLMGKDIAGCEGFPLVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            F+ RR  YI+ F  N++NW++V +RYE 
Sbjct: 178 KFQNRRPDYIKEF-WNVINWDFVAQRYEE 205


>gi|238028443|ref|YP_002912674.1| Superoxide dismutase [Burkholderia glumae BGR1]
 gi|237877637|gb|ACR29970.1| Superoxide dismutase [Burkholderia glumae BGR1]
          Length = 192

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 86/197 (43%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|167835698|ref|ZP_02462581.1| superoxide dismutase [Burkholderia thailandensis MSMB43]
          Length = 192

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E   L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFESLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI   +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAISAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|16767321|ref|NP_462936.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167991587|ref|ZP_02572686.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|197265735|ref|ZP_03165809.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|20141756|sp|P43019|SODM_SALTY RecName: Full=Superoxide dismutase [Mn]
 gi|16422620|gb|AAL22895.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|197243990|gb|EDY26610.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205330089|gb|EDZ16853.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261249172|emb|CBG27033.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996350|gb|ACY91235.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160563|emb|CBW20093.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312915171|dbj|BAJ39145.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|332990884|gb|AEF09867.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 206

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFASLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|167035466|ref|YP_001670697.1| superoxide dismutase [Pseudomonas putida GB-1]
 gi|33860110|sp|P09223|SODF_PSEPU RecName: Full=Superoxide dismutase [Fe]
 gi|1498060|gb|AAB06332.1| iron superoxide dismutase [Pseudomonas putida]
 gi|166861954|gb|ABZ00362.1| Superoxide dismutase [Pseudomonas putida GB-1]
          Length = 198

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 94/197 (47%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A  PL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AF-WNLVNWAFVAEQFE 192


>gi|254721868|ref|ZP_05183657.1| superoxide dismutase, Mn [Bacillus anthracis str. A1055]
          Length = 203

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNATLEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|167031968|ref|YP_001667199.1| superoxide dismutase [Pseudomonas putida GB-1]
 gi|166858456|gb|ABY96863.1| Superoxide dismutase [Pseudomonas putida GB-1]
          Length = 203

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 1   MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAAIEGTEWAEWPVEKLVGAV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G   V Q L+ A+    G FE FK    
Sbjct: 61  KQLPENLRGAVTNHGGGHANHSLFWTVMSPQGGGEPVGQ-LAQAVTAQLGGFEAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMHGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWAQVERRYLEALK 203


>gi|261749421|ref|YP_003257107.1| superoxide dismutase, iron/manganese-dependent [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497514|gb|ACX83964.1| superoxide dismutase, iron/manganese-dependent [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 204

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 124/205 (60%), Gaps = 5/205 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKLP L YSY DL PY+ ++T+E H+  HH  Y +N  K     ++ HLS+EEI+ +S
Sbjct: 1   MSFKLPKLSYSYKDLEPYIDQKTMEIHYTKHHAGYTNNLNKAIEGTDLTHLSIEEILRRS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +     + NN   +YNHNLFW  +  +       + L +AI+ NF SF+ FK    + A 
Sbjct: 61  NIEKPIIRNNGGGFYNHNLFWEILIPHLDYTHPSKYLKNAIEKNFKSFDAFKEKFTSIAM 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRAH 176
            +FGSGW WL VK  +L I  T N +NP++       +PILG+DVWEHAYYL ++ RRA 
Sbjct: 121 NRFGSGWTWLCVKEKRLTICSTANQDNPVMLGIGCEGVPILGLDVWEHAYYLQYQNRRAD 180

Query: 177 YIESFITNLVNWEYVCERYETAMLA 201
           YI SF  N++NW+ V E Y+ ++  
Sbjct: 181 YISSF-WNIINWKKVEENYKKSIEE 204


>gi|205354366|ref|YP_002228167.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205274147|emb|CAR39159.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
          Length = 206

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 117/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENFPEFADLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+ FW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSFFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|239787519|emb|CAX83989.1| Superoxide dismutase [uncultured bacterium]
          Length = 198

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 87/199 (43%), Positives = 122/199 (61%), Gaps = 3/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P+MS  T E+HH  HH  Y  N   L       +  LEE+ ++ 
Sbjct: 1   MAFELPALPYASNALEPHMSARTFEFHHGKHHAAYVTNLNNLVKGTPYENRPLEEVFMEV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S A +FNNA+Q +NH  FW CMK   G G     L   ID  FGSF+KFK +   A
Sbjct: 61  GGDVSKAAIFNNAAQVWNHTFFWNCMKP-GGGGAPTGDLKAKIDAAFGSFDKFKEEFKAA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A   FGSGW WL + NG+++ISKT NA+ P+ +G   +L +DVWEHAYY+D++ RR  ++
Sbjct: 120 AVGNFGSGWTWLVIDNGEMKISKTSNADTPMRHGQKALLTVDVWEHAYYIDYQNRRPDFV 179

Query: 179 ESFITNLVNWEYVCERYET 197
           ++F+ +LVNW++V +    
Sbjct: 180 QAFLDHLVNWDFVAKNLAE 198


>gi|330888528|gb|EGH21189.1| superoxide dismutase [Pseudomonas syringae pv. mori str. 301020]
          Length = 193

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 92/198 (46%), Positives = 123/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+    G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPKAGGEP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++  
Sbjct: 177 AF-WNLVNWDFVAKQFAA 193


>gi|82778924|ref|YP_405273.1| superoxide dismutase [Shigella dysenteriae Sd197]
 gi|309783834|ref|ZP_07678479.1| superoxide dismutase [Shigella dysenteriae 1617]
 gi|81243072|gb|ABB63782.1| superoxide dismutase, manganese [Shigella dysenteriae Sd197]
 gi|308928205|gb|EFP73667.1| superoxide dismutase [Shigella dysenteriae 1617]
          Length = 206

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LEQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|16762379|ref|NP_457996.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29143867|ref|NP_807209.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56415901|ref|YP_152976.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|167551453|ref|ZP_02345208.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168232994|ref|ZP_02658052.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168244193|ref|ZP_02669125.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168263044|ref|ZP_02685017.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168467396|ref|ZP_02701233.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168821597|ref|ZP_02833597.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194444427|ref|YP_002043279.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194449279|ref|YP_002048058.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194469129|ref|ZP_03075113.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197249648|ref|YP_002148986.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197364830|ref|YP_002144467.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198242216|ref|YP_002217982.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200387803|ref|ZP_03214415.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204930330|ref|ZP_03221307.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|213426102|ref|ZP_03358852.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213645965|ref|ZP_03376018.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213854677|ref|ZP_03382917.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289825995|ref|ZP_06545154.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|20455285|sp|Q8Z2V9|SODM_SALTI RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|25285816|pir||AG0943 manganese superoxide dismutase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504683|emb|CAD09569.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139503|gb|AAO71069.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130158|gb|AAV79664.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194403090|gb|ACF63312.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407583|gb|ACF67802.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194455493|gb|EDX44332.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195630215|gb|EDX48855.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197096307|emb|CAR61908.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213351|gb|ACH50748.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197936732|gb|ACH74065.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199604901|gb|EDZ03446.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204320734|gb|EDZ05936.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205323712|gb|EDZ11551.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205332839|gb|EDZ19603.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336869|gb|EDZ23633.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205341793|gb|EDZ28557.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348197|gb|EDZ34828.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|320088466|emb|CBY98225.1| superoxide dismutase, manganese [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 206

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|323132400|gb|ADX19830.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
          Length = 210

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFASLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|15804498|ref|NP_290538.1| superoxide dismutase [Escherichia coli O157:H7 EDL933]
 gi|30064799|ref|NP_838970.1| superoxide dismutase [Shigella flexneri 2a str. 2457T]
 gi|56480476|ref|NP_709712.2| superoxide dismutase [Shigella flexneri 2a str. 301]
 gi|74314409|ref|YP_312828.1| superoxide dismutase [Shigella sonnei Ss046]
 gi|82546258|ref|YP_410205.1| superoxide dismutase [Shigella boydii Sb227]
 gi|110807403|ref|YP_690923.1| superoxide dismutase [Shigella flexneri 5 str. 8401]
 gi|157157036|ref|YP_001465399.1| superoxide dismutase [Escherichia coli E24377A]
 gi|168748799|ref|ZP_02773821.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4113]
 gi|168755588|ref|ZP_02780595.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4401]
 gi|168761713|ref|ZP_02786720.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4501]
 gi|168768206|ref|ZP_02793213.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4486]
 gi|168775261|ref|ZP_02800268.1| superoxide dismutase (Mn) [Escherichia coli O157:H7 str. EC4196]
 gi|168780821|ref|ZP_02805828.1| superoxide dismutase (Mn) [Escherichia coli O157:H7 str. EC4076]
 gi|168786760|ref|ZP_02811767.1| superoxide dismutase [Escherichia coli O157:H7 str. EC869]
 gi|168799516|ref|ZP_02824523.1| superoxide dismutase [Escherichia coli O157:H7 str. EC508]
 gi|187733530|ref|YP_001882601.1| superoxide dismutase [Shigella boydii CDC 3083-94]
 gi|191166406|ref|ZP_03028237.1| superoxide dismutase [Escherichia coli B7A]
 gi|193063899|ref|ZP_03044985.1| superoxide dismutase [Escherichia coli E22]
 gi|193068106|ref|ZP_03049071.1| superoxide dismutase [Escherichia coli E110019]
 gi|194427453|ref|ZP_03060002.1| superoxide dismutase [Escherichia coli B171]
 gi|194433251|ref|ZP_03065532.1| superoxide dismutase [Shigella dysenteriae 1012]
 gi|194438293|ref|ZP_03070384.1| superoxide dismutase [Escherichia coli 101-1]
 gi|195937550|ref|ZP_03082932.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4024]
 gi|208808602|ref|ZP_03250939.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4206]
 gi|208812269|ref|ZP_03253598.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4045]
 gi|208818807|ref|ZP_03259127.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4042]
 gi|209400600|ref|YP_002273425.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4115]
 gi|209921388|ref|YP_002295472.1| superoxide dismutase [Escherichia coli SE11]
 gi|217324317|ref|ZP_03440401.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14588]
 gi|218556471|ref|YP_002389385.1| superoxide dismutase [Escherichia coli IAI1]
 gi|218697623|ref|YP_002405290.1| superoxide dismutase [Escherichia coli 55989]
 gi|218707533|ref|YP_002415052.1| superoxide dismutase [Escherichia coli UMN026]
 gi|253775452|ref|YP_003038283.1| superoxide dismutase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163859|ref|YP_003046967.1| superoxide dismutase [Escherichia coli B str. REL606]
 gi|254795908|ref|YP_003080745.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14359]
 gi|256021554|ref|ZP_05435419.1| superoxide dismutase [Shigella sp. D9]
 gi|260846671|ref|YP_003224449.1| superoxide dismutase SodA [Escherichia coli O103:H2 str. 12009]
 gi|260857690|ref|YP_003231581.1| superoxide dismutase SodA [Escherichia coli O26:H11 str. 11368]
 gi|260870628|ref|YP_003237030.1| superoxide dismutase SodA [Escherichia coli O111:H- str. 11128]
 gi|261223541|ref|ZP_05937822.1| superoxide dismutase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257303|ref|ZP_05949836.1| superoxide dismutase [Escherichia coli O157:H7 str. FRIK966]
 gi|293407528|ref|ZP_06651447.1| superoxide dismutase [Escherichia coli FVEC1412]
 gi|293413347|ref|ZP_06656008.1| superoxide dismutase [Escherichia coli B354]
 gi|293417372|ref|ZP_06659996.1| superoxide dismutase [Escherichia coli B185]
 gi|293470222|ref|ZP_06664633.1| superoxide dismutase [Escherichia coli B088]
 gi|298383276|ref|ZP_06992869.1| superoxide dismutase [Escherichia coli FVEC1302]
 gi|307313964|ref|ZP_07593578.1| Superoxide dismutase [Escherichia coli W]
 gi|331665560|ref|ZP_08366458.1| superoxide dismutase (Mn) [Escherichia coli TA143]
 gi|331670760|ref|ZP_08371596.1| superoxide dismutase (Mn) [Escherichia coli TA271]
 gi|54039612|sp|P66829|SODM_SHIFL RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|54042218|sp|P66828|SODM_ECO57 RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|12518807|gb|AAG59102.1|AE005622_4 superoxide dismutase, manganese [Escherichia coli O157:H7 str.
           EDL933]
 gi|13364310|dbj|BAB38257.1| superoxide dismutase SodA [Escherichia coli O157:H7 str. Sakai]
 gi|30043059|gb|AAP18781.1| superoxide dismutase, manganese [Shigella flexneri 2a str. 2457T]
 gi|56384027|gb|AAN45419.2| superoxide dismutase, manganese [Shigella flexneri 2a str. 301]
 gi|73857886|gb|AAZ90593.1| superoxide dismutase, manganese [Shigella sonnei Ss046]
 gi|81247669|gb|ABB68377.1| superoxide dismutase, manganese [Shigella boydii Sb227]
 gi|110616951|gb|ABF05618.1| superoxide dismutase, manganese [Shigella flexneri 5 str. 8401]
 gi|157079066|gb|ABV18774.1| superoxide dismutase (Mn) [Escherichia coli E24377A]
 gi|187430522|gb|ACD09796.1| superoxide dismutase (Mn) [Shigella boydii CDC 3083-94]
 gi|187769197|gb|EDU33041.1| superoxide dismutase (Mn) [Escherichia coli O157:H7 str. EC4196]
 gi|188016771|gb|EDU54893.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4113]
 gi|189001457|gb|EDU70443.1| superoxide dismutase (Mn) [Escherichia coli O157:H7 str. EC4076]
 gi|189357143|gb|EDU75562.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4401]
 gi|189362710|gb|EDU81129.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4486]
 gi|189367896|gb|EDU86312.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4501]
 gi|189373231|gb|EDU91647.1| superoxide dismutase [Escherichia coli O157:H7 str. EC869]
 gi|189378075|gb|EDU96491.1| superoxide dismutase [Escherichia coli O157:H7 str. EC508]
 gi|190903506|gb|EDV63224.1| superoxide dismutase [Escherichia coli B7A]
 gi|192929364|gb|EDV82972.1| superoxide dismutase [Escherichia coli E22]
 gi|192958726|gb|EDV89164.1| superoxide dismutase [Escherichia coli E110019]
 gi|194414493|gb|EDX30766.1| superoxide dismutase [Escherichia coli B171]
 gi|194418535|gb|EDX34623.1| superoxide dismutase [Shigella dysenteriae 1012]
 gi|194422730|gb|EDX38726.1| superoxide dismutase [Escherichia coli 101-1]
 gi|208728403|gb|EDZ78004.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4206]
 gi|208733546|gb|EDZ82233.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4045]
 gi|208738930|gb|EDZ86612.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4042]
 gi|209162000|gb|ACI39433.1| superoxide dismutase [Escherichia coli O157:H7 str. EC4115]
 gi|209752458|gb|ACI74536.1| 2-keto-3-deoxy-D-gluconate transport system protein [Escherichia
           coli]
 gi|209752460|gb|ACI74537.1| 2-keto-3-deoxy-D-gluconate transport system protein [Escherichia
           coli]
 gi|209752462|gb|ACI74538.1| 2-keto-3-deoxy-D-gluconate transport system protein [Escherichia
           coli]
 gi|209752464|gb|ACI74539.1| 2-keto-3-deoxy-D-gluconate transport system protein [Escherichia
           coli]
 gi|209752466|gb|ACI74540.1| 2-keto-3-deoxy-D-gluconate transport system protein [Escherichia
           coli]
 gi|209914647|dbj|BAG79721.1| superoxide dismutase [Escherichia coli SE11]
 gi|217320538|gb|EEC28962.1| superoxide dismutase [Escherichia coli O157:H7 str. TW14588]
 gi|218354355|emb|CAV01096.1| superoxide dismutase, Mn [Escherichia coli 55989]
 gi|218363240|emb|CAR00885.1| superoxide dismutase, Mn [Escherichia coli IAI1]
 gi|218434630|emb|CAR15563.1| superoxide dismutase, Mn [Escherichia coli UMN026]
 gi|242379445|emb|CAQ34260.1| superoxide dismutase (Mn) [Escherichia coli BL21(DE3)]
 gi|253326496|gb|ACT31098.1| Superoxide dismutase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975760|gb|ACT41431.1| superoxide dismutase, Mn [Escherichia coli B str. REL606]
 gi|253979917|gb|ACT45587.1| superoxide dismutase, Mn [Escherichia coli BL21(DE3)]
 gi|254595308|gb|ACT74669.1| superoxide dismutase, Mn [Escherichia coli O157:H7 str. TW14359]
 gi|257756339|dbj|BAI27841.1| superoxide dismutase SodA [Escherichia coli O26:H11 str. 11368]
 gi|257761818|dbj|BAI33315.1| superoxide dismutase SodA [Escherichia coli O103:H2 str. 12009]
 gi|257766984|dbj|BAI38479.1| superoxide dismutase SodA [Escherichia coli O111:H- str. 11128]
 gi|281603303|gb|ADA76287.1| Superoxide dismutase [Shigella flexneri 2002017]
 gi|291321432|gb|EFE60871.1| superoxide dismutase [Escherichia coli B088]
 gi|291425445|gb|EFE98484.1| superoxide dismutase [Escherichia coli FVEC1412]
 gi|291430892|gb|EFF03888.1| superoxide dismutase [Escherichia coli B185]
 gi|291468095|gb|EFF10593.1| superoxide dismutase [Escherichia coli B354]
 gi|298276310|gb|EFI17830.1| superoxide dismutase [Escherichia coli FVEC1302]
 gi|306906281|gb|EFN36797.1| Superoxide dismutase [Escherichia coli W]
 gi|313647197|gb|EFS11650.1| superoxide dismutase [Mn] [Shigella flexneri 2a str. 2457T]
 gi|315063200|gb|ADT77527.1| superoxide dismutase, Mn [Escherichia coli W]
 gi|320177070|gb|EFW52089.1| Manganese superoxide dismutase [Shigella dysenteriae CDC 74-1112]
 gi|320186916|gb|EFW61633.1| Manganese superoxide dismutase [Shigella flexneri CDC 796-83]
 gi|320190995|gb|EFW65645.1| Manganese superoxide dismutase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320198885|gb|EFW73483.1| Manganese superoxide dismutase [Escherichia coli EC4100B]
 gi|320639158|gb|EFX08789.1| superoxide dismutase [Escherichia coli O157:H7 str. G5101]
 gi|320644547|gb|EFX13604.1| superoxide dismutase [Escherichia coli O157:H- str. 493-89]
 gi|320649870|gb|EFX18382.1| superoxide dismutase [Escherichia coli O157:H- str. H 2687]
 gi|320655271|gb|EFX23217.1| superoxide dismutase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320660898|gb|EFX28344.1| superoxide dismutase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320665963|gb|EFX32986.1| superoxide dismutase [Escherichia coli O157:H7 str. LSU-61]
 gi|323154015|gb|EFZ40224.1| superoxide dismutase [Escherichia coli EPECa14]
 gi|323161190|gb|EFZ47107.1| superoxide dismutase [Escherichia coli E128010]
 gi|323167333|gb|EFZ53041.1| superoxide dismutase [Shigella sonnei 53G]
 gi|323177928|gb|EFZ63512.1| superoxide dismutase [Escherichia coli 1180]
 gi|323182359|gb|EFZ67767.1| superoxide dismutase [Escherichia coli 1357]
 gi|323380735|gb|ADX53003.1| Manganese/iron superoxide dismutase-like protein [Escherichia coli
           KO11]
 gi|323943745|gb|EGB39843.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H120]
 gi|323959322|gb|EGB54983.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H489]
 gi|323969661|gb|EGB64945.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli TA007]
 gi|323974317|gb|EGB69446.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli TW10509]
 gi|324115654|gb|EGC09591.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E1167]
 gi|326338082|gb|EGD61912.1| Manganese superoxide dismutase [Escherichia coli O157:H7 str. 1044]
 gi|326342623|gb|EGD66396.1| Manganese superoxide dismutase [Escherichia coli O157:H7 str. 1125]
 gi|331057245|gb|EGI29235.1| superoxide dismutase (Mn) [Escherichia coli TA143]
 gi|331062015|gb|EGI33938.1| superoxide dismutase (Mn) [Escherichia coli TA271]
 gi|332084148|gb|EGI89353.1| superoxide dismutase [Shigella boydii 5216-82]
 gi|332085217|gb|EGI90395.1| superoxide dismutase [Shigella dysenteriae 155-74]
 gi|332088272|gb|EGI93392.1| superoxide dismutase [Shigella boydii 3594-74]
 gi|332751607|gb|EGJ82006.1| superoxide dismutase [Shigella flexneri 4343-70]
 gi|332751879|gb|EGJ82276.1| superoxide dismutase [Shigella flexneri K-671]
 gi|332752626|gb|EGJ83012.1| superoxide dismutase [Shigella flexneri 2747-71]
 gi|332764555|gb|EGJ94787.1| superoxide dismutase [Shigella flexneri 2930-71]
 gi|332998463|gb|EGK18061.1| superoxide dismutase [Shigella flexneri K-272]
 gi|332998565|gb|EGK18162.1| superoxide dismutase [Shigella flexneri K-218]
 gi|333013844|gb|EGK33206.1| superoxide dismutase [Shigella flexneri K-304]
 gi|333014156|gb|EGK33513.1| superoxide dismutase [Shigella flexneri K-227]
          Length = 206

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|315224726|ref|ZP_07866549.1| superoxide dismutase [Capnocytophaga ochracea F0287]
 gi|314945354|gb|EFS97380.1| superoxide dismutase [Capnocytophaga ochracea F0287]
          Length = 201

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 96/198 (48%), Positives = 121/198 (61%), Gaps = 7/198 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E H+  HH  Y  N     + A +   ++EEI+     
Sbjct: 2   FTLPKLPYAYNALEPYIDARTMEIHYTKHHNAYTTNLNTALAPAGVEGKTIEEILTSLDM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AI++ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEVMSPN-GGGKPTGELAKAIEEAFGSFEAFKEVFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GKLEI  T N +NPL+        PILG+DVWEHAYYL ++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKLEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLHYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERY 195
           IE+F  N++NW  V E Y
Sbjct: 181 IEAFF-NVINWAKVAELY 197


>gi|237728018|ref|ZP_04558499.1| superoxide dismutase [Citrobacter sp. 30_2]
 gi|226910275|gb|EEH96193.1| superoxide dismutase [Citrobacter sp. 30_2]
          Length = 210

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS+EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFASLSVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|808038|gb|AAC43331.1| Mn-superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 205

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 15/207 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFASLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYE 196
           F+ RR  YI+ F  N+VNW+    R+ 
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFA 203


>gi|93007055|ref|YP_581492.1| superoxide dismutase [Psychrobacter cryohalolentis K5]
 gi|92394733|gb|ABE76008.1| Superoxide dismutase [Psychrobacter cryohalolentis K5]
          Length = 209

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 86/197 (43%), Positives = 122/197 (61%), Gaps = 4/197 (2%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII--KSH 61
            LP+LPY+ D L P++S ETLE+HHD HH  Y     +L   + +   +L EIII     
Sbjct: 5   TLPDLPYAKDALEPHISAETLEFHHDKHHNAYVTKLNELLPGSGLEDKTLSEIIIATAKD 64

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
            S  G+FN A+Q +NH  +W CM   +G G+    L   I+++FGS++KF+ +   AA T
Sbjct: 65  DSKQGMFNQAAQVWNHTFYWNCMTPTNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAALT 124

Query: 122 QFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           QFGSGW WL       KL I+KT NA+ PL +  I +L  DVWEHAYY+D++ RR  Y++
Sbjct: 125 QFGSGWAWLVADKVGGKLSIAKTANADTPLAHDQIAVLTCDVWEHAYYIDYRNRRPDYVD 184

Query: 180 SFITNLVNWEYVCERYE 196
           +F+  LVNW+Y   +Y+
Sbjct: 185 TFLDKLVNWDYANAKYK 201


>gi|326629493|gb|EGE35836.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 210

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 117/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENFPEFADLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+ FW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSFFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|221066171|ref|ZP_03542276.1| Superoxide dismutase [Comamonas testosteroni KF-1]
 gi|220711194|gb|EED66562.1| Superoxide dismutase [Comamonas testosteroni KF-1]
          Length = 211

 Score =  204 bits (518), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 82/212 (38%), Positives = 117/212 (55%), Gaps = 11/212 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y Y  L P++  +T+E H+  HH+ Y +N       +E    SL++++ K 
Sbjct: 1   MSYTLPPLAYDYAALEPHIDAQTMEIHYSRHHQTYVNNLNAALEGSEYAQWSLDDLLAKV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G    AL+ AID + G FE FK++  
Sbjct: 61  ESLPQTLRQAVRNNGGGHANHSLFWQVMSP-GGGGLPQNALAAAIDKDLGGFENFKTEFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFK 171
            AA ++FGSGW WLSV    KL +  + N +NPL+    +G  PILG+DVWEHAYYL ++
Sbjct: 120 KAAISRFGSGWAWLSVDRSGKLHVESSANQDNPLMLGIGSGNTPILGLDVWEHAYYLKYQ 179

Query: 172 YRRAHYIESFITNLVNWEYVCERYETAMLAQK 203
            RR  YI +F  N+V+W  V  R+  A  A +
Sbjct: 180 NRRPEYIAAFY-NVVDWNEVARRFAAATQAVR 210


>gi|253576190|ref|ZP_04853522.1| superoxide dismutase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844533|gb|EES72549.1| superoxide dismutase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 209

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 80/206 (38%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY  + L P++ + T+  HHD HH  Y  N       A  L     E +I  
Sbjct: 5   MAHQLPALPYPNNALEPHIDETTMMIHHDRHHNTYVTNLNAALESAPELQSKSVEELISD 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L++AI++  G F+KFK + 
Sbjct: 65  LDSVPESIRTAVRNNGGGHANHSLFWETIGPNGGGQP-SGKLAEAINNELGGFDKFKEEF 123

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW +L+V  NGKL +    N ++PL+ G  PILG+DVWEHAYYL ++ +R
Sbjct: 124 TKAATTRFGSGWAFLAVDANGKLSVYSLPNQDSPLMEGKTPILGLDVWEHAYYLKYQNKR 183

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N++NW  V +RYE A+ 
Sbjct: 184 PDYIAAFF-NVINWPAVEKRYEAALN 208


>gi|223041770|ref|ZP_03611962.1| manganese superoxide dismutase [Actinobacillus minor 202]
 gi|223017421|gb|EEF15840.1| manganese superoxide dismutase [Actinobacillus minor 202]
          Length = 213

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 79/212 (37%), Positives = 116/212 (54%), Gaps = 15/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA        E+L     ++I  
Sbjct: 1   MAYTLPELGYAYDALEPHFDAKTMEIHHSKHHQAYINNANAALEAYPELLEQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +  AL D+I  +FGS E F++  
Sbjct: 61  LEQVPAEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDSIVRDFGSVEAFQAQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL+
Sbjct: 118 EQAAATRFGSGWAWLVLEDGKLAVVSTANQDSPLMGKEVAGVSGYPILGLDVWEHAYYLN 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           ++ RR  YI++F  N+VNW+    R+E  +  
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEDKVKT 208


>gi|294055424|ref|YP_003549082.1| Superoxide dismutase [Coraliomargarita akajimensis DSM 45221]
 gi|293614757|gb|ADE54912.1| Superoxide dismutase [Coraliomargarita akajimensis DSM 45221]
          Length = 208

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 74/210 (35%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+YD L P+    T+E HH  HH  Y  N         +   SL E++   
Sbjct: 1   MAHELPALPYAYDALEPHFDARTMEIHHSKHHNAYVTNLNAALEGTGLEDKSLCELLSDL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+ FW  +  N G       L+ AID   G F+  K    
Sbjct: 61  DAVPAEKRGAVRNNGGGHANHSFFWKILSSNGGGAP-TGELAAAIDAELGGFDALKEAFA 119

Query: 117 TAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLIN-----GAIPILGIDVWEHAYYLDF 170
            A +T+FGSGW WL VK +G L ++ T N + P ++        P++G+DVWEHAYYL +
Sbjct: 120 KAGATRFGSGWAWLVVKADGSLAVTSTPNQDCPCMSGVAEVEGKPVIGLDVWEHAYYLKY 179

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAML 200
           +  R  YIE+F  N+V+W    E Y+ A  
Sbjct: 180 QNLRPKYIEAF-WNVVDWSAAEENYKAAKA 208


>gi|15924543|ref|NP_372077.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927133|ref|NP_374666.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283234|ref|NP_646322.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus MW2]
 gi|49483802|ref|YP_041026.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49486389|ref|YP_043610.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57651946|ref|YP_186450.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|82751156|ref|YP_416897.1| superoxide dismutase [Staphylococcus aureus RF122]
 gi|87161707|ref|YP_494208.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195361|ref|YP_500165.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268037|ref|YP_001246980.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|150394105|ref|YP_001316780.1| superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|151221668|ref|YP_001332490.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156979871|ref|YP_001442130.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509782|ref|YP_001575441.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140027|ref|ZP_03564520.1| superoxide dismutase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253314924|ref|ZP_04838137.1| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732206|ref|ZP_04866371.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733197|ref|ZP_04867362.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|255006339|ref|ZP_05144940.2| Fe/Mn family superoxide dismutase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425678|ref|ZP_05602102.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257428339|ref|ZP_05604737.1| superoxide dismutase  1 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430976|ref|ZP_05607356.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433664|ref|ZP_05610022.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436578|ref|ZP_05612622.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793629|ref|ZP_05642608.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9781]
 gi|258411071|ref|ZP_05681351.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9763]
 gi|258420125|ref|ZP_05683080.1| superoxide dismutase 1 [Staphylococcus aureus A9719]
 gi|258423206|ref|ZP_05686099.1| superoxide dismutase 1 [Staphylococcus aureus A9635]
 gi|258437385|ref|ZP_05689369.1| superoxide dismutase SodA [Staphylococcus aureus A9299]
 gi|258443591|ref|ZP_05691930.1| superoxide dismutase SodA [Staphylococcus aureus A8115]
 gi|258446798|ref|ZP_05694952.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|258448712|ref|ZP_05696824.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|258450618|ref|ZP_05698680.1| superoxide dismutase 1 [Staphylococcus aureus A5948]
 gi|258453529|ref|ZP_05701507.1| superoxide dismutase SodA [Staphylococcus aureus A5937]
 gi|262049131|ref|ZP_06022008.1| superoxide dismutase SodA [Staphylococcus aureus D30]
 gi|262051215|ref|ZP_06023439.1| superoxide dismutase SodA [Staphylococcus aureus 930918-3]
 gi|269203181|ref|YP_003282450.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|282893054|ref|ZP_06301288.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A8117]
 gi|282905962|ref|ZP_06313817.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908872|ref|ZP_06316690.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911191|ref|ZP_06318993.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914360|ref|ZP_06322146.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282916823|ref|ZP_06324581.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919329|ref|ZP_06327064.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920102|ref|ZP_06327827.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A9765]
 gi|282924654|ref|ZP_06332322.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928186|ref|ZP_06335791.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A10102]
 gi|283770629|ref|ZP_06343521.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283958317|ref|ZP_06375768.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024612|ref|ZP_06379010.1| superoxide dismutase [Staphylococcus aureus subsp. aureus 132]
 gi|293503434|ref|ZP_06667281.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510451|ref|ZP_06669157.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293530991|ref|ZP_06671673.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848584|ref|ZP_06789330.1| superoxide dismutase 1 [Staphylococcus aureus A9754]
 gi|295406676|ref|ZP_06816481.1| superoxide dismutase 1 [Staphylococcus aureus A8819]
 gi|295428131|ref|ZP_06820763.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275090|ref|ZP_06857597.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MR1]
 gi|297207728|ref|ZP_06924163.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245742|ref|ZP_06929607.1| superoxide dismutase 1 [Staphylococcus aureus A8796]
 gi|297590903|ref|ZP_06949541.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300911809|ref|ZP_07129252.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304380858|ref|ZP_07363518.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|60390904|sp|Q6G913|SODM1_STAAS RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60390909|sp|Q6GGE6|SODM1_STAAR RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415928|sp|P0A0J1|SODM1_STAAM RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415929|sp|P0A0J2|SODM1_STAAW RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|60415930|sp|P0A0J3|SODM1_STAA8 RecName: Full=Superoxide dismutase [Mn] 1
 gi|60415931|sp|P99098|SODM1_STAAN RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|81694393|sp|Q5HFK7|SODM1_STAAC RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|123735978|sp|Q2FGH0|SODM1_STAA3 RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|123754586|sp|Q2YT26|SODM1_STAAB RecName: Full=Superoxide dismutase [Mn/Fe] 1
 gi|4325247|gb|AAD17309.1| superoxide dismutase SodA [Staphylococcus aureus]
 gi|13701351|dbj|BAB42645.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247324|dbj|BAB57715.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204674|dbj|BAB95370.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus MW2]
 gi|49241931|emb|CAG40625.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244832|emb|CAG43292.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57286132|gb|AAW38226.1| superoxide dismutase [Staphylococcus aureus subsp. aureus COL]
 gi|82656687|emb|CAI81114.1| superoxide dismutase [Staphylococcus aureus RF122]
 gi|87127681|gb|ABD22195.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87202919|gb|ABD30729.1| superoxide dismutase, Mn, putative [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|147741106|gb|ABQ49404.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH9]
 gi|149946557|gb|ABR52493.1| Superoxide dismutase [Staphylococcus aureus subsp. aureus JH1]
 gi|150374468|dbj|BAF67728.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156722006|dbj|BAF78423.1| superoxide dismutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368591|gb|ABX29562.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253723995|gb|EES92724.1| superoxide dismutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728737|gb|EES97466.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH130]
 gi|257271372|gb|EEV03518.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257275180|gb|EEV06667.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278406|gb|EEV09042.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281757|gb|EEV11894.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus E1410]
 gi|257283929|gb|EEV14052.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787601|gb|EEV25941.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9781]
 gi|257840221|gb|EEV64685.1| superoxide dismutase (Mn/Fe) SodA [Staphylococcus aureus A9763]
 gi|257843836|gb|EEV68230.1| superoxide dismutase 1 [Staphylococcus aureus A9719]
 gi|257846656|gb|EEV70677.1| superoxide dismutase  1 [Staphylococcus aureus A9635]
 gi|257848590|gb|EEV72578.1| superoxide dismutase SodA [Staphylococcus aureus A9299]
 gi|257850997|gb|EEV74940.1| superoxide dismutase SodA [Staphylococcus aureus A8115]
 gi|257854373|gb|EEV77322.1| Mn/Fe family superoxide dismutase [Staphylococcus aureus A6300]
 gi|257857990|gb|EEV80879.1| superoxide dismutase (Mn/Fe family) [Staphylococcus aureus A6224]
 gi|257861776|gb|EEV84575.1| superoxide dismutase  1 [Staphylococcus aureus A5948]
 gi|257864260|gb|EEV87010.1| superoxide dismutase SodA [Staphylococcus aureus A5937]
 gi|259160852|gb|EEW45872.1| superoxide dismutase SodA [Staphylococcus aureus 930918-3]
 gi|259162800|gb|EEW47365.1| superoxide dismutase SodA [Staphylococcus aureus D30]
 gi|262075471|gb|ACY11444.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED98]
 gi|269941043|emb|CBI49427.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TW20]
 gi|282313489|gb|EFB43884.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317139|gb|EFB47513.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319310|gb|EFB49662.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321541|gb|EFB51866.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus M899]
 gi|282324886|gb|EFB55196.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327136|gb|EFB57431.1| superoxide dismutase SodA [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331254|gb|EFB60768.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589993|gb|EFB95075.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A10102]
 gi|282594450|gb|EFB99435.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A9765]
 gi|282764372|gb|EFC04498.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus A8117]
 gi|283460776|gb|EFC07866.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283470831|emb|CAQ50042.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ST398]
 gi|283790466|gb|EFC29283.1| Mn superoxide dismutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817235|gb|ADC37722.1| Manganese superoxide dismutase; Superoxide dismutase (Fe)
           [Staphylococcus aureus 04-02981]
 gi|290920259|gb|EFD97325.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095100|gb|EFE25365.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466815|gb|EFF09335.1| superoxide dismutase [Mn/Fe] 1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824610|gb|EFG41033.1| superoxide dismutase 1 [Staphylococcus aureus A9754]
 gi|294968423|gb|EFG44447.1| superoxide dismutase 1 [Staphylococcus aureus A8819]
 gi|295128489|gb|EFG58123.1| superoxide dismutase 1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887745|gb|EFH26643.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177393|gb|EFH36645.1| superoxide dismutase 1 [Staphylococcus aureus A8796]
 gi|297575789|gb|EFH94505.1| superoxide dismutase [Staphylococcus aureus subsp. aureus MN8]
 gi|298694835|gb|ADI98057.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ED133]
 gi|300886055|gb|EFK81257.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH70]
 gi|302333229|gb|ADL23422.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|302751384|gb|ADL65561.1| superoxide dismutase Mn/Fe family protein [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304340585|gb|EFM06519.1| superoxide dismutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437978|gb|ADQ77049.1| superoxide dismutase [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829941|emb|CBX34783.1| superoxide dismutase [Mn] (General stress protein 24)(GSP24)
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129831|gb|EFT85821.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195455|gb|EFU25842.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS00]
 gi|315198752|gb|EFU29080.1| superoxide dismutase [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140562|gb|EFW32416.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320144099|gb|EFW35868.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440451|gb|EGA98163.1| superoxide dismutase [Staphylococcus aureus O11]
 gi|323443225|gb|EGB00843.1| superoxide dismutase [Staphylococcus aureus O46]
 gi|329314229|gb|AEB88642.1| Superoxide dismutase [Mn] 1 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727081|gb|EGG63537.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21172]
 gi|329728455|gb|EGG64892.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21189]
 gi|329730875|gb|EGG67253.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus
           21193]
          Length = 199

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 83/201 (41%), Positives = 112/201 (55%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY++D L P+  KET+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        + I + +GS E+FK +  
Sbjct: 61  DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVV---EKIKEQWGSLEEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNWE V E Y  
Sbjct: 178 YIGAF-WNVVNWEKVDELYNA 197


>gi|148652121|ref|YP_001279214.1| superoxide dismutase [Psychrobacter sp. PRwf-1]
 gi|148571205|gb|ABQ93264.1| Superoxide dismutase [Psychrobacter sp. PRwf-1]
          Length = 209

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 84/197 (42%), Positives = 126/197 (63%), Gaps = 4/197 (2%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKSH 61
            LP+LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +   +L+EII      
Sbjct: 5   TLPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKALDEIITATAKD 64

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
            S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA++
Sbjct: 65  DSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAATS 124

Query: 122 QFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           QFGSGW WL   +   KL I KT NA+ PL +G + +L  DVWEHAYY+D++ RR  Y++
Sbjct: 125 QFGSGWAWLVADSVGGKLSIMKTANADTPLAHGKVAVLTCDVWEHAYYIDYRNRRPDYVD 184

Query: 180 SFITNLVNWEYVCERYE 196
           +F+  LVNW+Y   +Y+
Sbjct: 185 TFLEKLVNWDYANAKYK 201


>gi|78484582|ref|YP_390507.1| superoxide dismutase [Thiomicrospira crunogena XCL-2]
 gi|78362868|gb|ABB40833.1| Iron/manganese superoxide dismutase [Thiomicrospira crunogena
           XCL-2]
          Length = 203

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 116/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP+LPY YD L   +   T+E HH  HH  Y  N     +D E    SLE++I  +
Sbjct: 1   MAFTLPDLPYDYDALEVSIDARTMEIHHTKHHNTYVTNLNNAIADTENADKSLEDLIANA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   ++NH+ FW  +   D  G    AL+D I+  FGS +  K    TA +
Sbjct: 61  GSISPAVRNNGGGHWNHSFFWE-VMTGDSMGAPTGALADDINATFGSVDAMKEKFNTAGA 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL+V  +GKLEIS T N +NPL++       PILG+DVWEHAYYL ++  R 
Sbjct: 120 TRFGSGWAWLTVSADGKLEISSTPNQDNPLMDVAEVKGTPILGLDVWEHAYYLRYQNLRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+++   ++VNW  V E Y+ A  
Sbjct: 180 AYMQA-WWDVVNWNKVSELYQAAKA 203


>gi|256819283|ref|YP_003140562.1| Superoxide dismutase [Capnocytophaga ochracea DSM 7271]
 gi|256580866|gb|ACU92001.1| Superoxide dismutase [Capnocytophaga ochracea DSM 7271]
          Length = 201

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 96/200 (48%), Positives = 121/200 (60%), Gaps = 7/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E H+  HH  Y  N     + A +   ++EEI+     
Sbjct: 2   FTLPKLPYAYNALEPYIDARTMEIHYTKHHNAYTTNLNTALAPAGVEGKTIEEILTSLDM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AI++ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEVMSPN-GGGKPTGELAKAIEEAFGSFEAFKEAFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GKLEI  T N +NPL+        PILG+DVWEHAYYL ++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKLEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLHYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERYET 197
           IE+F  N++NW  V E Y  
Sbjct: 181 IEAFF-NVINWAKVAELYNA 199


>gi|224585868|ref|YP_002639667.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224470396|gb|ACN48226.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|326625773|gb|EGE32118.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 210

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|218560976|ref|YP_002393889.1| superoxide dismutase [Escherichia coli S88]
 gi|218367745|emb|CAR05539.1| superoxide dismutase, Mn [Escherichia coli S88]
 gi|294492703|gb|ADE91459.1| superoxide dismutase (Mn) [Escherichia coli IHE3034]
 gi|307628982|gb|ADN73286.1| superoxide dismutase [Escherichia coli UM146]
 gi|323949399|gb|EGB45288.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H252]
 gi|323954320|gb|EGB50105.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli H263]
          Length = 206

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|254251600|ref|ZP_04944918.1| superoxide dismutase [Burkholderia dolosa AUO158]
 gi|124894209|gb|EAY68089.1| superoxide dismutase [Burkholderia dolosa AUO158]
          Length = 226

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 89/198 (44%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEII KS
Sbjct: 34  MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIIKKS 93

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 94  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSYDAFKEAFTKAAV 149

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 150 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 209

Query: 180 SFITNLVNWEYVCERYET 197
           +F  N+VNW++  + +  
Sbjct: 210 AF-WNIVNWDFAAKNFAA 226


>gi|238892325|ref|YP_002917059.1| superoxide dismutase [Klebsiella pneumoniae NTUH-K2044]
 gi|238544641|dbj|BAH60992.1| superoxide dismutase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 208

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +LS EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS E FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVENFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 180 FQNRRPDYIKAF-WDVVNWDEAAARFAA 206


>gi|196234481|ref|ZP_03133306.1| Superoxide dismutase [Chthoniobacter flavus Ellin428]
 gi|196221462|gb|EDY16007.1| Superoxide dismutase [Chthoniobacter flavus Ellin428]
          Length = 244

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           FKLP L Y Y+ L PY+  +T++ HHD HH  Y        + A  L     E I+    
Sbjct: 43  FKLPPLGYDYNALEPYIDADTMKIHHDKHHAAYVSKLNVAIAGAPGLEKKSIEEILSNLD 102

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                    + N    + NH+LFW  +KKN+  GK    L+ AID NFGSF+KF+     
Sbjct: 103 AVPEAVRTEIRNQGGGHANHSLFWQILKKNE-NGKPSGDLAKAIDVNFGSFDKFQDAFNA 161

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+  FGSGW WL  K+ KL +  + N ++PL +G +P++GIDVWEHAYYL ++ RR  Y
Sbjct: 162 AAAKVFGSGWAWLVWKDKKLGVESSANQDSPLSSGGVPLMGIDVWEHAYYLKYQNRRPDY 221

Query: 178 IESFITNLVNWEYVCERYETAMLA 201
           I++F  N++NW++V +RY     A
Sbjct: 222 IKAF-QNVINWDFVADRYSKVSKA 244


>gi|237799575|ref|ZP_04588036.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022431|gb|EGI02488.1| superoxide dismutase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 193

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 95/198 (47%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSFEKFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALADAINTAFGSFEKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NP+ +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPITSGDKPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V ++Y  
Sbjct: 177 AF-WNLVNWDFVAQQYAA 193


>gi|71275234|ref|ZP_00651521.1| Superoxide dismutase [Xylella fastidiosa Dixon]
 gi|71899545|ref|ZP_00681701.1| Superoxide dismutase [Xylella fastidiosa Ann-1]
 gi|170731231|ref|YP_001776664.1| superoxide dismutase [Xylella fastidiosa M12]
 gi|71164043|gb|EAO13758.1| Superoxide dismutase [Xylella fastidiosa Dixon]
 gi|71730674|gb|EAO32749.1| Superoxide dismutase [Xylella fastidiosa Ann-1]
 gi|167966024|gb|ACA13034.1| Superoxide dismutase [Xylella fastidiosa M12]
          Length = 203

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 113/205 (55%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH  Y +N        E   L +EE++ + 
Sbjct: 1   MAYTLPILPYAYDALEPHIDAQTMEIHYTKHHATYINNLNAALEGTEYADLPIEELLRRL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +   DG GK    ++ AID   G FE  K    
Sbjct: 61  KSLPESLQGAVRNNGGGHANHSLFWT-VMAQDGGGKPKGEVAKAIDQQLGGFETLKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW  L+V   K L +  + N ++PL +G  PIL +DVWEHAYYL ++ RRA
Sbjct: 120 KAALSRFGSGWSLLNVTPSKTLVVESSANQDSPLCDGKTPILCLDVWEHAYYLHYQNRRA 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +F  N++NW+ V  RY  AM 
Sbjct: 180 DYVNAFY-NVINWDEVERRYVAAMS 203


>gi|330957923|gb|EGH58183.1| superoxide dismutase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 193

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYHHD HH  Y  N   L    E    +LEEII  S
Sbjct: 1   MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALAEAINAAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDKPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V ++Y +
Sbjct: 177 AF-WNLVNWDFVAQQYAS 193


>gi|294463734|gb|ADE77392.1| unknown [Picea sitchensis]
          Length = 253

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 91/198 (45%), Positives = 126/198 (63%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F L   PY  D L P+MS+ TLE+H   HH+ Y DN  K     E+   +LEE+I  ++ 
Sbjct: 43  FGLKEPPYKLDALEPFMSRRTLEFHWGKHHRGYVDNLNKQIEGNELEGFTLEELIKVTYN 102

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH+LFW CM+  +G G     + + I+ +FGS+  F  +   AA+
Sbjct: 103 NGNPMPAFNNAAQVWNHDLFWECMEP-EGGGDCTGMIQEFIERDFGSYNNFVEEFKQAAT 161

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL VK+ KL + K+ NA NPLI G IP+L IDVWEH YY+D++ RRA Y+ +
Sbjct: 162 TQFGSGWVWLVVKDSKLAVEKSTNALNPLIWGHIPLLTIDVWEHGYYIDYQNRRADYVSA 221

Query: 181 FITNLVNWEYVCERYETA 198
           F+ NLV+W+ V  R+  A
Sbjct: 222 FMDNLVSWDAVNARFGRA 239


>gi|320105746|ref|YP_004181336.1| Superoxide dismutase [Terriglobus saanensis SP1PR4]
 gi|319924267|gb|ADV81342.1| Superoxide dismutase [Terriglobus saanensis SP1PR4]
          Length = 203

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 106/205 (51%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY Y  L P++ + T++ HHD HH  Y  N          L     E +I +
Sbjct: 1   MAFELPVLPYEYTALEPHIDEATMKLHHDKHHATYVTNLNGAVEKHTELGAKTAEELISN 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             +        + NN   + NH +FW  MK N G       +++ I  +FG FE FK   
Sbjct: 61  LDAVPEDVRTVVRNNGGGHVNHTMFWEIMKPNGGGVP-TGDIAEQIKADFGDFETFKKTF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
               + QFG+GWGWL  K GKL I  T N ++PL  G  PILG DVWEHAYYL ++ +R 
Sbjct: 120 NETTAKQFGAGWGWLVFKGGKLTILTTPNQDSPLSQGLYPILGNDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +   N VNWE + +R+  A  
Sbjct: 180 EYLAA-WWNTVNWEEINKRFAKAKK 203


>gi|110644245|ref|YP_671975.1| superoxide dismutase [Escherichia coli 536]
 gi|191172721|ref|ZP_03034259.1| superoxide dismutase [Escherichia coli F11]
 gi|306813828|ref|ZP_07448004.1| superoxide dismutase [Escherichia coli NC101]
 gi|331660461|ref|ZP_08361395.1| superoxide dismutase (Mn) [Escherichia coli TA206]
 gi|110345837|gb|ABG72074.1| superoxide dismutase [Escherichia coli 536]
 gi|190907025|gb|EDV66626.1| superoxide dismutase [Escherichia coli F11]
 gi|222035621|emb|CAP78366.1| Superoxide dismutase [Mn] [Escherichia coli LF82]
 gi|305852826|gb|EFM53273.1| superoxide dismutase [Escherichia coli NC101]
 gi|307556051|gb|ADN48826.1| superoxide dismutase [Escherichia coli ABU 83972]
 gi|312948483|gb|ADR29310.1| superoxide dismutase [Escherichia coli O83:H1 str. NRG 857C]
 gi|320196869|gb|EFW71491.1| Manganese superoxide dismutase [Escherichia coli WV_060327]
 gi|331052410|gb|EGI24447.1| superoxide dismutase (Mn) [Escherichia coli TA206]
          Length = 206

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|238912200|ref|ZP_04656037.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 206

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 120/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|144898732|emb|CAM75596.1| Superoxide dismutase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 198

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/198 (45%), Positives = 124/198 (62%), Gaps = 4/198 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F+LP LPY    L P++S +TL++HH  HH  Y  N   L  D ++   SLEEII   
Sbjct: 1   MAFELPPLPYDKTALEPHISAQTLDFHHGKHHNAYVTNLNNLVKDTDLAAKSLEEIIAIA 60

Query: 59  -KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
            K   +  G+FNNA+Q +NH  FW CMK+  G       L+  I+  FGS+EKF  +   
Sbjct: 61  AKDLPAKQGVFNNAAQVWNHTFFWNCMKQGGGGKPTGTVLAK-IEAAFGSYEKFAEEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA TQFGSGW WL  +NG L+I+KT NA+ PL +G   +L +DVWEHAYYLDF+ RR  +
Sbjct: 120 AAVTQFGSGWAWLVEENGALKITKTANADLPLAHGQKALLTVDVWEHAYYLDFQNRRPDF 179

Query: 178 IESFITNLVNWEYVCERY 195
           +++F+  LVNW++V +  
Sbjct: 180 VQTFLDKLVNWDFVAKNL 197


>gi|254181531|ref|ZP_04888128.1| superoxide dismutase [Burkholderia pseudomallei 1655]
 gi|184212069|gb|EDU09112.1| superoxide dismutase [Burkholderia pseudomallei 1655]
          Length = 192

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINVKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|327261999|ref|XP_003215814.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Anolis
           carolinensis]
          Length = 226

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKG--DVTAQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF  FK  L T +   
Sbjct: 88  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-TGELMEAIKRDFGSFANFKEKLTTVSVGV 146

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L++S   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGFNKEQGRLQVSACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY     
Sbjct: 207 A-IWNVINWENVSSRYAACKK 226


>gi|218551107|ref|YP_002384898.1| superoxide dismutase [Escherichia fergusonii ATCC 35469]
 gi|218358648|emb|CAQ91298.1| superoxide dismutase, Mn [Escherichia fergusonii ATCC 35469]
 gi|324111470|gb|EGC05451.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia fergusonii B253]
 gi|325499386|gb|EGC97245.1| superoxide dismutase [Escherichia fergusonii ECD227]
          Length = 206

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAATRFAA 204


>gi|228993019|ref|ZP_04152942.1| Superoxide dismutase [Bacillus pseudomycoides DSM 12442]
 gi|228999069|ref|ZP_04158651.1| Superoxide dismutase [Bacillus mycoides Rock3-17]
 gi|229006617|ref|ZP_04164252.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
 gi|228754666|gb|EEM04076.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
 gi|228760686|gb|EEM09650.1| Superoxide dismutase [Bacillus mycoides Rock3-17]
 gi|228766667|gb|EEM15307.1| Superoxide dismutase [Bacillus pseudomycoides DSM 12442]
          Length = 203

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK++
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSSNGGGQP-VGELAAAIEAKFGSFDAFKTE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL ++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQEAK 203


>gi|168237679|ref|ZP_02662737.1| superoxide dismutase (Mn) [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194736704|ref|YP_002116979.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194712206|gb|ACF91427.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197289374|gb|EDY28739.1| superoxide dismutase (Mn) [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322613182|gb|EFY10126.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619191|gb|EFY16074.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322626057|gb|EFY22869.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626483|gb|EFY23289.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632404|gb|EFY29152.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635114|gb|EFY31835.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642683|gb|EFY39273.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647972|gb|EFY44444.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650722|gb|EFY47123.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322652905|gb|EFY49242.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657220|gb|EFY53500.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662292|gb|EFY58507.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666827|gb|EFY63003.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672097|gb|EFY68212.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675819|gb|EFY71891.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681765|gb|EFY77791.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684040|gb|EFY80049.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193312|gb|EFZ78527.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197669|gb|EFZ82802.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323200757|gb|EFZ85828.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207238|gb|EFZ92190.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211440|gb|EFZ96281.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218514|gb|EGA03222.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221003|gb|EGA05435.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225979|gb|EGA10198.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231659|gb|EGA15771.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236092|gb|EGA20170.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239486|gb|EGA23535.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243920|gb|EGA27931.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249283|gb|EGA33200.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250474|gb|EGA34357.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258928|gb|EGA42580.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260173|gb|EGA43796.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323265292|gb|EGA48789.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270514|gb|EGA53960.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 206

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E   L  EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|45383702|ref|NP_989542.1| superoxide dismutase [Mn], mitochondrial [Gallus gallus]
 gi|12034955|gb|AAG46055.1|AF329270_1 manganese-containing superoxide dismutase precursor [Gallus gallus]
          Length = 224

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HTLPDLPYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYKEALAKG--DVTAQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  + G       L +AI  +FGSF  FK  L   +   
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPSGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 144

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V +RYE+   
Sbjct: 205 A-IWNVINWENVSQRYESCRK 224


>gi|323498129|ref|ZP_08103133.1| superoxide dismutase [Vibrio sinaloensis DSM 21326]
 gi|323316840|gb|EGA69847.1| superoxide dismutase [Vibrio sinaloensis DSM 21326]
          Length = 205

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/207 (39%), Positives = 118/207 (57%), Gaps = 6/207 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  +     +E+ +  L EI    
Sbjct: 1   MSHTFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYFDKFIAAIKGSELENTQLTEIFANI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM  N G       L++AI + FGSF++F+     AA 
Sbjct: 61  SQHSPAIRNNGGGYYNHVLYWNCMSPNGGGAP-SGDLNEAIINTFGSFDEFQQLFTDAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V NG+L+I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVNNGELKIASTSNQDNPLMDVAGVQGEPILALDVWEHAYYISYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAMLAQK 203
           YIE+   N+V+W  V E Y  A+   +
Sbjct: 180 YIEA-WWNVVDWNTVSENYAAALAQGR 205


>gi|229163220|ref|ZP_04291175.1| Superoxide dismutase [Bacillus cereus R309803]
 gi|228620283|gb|EEK77154.1| Superoxide dismutase [Bacillus cereus R309803]
          Length = 203

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 115/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG++E++ T N ++PL  G  P++G+DVWEHAYYL ++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGEIEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    +RY+ A 
Sbjct: 180 PDYIGAF-WNVVDWNAAEKRYQAAK 203


>gi|332977270|gb|EGK14061.1| superoxide dismutase [Psychrobacter sp. 1501(2011)]
          Length = 209

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/197 (42%), Positives = 124/197 (62%), Gaps = 4/197 (2%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKSH 61
            LP+LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +    L+EII      
Sbjct: 5   TLPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKELDEIIQATAKD 64

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
            S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA++
Sbjct: 65  DSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAATS 124

Query: 122 QFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           QFGSGW WL   +   KL I KT NA+ PL +  + +L  DVWEHAYY+D++ RR  Y++
Sbjct: 125 QFGSGWAWLVADSVGGKLSIMKTANADTPLAHDKVAVLTCDVWEHAYYIDYRNRRPDYVD 184

Query: 180 SFITNLVNWEYVCERYE 196
           +F+  LVNW+Y   +Y+
Sbjct: 185 TFLDKLVNWDYANAKYK 201


>gi|331649758|ref|ZP_08350838.1| superoxide dismutase (Mn) [Escherichia coli M605]
 gi|331041391|gb|EGI13541.1| superoxide dismutase (Mn) [Escherichia coli M605]
          Length = 208

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|152972717|ref|YP_001337863.1| superoxide dismutase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|262041692|ref|ZP_06014884.1| superoxide dismutase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|330004469|ref|ZP_08304961.1| superoxide dismutase [Klebsiella sp. MS 92-3]
 gi|150957566|gb|ABR79596.1| superoxide dismutase, manganese [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259040954|gb|EEW42033.1| superoxide dismutase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|328536590|gb|EGF62919.1| superoxide dismutase [Klebsiella sp. MS 92-3]
          Length = 210

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +LS EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS E FK++ 
Sbjct: 65  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVENFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 182 FQNRRPDYIKAF-WDVVNWDEAAARFAA 208


>gi|104780303|ref|YP_606801.1| superoxide dismutase [Pseudomonas entomophila L48]
 gi|95109290|emb|CAK13987.1| superoxide dismutase [Mn] [Pseudomonas entomophila L48]
          Length = 203

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +N        E     +E+++   
Sbjct: 1   MPHTLPALPYAYDALEPHIDTQTMEIHHSKHHQTYINNLNAALEGTEWAEWPVEQLVGAV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N    + NH LFW  M    G     Q ++ AIDD  G F+ FK    
Sbjct: 61  KQLPEKLQGAVINQGGGHANHTLFWTVMSPKGGGQPQGQ-VAKAIDDQLGGFDAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV     L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQNTLVVESSGNQDSPLMHGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+V+W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVVDWSEVERRYLEALK 203


>gi|332663368|ref|YP_004446156.1| Manganese/iron superoxide dismutase [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332332182|gb|AEE49283.1| Manganese/iron superoxide dismutase [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 204

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P +   T+E HH  HH  Y +N     +  E    ++E+I+   
Sbjct: 1   MAFELPALPYAFDALEPNIDARTMEIHHGKHHAAYTNNLNAALAGTENEGKAIEDILANI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGK-VPQALSDAIDDNFGSFEKFKSDLITAA 119
              +  + NN   YYNHNLFW  M  +         A+  AI  + G F+ FK +   A 
Sbjct: 61  SKLSPAIRNNGGGYYNHNLFWTIMSPDGSPTPAEGTAIHAAITADLGGFDNFKKEFSAAG 120

Query: 120 STQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRR 174
           +T+FGSGW WLSV  +GKL +  + N +NPL++       PILG+DVWEHAYYL+++ RR
Sbjct: 121 ATRFGSGWAWLSVGADGKLFVCSSPNQDNPLMDVAEKKGTPILGMDVWEHAYYLNYQNRR 180

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YIE+F  N++NWE V +RY  A 
Sbjct: 181 PDYIEAFY-NVINWEEVNKRYLAAK 204


>gi|300690603|ref|YP_003751598.1| superoxide dismutase [Ralstonia solanacearum PSI07]
 gi|299077663|emb|CBJ50299.1| superoxide dismutase [Ralstonia solanacearum PSI07]
          Length = 192

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/197 (46%), Positives = 123/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNGLKPNGGGAP-TGALADAINAKWGSFDKFKEEFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V   + 
Sbjct: 177 AF-WNLVNWDFVANHFA 192


>gi|29373127|gb|AAO72712.1| Mn superoxide dismutase [Melopsittacus undulatus]
          Length = 224

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKG--DVTAQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L DAI  +FGSF  FK  L   +   
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELMDAIKRDFGSFANFKEKLTAVSVGV 144

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NW+ V  RY     
Sbjct: 205 A-IWNVINWDNVSSRYAACKK 224


>gi|284042633|ref|YP_003392973.1| superoxide dismutase [Conexibacter woesei DSM 14684]
 gi|283946854|gb|ADB49598.1| Superoxide dismutase [Conexibacter woesei DSM 14684]
          Length = 201

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/202 (38%), Positives = 116/202 (57%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY+YD L P++ + T ++HHD HH  Y   A +     E     +EE++   
Sbjct: 1   MAYELPALPYAYDALEPHIDEATQKFHHDKHHATYVARANEALEGTEWADKPVEELLKNL 60

Query: 61  HGSN----AGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NNA  +YNH L+W  +  N G       L+ AID  FGSF++FK+ + 
Sbjct: 61  DKLPADKLNPVRNNAGGHYNHTLWWESLSPNGGGAP-TGDLAAAIDAAFGSFDEFKAKVE 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
            A + +FGSGW WL   +G LE++ T N + PL +G  P+ GIDVWEHAYYL ++  R  
Sbjct: 120 AAGAGRFGSGWAWLVKGDGGLEVTSTPNQDTPLADGKTPLFGIDVWEHAYYLKYQNLRPA 179

Query: 177 YIESFITNLVNWEYVCERYETA 198
           Y+++ + N+V+W  V ER+  A
Sbjct: 180 YLKA-VWNVVDWNKVAERFAAA 200


>gi|116749202|ref|YP_845889.1| superoxide dismutase [Syntrophobacter fumaroxidans MPOB]
 gi|116698266|gb|ABK17454.1| Superoxide dismutase [Syntrophobacter fumaroxidans MPOB]
          Length = 197

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/197 (46%), Positives = 127/197 (64%), Gaps = 3/197 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY+ + L P++S  TLE+HH  HHK Y D   KL +  E  +   E ++ K 
Sbjct: 1   MSLTLPDLPYAKNALEPHISARTLEFHHGKHHKAYVDMGNKLTAGTEFENADPEAVLKKI 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH  +W CMK N G      A++  I+ +FGSFEKF  +   A
Sbjct: 61  VGDASKAGMFNNVAQAWNHAFYWKCMKPNGGGAP-TGAVAQKINADFGSFEKFAEEFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL +KNGKLE++KT NA+ P+ +G  P+L +DVWEHAYYLD++  RA+Y+
Sbjct: 120 GMTQFGSGWAWLVLKNGKLEVTKTPNADTPVAHGVKPLLVVDVWEHAYYLDYQNLRANYL 179

Query: 179 ESFITNLVNWEYVCERY 195
            +F+  L+NW++V    
Sbjct: 180 ATFVEKLINWDFVNSNL 196


>gi|157368330|ref|YP_001476319.1| superoxide dismutase [Serratia proteamaculans 568]
 gi|157320094|gb|ABV39191.1| Superoxide dismutase [Serratia proteamaculans 568]
          Length = 206

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 80/208 (38%), Positives = 116/208 (55%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +I+ 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELAQYSVEDLIQD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K     G     L  AI+ +FGS EKF+ + 
Sbjct: 61  LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGG---DLKAAIERDFGSVEKFQEEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ +R  YI++F  N+VNW+    R+  
Sbjct: 178 YQNKRPDYIKAF-WNVVNWDEAAARFAA 204


>gi|160898411|ref|YP_001563993.1| superoxide dismutase [Delftia acidovorans SPH-1]
 gi|160363995|gb|ABX35608.1| Superoxide dismutase [Delftia acidovorans SPH-1]
          Length = 211

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 113/208 (54%), Gaps = 12/208 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           + LP L Y+YD L P++  +T+E H+  HH+ Y +N      D       +E++I     
Sbjct: 4   YTLPPLNYAYDALEPHIDAQTMEIHYTKHHQAYVNNLNAALKDTPHGSQPVEQLIADLSL 63

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKK--NDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
              G    + NN   + NH+LFW  M      G G     L+ AID   G F+ FK+   
Sbjct: 64  LPEGVRGAVRNNGGGHANHSLFWTVMAPVDQGGGGAPSGELAQAIDRELGGFDAFKAAFT 123

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFK 171
            AA T+FGSGW WL V K+GKL +  + N ++PL+     GA PILG+DVWEHAYYL ++
Sbjct: 124 QAALTRFGSGWAWLVVGKDGKLAVESSGNQDSPLMAGIGSGATPILGLDVWEHAYYLKYQ 183

Query: 172 YRRAHYIESFITNLVNWEYVCERYETAM 199
            RR  YI +F  N+VNW  V  RY  A 
Sbjct: 184 NRRPEYIAAFY-NVVNWAEVARRYAAAR 210


>gi|229019498|ref|ZP_04176317.1| Superoxide dismutase [Bacillus cereus AH1273]
 gi|229025740|ref|ZP_04182142.1| Superoxide dismutase [Bacillus cereus AH1272]
 gi|228735559|gb|EEL86152.1| Superoxide dismutase [Bacillus cereus AH1272]
 gi|228741797|gb|EEL91978.1| Superoxide dismutase [Bacillus cereus AH1273]
          Length = 203

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 115/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK +
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    + Y+ A 
Sbjct: 180 PDYIGAF-WNVVDWNVAEKLYQEAK 203


>gi|282904135|ref|ZP_06312023.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus C160]
 gi|282595753|gb|EFC00717.1| superoxide dismutase, Mn [Staphylococcus aureus subsp. aureus C160]
          Length = 199

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/201 (40%), Positives = 111/201 (55%), Gaps = 8/201 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LP LPY++D L P+  KET+E HHD HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        + I + +GS E+FK +  
Sbjct: 61  DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVV---EKIKEQWGSLEEFKKEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG+LEI  T N +NPL     PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEDKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYET 197
           YI +F  N+VNWE V E Y  
Sbjct: 178 YIGAF-WNVVNWEKVDELYNA 197


>gi|226945828|ref|YP_002800901.1| Fe-Superoxide dismutase [Azotobacter vinelandii DJ]
 gi|4106403|gb|AAD02836.1| iron superoxide dismutase FeSOD [Azotobacter vinelandii]
 gi|6552344|dbj|BAA88212.1| iron superoxide dismutase [Azotobacter vinelandii]
 gi|226720755|gb|ACO79926.1| Fe-Superoxide dismutase [Azotobacter vinelandii DJ]
          Length = 193

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L PY+S ETLEYH+  HH  Y  N   L    E    SLE+I+  S
Sbjct: 1   MAFELPPLPYEKNALEPYISTETLEYHYGKHHNTYVVNLNNLIPGTEFEGKSLEDIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +K   G       L+DAI+  FGSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNGLKPQGGGQPTGP-LADAINAAFGSFDKFKEEFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V   Y  
Sbjct: 177 AF-WNLVNWDFVAANYAA 193


>gi|26987682|ref|NP_743107.1| superoxide dismutase [Pseudomonas putida KT2440]
 gi|24982367|gb|AAN66571.1|AE016285_9 superoxide dismutase (Mn) [Pseudomonas putida KT2440]
          Length = 210

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 8   MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAALEGTEWAEWPVEKLVAAV 67

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G   V Q L+ A+    G FE FK    
Sbjct: 68  KQLPENLRGAVTNHGGGHANHSLFWTVMSPQGGGEPVGQ-LAQAVTAQLGGFEAFKEAFT 126

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 127 KAALTRFGSGWAWLSVTPQKTLMVESSGNQDSPLMHGNAPILGLDVWEHAYYLKYQNRRP 186

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 187 EYIGAFY-NVIDWVEVERRYLEALK 210


>gi|307111243|gb|EFN59478.1| hypothetical protein CHLNCDRAFT_33910 [Chlorella variabilis]
          Length = 236

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 124/203 (61%), Gaps = 5/203 (2%)

Query: 2   DFKLPNLPYSYDDLSP-YMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
            F LP LPY  D L    MSK T E+H+  HH+ Y  N     +  ++  LS+EE+++K+
Sbjct: 35  AFTLPPLPYPIDALEKKGMSKTTFEFHYGKHHQAYVTNLNNQIAGKDLESLSIEEVMLKT 94

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
              G     FNNA+Q  NH  FW  M  N G GK    +++AI+ + G ++KF      A
Sbjct: 95  FNGGKPTPEFNNAAQVVNHTFFWESMSPN-GGGKPSGKVAEAIEKDLGGYDKFVEAFKAA 153

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WLSV K GKLE++KT NAENP   GA PIL +DVWEHAYYLD + RR  +
Sbjct: 154 GATQFGSGWAWLSVNKEGKLEVTKTPNAENPWCYGATPILTMDVWEHAYYLDVQNRRPDF 213

Query: 178 IESFITNLVNWEYVCERYETAML 200
           I +F+ NL++W+ V +RY  A  
Sbjct: 214 ITNFVDNLIDWDRVEQRYLAATK 236


>gi|312283580|ref|NP_999292.2| superoxide dismutase [Mn], mitochondrial [Sus scrofa]
          Length = 222

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 103/201 (51%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N   +    +         +     
Sbjct: 26  HTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVVEEKYQEALKKG--DVTAQVA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSFEKFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFEKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G +P+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYAACKK 222


>gi|298490142|ref|YP_003720319.1| superoxide dismutase ['Nostoc azollae' 0708]
 gi|298232060|gb|ADI63196.1| Superoxide dismutase ['Nostoc azollae' 0708]
          Length = 240

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 115/202 (56%), Gaps = 8/202 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
             +LP LPY+Y+ L P++   T+++HHD HH  Y +N  K+      L     E +++  
Sbjct: 36  TIQLPPLPYAYEALEPHIDSRTMQFHHDKHHAAYVNNLNKVLDKYPKLKNKPVEALLQNL 95

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NNA  + NH++FW  MK N G       ++ AI DNFGSF  F+    
Sbjct: 96  DQVPSDIRTIVRNNAGGHVNHSMFWKIMKPNGGGEP-SGEVATAIKDNFGSFIDFRRKFN 154

Query: 117 TAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A + +FGSGW WL   KNGKLEI+ T N ++P++ G  PI G DVWEHAYYL ++ RR 
Sbjct: 155 EAGAGRFGSGWVWLVRTKNGKLEITTTGNQDSPIMKGKYPIFGNDVWEHAYYLKYQNRRP 214

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+E+   N+VNW+ + +R+  
Sbjct: 215 DYLEA-WWNVVNWDEINQRFAN 235


>gi|166368140|ref|YP_001660413.1| superoxide dismutase [Microcystis aeruginosa NIES-843]
 gi|166090513|dbj|BAG05221.1| superoxide dismutase [Microcystis aeruginosa NIES-843]
          Length = 199

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/200 (52%), Positives = 133/200 (66%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY Y  L P ++K TLE+HHD HH  Y +N   L  D E+  LSLEE+I+K 
Sbjct: 1   MAYTLPPLPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G G    AL+D I  +FGSFEKF     TA
Sbjct: 61  AGDASKAGVFNNAAQAWNHSFYWDCMK-PGGGGAPTGALADKIQADFGSFEKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADNPLTAGQVPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+T LVNW++V      A
Sbjct: 180 SDFLTKLVNWDFVAANLAAA 199


>gi|291085913|ref|ZP_06354411.2| hypothetical protein CIT292_08881 [Citrobacter youngae ATCC 29220]
 gi|291069589|gb|EFE07698.1| superoxide dismutase (Mn) [Citrobacter youngae ATCC 29220]
          Length = 208

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 117/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLSAEELIAK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL ++  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAATRFGSGWAWLVLQGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|156935949|ref|YP_001439865.1| superoxide dismutase [Cronobacter sakazakii ATCC BAA-894]
 gi|156534203|gb|ABU79029.1| hypothetical protein ESA_03843 [Cronobacter sakazakii ATCC BAA-894]
          Length = 211

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 88/208 (42%), Positives = 121/208 (58%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E+ +L +EE+I K
Sbjct: 6   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPELANLPVEELITK 65

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS EKFK + 
Sbjct: 66  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVEKFKEEF 122

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 123 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGYPILGLDVWEHAYYLK 182

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+ +
Sbjct: 183 FQNRRPDYIKEF-WNVVNWDEAAARFAS 209


>gi|225012048|ref|ZP_03702485.1| Superoxide dismutase [Flavobacteria bacterium MS024-2A]
 gi|225003603|gb|EEG41576.1| Superoxide dismutase [Flavobacteria bacterium MS024-2A]
          Length = 202

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 116/202 (57%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP+L Y+YD L P +   T+E HH  HH  Y  N     +   +   S+EEI+   
Sbjct: 1   MAFELPSLSYAYDALEPNIDSRTMEIHHSKHHNGYTTNLNNAIAGTPLADQSIEEILKGL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +N  + NN   YYNH LFW  M  N G       L+ AID  FGSF+ FKS+   AA+
Sbjct: 61  DLNNKAVRNNGGGYYNHRLFWNIMSPNGGGLPTGT-LATAIDSAFGSFDNFKSEFAKAAA 119

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V     +++  T N +NPL+     G  PILGIDVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHVDGTVKVCATANQDNPLMPGIGCGGTPILGIDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            YI++F  N+++W  V E +  
Sbjct: 180 DYIQAFF-NVIDWNKVNELFTK 200


>gi|254517155|ref|ZP_05129213.1| superoxide dismutase (Fe) [gamma proteobacterium NOR5-3]
 gi|219674660|gb|EED31028.1| superoxide dismutase (Fe) [gamma proteobacterium NOR5-3]
          Length = 199

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 121/197 (61%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYH+  HHK Y D    + +  E+   SLEE+I +S
Sbjct: 8   MAFELPALPYDQNALEPHISAETLEYHYGKHHKTYVDKLNGMLAGTELESASLEEVIRQS 67

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH+ +W C+  N G      AL+DAI+  FGSF  FK +   AA+
Sbjct: 68  EG---GVFNNAAQIWNHSFYWECLSPNGGGEP-TGALADAINAAFGSFAAFKEEFSAAAA 123

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +G + IS T NA  PL     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 124 GNFGSGWTWLVQNADGSVAISNTSNAGCPLTENVTPLLTVDVWEHAYYIDYRNARPKYLE 183

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V     
Sbjct: 184 AF-WNLVNWDFVSSNMA 199


>gi|170679702|ref|YP_001746245.1| superoxide dismutase [Escherichia coli SMS-3-5]
 gi|218701388|ref|YP_002409017.1| superoxide dismutase [Escherichia coli IAI39]
 gi|170517420|gb|ACB15598.1| superoxide dismutase (Mn) [Escherichia coli SMS-3-5]
 gi|218371374|emb|CAR19206.1| superoxide dismutase, Mn [Escherichia coli IAI39]
          Length = 206

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|302828926|ref|XP_002946030.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
 gi|121077704|gb|ABM47310.1| superoxide dismutase [Volvox carteri f. nagariensis]
 gi|300268845|gb|EFJ53025.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
          Length = 233

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 126/200 (63%), Gaps = 4/200 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
             +L   PY  D L P+MSK+TLE+H   HH+ Y DN  K  +   +   SLEEI++ S 
Sbjct: 33  ALELKAPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNMNKQIAGTPLDGKSLEEIVLASW 92

Query: 62  --GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
             G+   +FNNA+Q +NH  FW  MK N G       L++AI  +FGSF+KFK +  TA 
Sbjct: 93  NGGNPTPVFNNAAQVWNHTFFWESMKANGGGAP-TGKLAEAIARDFGSFDKFKEEFKTAG 151

Query: 120 STQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            TQFGSGW WL+  K+GKL ISK+ NA  P++ G  PIL +DVWEHAYY+D + RR  Y+
Sbjct: 152 MTQFGSGWAWLNADKSGKLSISKSPNAVTPVVEGKTPILTVDVWEHAYYIDVQNRRPDYL 211

Query: 179 ESFITNLVNWEYVCERYETA 198
            +FI  L++W+ V +RY  A
Sbjct: 212 TTFIEKLIDWDVVAQRYAAA 231


>gi|92115375|ref|YP_575303.1| superoxide dismutase [Chromohalobacter salexigens DSM 3043]
 gi|91798465|gb|ABE60604.1| Superoxide dismutase [Chromohalobacter salexigens DSM 3043]
          Length = 203

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 110/203 (54%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE----EI 56
           M  +LP LPY+YD L P++   T+E HH  HH+ Y +N         +  L +E    E+
Sbjct: 1   MAHQLPTLPYAYDALEPHIDALTMEIHHSRHHQTYVNNLNAALEGTGLESLPVETLLGEL 60

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G     L+ AI+ + G  + F+    
Sbjct: 61  ERVPEDKRQAVINNGGGHANHSLFWTVMSP-QGGGAAKGDLASAIERDLGGDDAFREAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA  +FGSGW WLSV   K L +  T N ++PL++G  PILG+DVWEHAYYL ++ +R 
Sbjct: 120 QAAVKRFGSGWAWLSVTPAKHLVVENTLNQDSPLMHGNTPILGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI++F   +++W+ V  RY  A
Sbjct: 180 EYIKAFF-EVIDWDEVARRYAEA 201


>gi|146263096|gb|ABQ15318.1| SodA [Yersinia frederiksenii]
          Length = 207

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/211 (39%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTSLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N +NPL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDNPLMGEAVCGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|38704210|ref|NP_312861.2| superoxide dismutase [Escherichia coli O157:H7 str. Sakai]
 gi|291285321|ref|YP_003502139.1| Superoxide dismutase [Escherichia coli O55:H7 str. CB9615]
 gi|300819296|ref|ZP_07099496.1| superoxide dismutase [Escherichia coli MS 107-1]
 gi|300823739|ref|ZP_07103865.1| superoxide dismutase [Escherichia coli MS 119-7]
 gi|300896401|ref|ZP_07114934.1| superoxide dismutase [Escherichia coli MS 198-1]
 gi|300906235|ref|ZP_07123945.1| superoxide dismutase [Escherichia coli MS 84-1]
 gi|300919103|ref|ZP_07135643.1| superoxide dismutase [Escherichia coli MS 115-1]
 gi|300922914|ref|ZP_07138990.1| superoxide dismutase [Escherichia coli MS 182-1]
 gi|300931651|ref|ZP_07146960.1| superoxide dismutase [Escherichia coli MS 187-1]
 gi|301023927|ref|ZP_07187654.1| superoxide dismutase [Escherichia coli MS 69-1]
 gi|301303386|ref|ZP_07209510.1| superoxide dismutase [Escherichia coli MS 124-1]
 gi|301328239|ref|ZP_07221361.1| superoxide dismutase [Escherichia coli MS 78-1]
 gi|309796621|ref|ZP_07691027.1| superoxide dismutase [Escherichia coli MS 145-7]
 gi|331655602|ref|ZP_08356594.1| superoxide dismutase (Mn) [Escherichia coli M718]
 gi|331680024|ref|ZP_08380686.1| superoxide dismutase (Mn) [Escherichia coli H591]
 gi|332282793|ref|ZP_08395206.1| superoxide dismutase [Shigella sp. D9]
 gi|284924007|emb|CBG37106.1| superoxide dismutase [Escherichia coli 042]
 gi|290765194|gb|ADD59155.1| Superoxide dismutase [Escherichia coli O55:H7 str. CB9615]
 gi|300359718|gb|EFJ75588.1| superoxide dismutase [Escherichia coli MS 198-1]
 gi|300396849|gb|EFJ80387.1| superoxide dismutase [Escherichia coli MS 69-1]
 gi|300401961|gb|EFJ85499.1| superoxide dismutase [Escherichia coli MS 84-1]
 gi|300413794|gb|EFJ97104.1| superoxide dismutase [Escherichia coli MS 115-1]
 gi|300420774|gb|EFK04085.1| superoxide dismutase [Escherichia coli MS 182-1]
 gi|300460551|gb|EFK24044.1| superoxide dismutase [Escherichia coli MS 187-1]
 gi|300523801|gb|EFK44870.1| superoxide dismutase [Escherichia coli MS 119-7]
 gi|300528182|gb|EFK49244.1| superoxide dismutase [Escherichia coli MS 107-1]
 gi|300841340|gb|EFK69100.1| superoxide dismutase [Escherichia coli MS 124-1]
 gi|300845302|gb|EFK73062.1| superoxide dismutase [Escherichia coli MS 78-1]
 gi|308119777|gb|EFO57039.1| superoxide dismutase [Escherichia coli MS 145-7]
 gi|315254281|gb|EFU34249.1| superoxide dismutase [Escherichia coli MS 85-1]
 gi|324020504|gb|EGB89723.1| superoxide dismutase [Escherichia coli MS 117-3]
 gi|331046703|gb|EGI18788.1| superoxide dismutase (Mn) [Escherichia coli M718]
 gi|331072350|gb|EGI43683.1| superoxide dismutase (Mn) [Escherichia coli H591]
 gi|332105145|gb|EGJ08491.1| superoxide dismutase [Shigella sp. D9]
          Length = 208

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|238787787|ref|ZP_04631584.1| Superoxide dismutase [Mn] [Yersinia frederiksenii ATCC 33641]
 gi|238724130|gb|EEQ15773.1| Superoxide dismutase [Mn] [Yersinia frederiksenii ATCC 33641]
          Length = 209

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 83/211 (39%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEDLIKD 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 63  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTSLTGDLKAAIERDFGSVDSFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N +NPL+          PI+G+DVWEHAYYL
Sbjct: 120 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDNPLMGEAVCGASGFPIVGLDVWEHAYYL 179

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 180 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 209


>gi|254508188|ref|ZP_05120313.1| superoxide dismutase [Mn] (MnSOD) [Vibrio parahaemolyticus 16]
 gi|219548910|gb|EED25910.1| superoxide dismutase [Mn] (MnSOD) [Vibrio parahaemolyticus 16]
          Length = 205

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/207 (41%), Positives = 114/207 (55%), Gaps = 6/207 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D        +E+   SL EI    
Sbjct: 1   MSHTFPELPYAYDALEPYIDAKTMEVHYSKHHRTYFDKFTAAIKRSELESTSLSEIFATI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   YYNH L+W CMK N G     Q L DAI   FGSF +F+     AA 
Sbjct: 61  SNHPPAIRNNGGGYYNHILYWNCMKPNGGGAPNGQ-LLDAIIAQFGSFAQFQQLFTEAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK G+L ++ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLIVKEGELHVTSTTNQDNPLMDVADIQGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAMLAQK 203
           YI++   N+VNW+ V E Y  A+   K
Sbjct: 180 YIDA-WWNVVNWDAVSENYSAALAQGK 205


>gi|312114585|ref|YP_004012181.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219714|gb|ADP71082.1| Manganese/iron superoxide dismutase-like protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 238

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 77/206 (37%), Positives = 109/206 (52%), Gaps = 9/206 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            FKLP LPY++D L P +  +T+E HHD HH  Y +N      D   +       I+   
Sbjct: 32  PFKLPPLPYAFDALEPTIDAKTMELHHDKHHAAYVNNLNAALKDHPKIAEWPLSQILAKL 91

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NNA  + NH +FW  M K    G+   AL  AID +FG  +K K  L 
Sbjct: 92  DEIPDTIRTTVRNNAGGHANHTMFWQVMAK--DGGEPQGALKAAIDRDFGGLDKLKEQLN 149

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
           TA +  FGSGW +++V K+GKL +    N + PL+ G   + G DVWEHAYYL ++ RR 
Sbjct: 150 TAGTKVFGSGWVFVTVDKDGKLALVAAPNQDTPLMKGTRVLFGNDVWEHAYYLKYQNRRP 209

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            Y+++   ++VNW+ V +RY  A   
Sbjct: 210 DYLKA-WWDVVNWKAVGDRYAAAKAG 234


>gi|262375420|ref|ZP_06068653.1| superoxide dismutase [Acinetobacter lwoffii SH145]
 gi|262309674|gb|EEY90804.1| superoxide dismutase [Acinetobacter lwoffii SH145]
          Length = 205

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/206 (41%), Positives = 120/206 (58%), Gaps = 7/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P++  +T+E HH  HH+ Y +N     +  E   LS+E +I K 
Sbjct: 1   MSYTLPALPYAYDALEPHIDSKTMEIHHSKHHQTYINNINAGIAGTEWEDLSVEALISKF 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NNA  + NH+LFW  M   DG G     ++ AI+   G FE FK    
Sbjct: 61  NEVPEQLRQNVINNAGGHANHSLFWTVMSP-DGGGHPEAEIAKAIEHELGGFEAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A  ++FGSGW WLS+  +  L +  + N ++PL++G IP+LG+DVWEHAYYL ++ RR 
Sbjct: 120 QAGLSRFGSGWAWLSMAPDQTLIVESSANQDSPLMHGNIPLLGLDVWEHAYYLQYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            YI +F  N+VNWE V  RY  A+ A
Sbjct: 180 EYISAFF-NVVNWEEVNRRYLEALNA 204


>gi|53718519|ref|YP_107505.1| putative superoxide dismutase [Burkholderia pseudomallei K96243]
 gi|67641288|ref|ZP_00440070.1| superoxide dismutase (Fe) [Burkholderia mallei GB8 horse 4]
 gi|121598701|ref|YP_991914.1| superoxide dismutase [Burkholderia mallei SAVP1]
 gi|124384132|ref|YP_001027029.1| superoxide dismutase [Burkholderia mallei NCTC 10229]
 gi|126440422|ref|YP_001057981.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 668]
 gi|126451400|ref|YP_001081678.1| superoxide dismutase [Burkholderia mallei NCTC 10247]
 gi|126454128|ref|YP_001065214.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 1106a]
 gi|134279848|ref|ZP_01766560.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 305]
 gi|167003946|ref|ZP_02269724.1| superoxide dismutase [Burkholderia mallei PRL-20]
 gi|167718410|ref|ZP_02401646.1| superoxide dismutase [Burkholderia pseudomallei DM98]
 gi|167737459|ref|ZP_02410233.1| superoxide dismutase [Burkholderia pseudomallei 14]
 gi|167814577|ref|ZP_02446257.1| superoxide dismutase [Burkholderia pseudomallei 91]
 gi|167823048|ref|ZP_02454519.1| superoxide dismutase [Burkholderia pseudomallei 9]
 gi|167844610|ref|ZP_02470118.1| superoxide dismutase [Burkholderia pseudomallei B7210]
 gi|167893143|ref|ZP_02480545.1| superoxide dismutase [Burkholderia pseudomallei 7894]
 gi|167905705|ref|ZP_02492910.1| superoxide dismutase [Burkholderia pseudomallei NCTC 13177]
 gi|167909840|ref|ZP_02496931.1| superoxide dismutase [Burkholderia pseudomallei 112]
 gi|167917866|ref|ZP_02504957.1| superoxide dismutase [Burkholderia pseudomallei BCC215]
 gi|217419967|ref|ZP_03451473.1| superoxide dismutase [Burkholderia pseudomallei 576]
 gi|226192852|ref|ZP_03788465.1| superoxide dismutase [Burkholderia pseudomallei Pakistan 9]
 gi|237811129|ref|YP_002895580.1| superoxide dismutase (Fe) [Burkholderia pseudomallei MSHR346]
 gi|242317972|ref|ZP_04816988.1| superoxide dismutase [Burkholderia pseudomallei 1106b]
 gi|254175464|ref|ZP_04882124.1| superoxide dismutase [Burkholderia mallei ATCC 10399]
 gi|254187489|ref|ZP_04894001.1| superoxide dismutase, Fe [Burkholderia pseudomallei Pasteur 52237]
 gi|254196245|ref|ZP_04902669.1| superoxide dismutase, Fe [Burkholderia pseudomallei S13]
 gi|254202539|ref|ZP_04908902.1| superoxide dismutase [Burkholderia mallei FMH]
 gi|254207876|ref|ZP_04914226.1| superoxide dismutase [Burkholderia mallei JHU]
 gi|254296391|ref|ZP_04963848.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|254298215|ref|ZP_04965667.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|254356228|ref|ZP_04972504.1| superoxide dismutase [Burkholderia mallei 2002721280]
 gi|52208933|emb|CAH34872.1| putative superoxide dismutase [Burkholderia pseudomallei K96243]
 gi|121227511|gb|ABM50029.1| superoxide dismutase [Burkholderia mallei SAVP1]
 gi|124292152|gb|ABN01421.1| superoxide dismutase [Burkholderia mallei NCTC 10229]
 gi|126219915|gb|ABN83421.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 668]
 gi|126227770|gb|ABN91310.1| superoxide dismutase [Burkholderia pseudomallei 1106a]
 gi|126244270|gb|ABO07363.1| superoxide dismutase [Burkholderia mallei NCTC 10247]
 gi|134249048|gb|EBA49130.1| superoxide dismutase (Fe) [Burkholderia pseudomallei 305]
 gi|147746786|gb|EDK53863.1| superoxide dismutase [Burkholderia mallei FMH]
 gi|147751770|gb|EDK58837.1| superoxide dismutase [Burkholderia mallei JHU]
 gi|148025225|gb|EDK83379.1| superoxide dismutase [Burkholderia mallei 2002721280]
 gi|157805858|gb|EDO83028.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|157808109|gb|EDO85279.1| superoxide dismutase, Fe [Burkholderia pseudomallei 406e]
 gi|157935169|gb|EDO90839.1| superoxide dismutase, Fe [Burkholderia pseudomallei Pasteur 52237]
 gi|160696508|gb|EDP86478.1| superoxide dismutase [Burkholderia mallei ATCC 10399]
 gi|169652988|gb|EDS85681.1| superoxide dismutase, Fe [Burkholderia pseudomallei S13]
 gi|217397271|gb|EEC37287.1| superoxide dismutase [Burkholderia pseudomallei 576]
 gi|225935102|gb|EEH31076.1| superoxide dismutase [Burkholderia pseudomallei Pakistan 9]
 gi|237503404|gb|ACQ95722.1| superoxide dismutase (Fe) [Burkholderia pseudomallei MSHR346]
 gi|238522197|gb|EEP85643.1| superoxide dismutase (Fe) [Burkholderia mallei GB8 horse 4]
 gi|242141211|gb|EES27613.1| superoxide dismutase [Burkholderia pseudomallei 1106b]
 gi|243060596|gb|EES42782.1| superoxide dismutase [Burkholderia mallei PRL-20]
          Length = 192

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|71899930|ref|ZP_00682077.1| Superoxide dismutase [Xylella fastidiosa Ann-1]
 gi|71730293|gb|EAO32377.1| Superoxide dismutase [Xylella fastidiosa Ann-1]
          Length = 203

 Score =  203 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH  Y +N        E + L +EE++ + 
Sbjct: 1   MAYTLPILPYAYDALEPHIDAQTMEIHYTKHHATYINNLNAALEGTEYVDLPIEELLRRL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +   DG GK    ++ AID   G FE FK    
Sbjct: 61  KSLPESLQGSVRNNGGGHANHSLFWT-VMAQDGGGKPKGEVAKAIDQQLGGFETFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW  L+V   K L +  + N ++PL +G  PIL +DVWEHAYYL ++ RRA
Sbjct: 120 KAALSRFGSGWSLLNVTPSKTLVVESSANQDSPLCDGKTPILCLDVWEHAYYLHYQNRRA 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +F  N++NW+ V  RY  AM 
Sbjct: 180 DYVNAFY-NVINWDEVERRYVVAMS 203


>gi|13182789|gb|AAK14938.1| superoxide dismutase [Pseudomonas putida]
          Length = 198

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 123/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C++ N G      AL+DAI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLEPNSGGQP-TGALADAINAAFGSFDKFKEEFTKTSV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGS WG L  K +G L ++ T  A  PL  G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSDWGCLVKKADGSLALASTIGAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW +V E++E
Sbjct: 177 AF-WNLVNWAFVAEQFE 192


>gi|49176442|ref|NP_418344.3| superoxide dismutase, Mn [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110120|ref|AP_003900.1| superoxide dismutase, Mn [Escherichia coli str. K-12 substr. W3110]
 gi|157163381|ref|YP_001460699.1| superoxide dismutase [Escherichia coli HS]
 gi|170022080|ref|YP_001727034.1| superoxide dismutase [Escherichia coli ATCC 8739]
 gi|170083379|ref|YP_001732699.1| superoxide dismutase, Mn [Escherichia coli str. K-12 substr. DH10B]
 gi|188495746|ref|ZP_03003016.1| superoxide dismutase (Mn) [Escherichia coli 53638]
 gi|238902975|ref|YP_002928771.1| superoxide dismutase, Mn [Escherichia coli BW2952]
 gi|254039125|ref|ZP_04873175.1| superoxide dismutase [Escherichia sp. 1_1_43]
 gi|256026054|ref|ZP_05439919.1| superoxide dismutase [Escherichia sp. 4_1_40B]
 gi|301023969|ref|ZP_07187692.1| superoxide dismutase [Escherichia coli MS 196-1]
 gi|307140607|ref|ZP_07499963.1| superoxide dismutase [Escherichia coli H736]
 gi|312971804|ref|ZP_07785978.1| superoxide dismutase [Mn] [Escherichia coli 1827-70]
 gi|134659|sp|P00448|SODM_ECOLI RecName: Full=Superoxide dismutase [Mn]; AltName: Full=MnSOD
 gi|42973|emb|CAA27580.1| unnamed protein product [Escherichia coli]
 gi|305012|gb|AAB03041.1| manganese superoxide dismutase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1790342|gb|AAC76890.1| superoxide dismutase, Mn [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676151|dbj|BAE77401.1| superoxide dismutase, Mn [Escherichia coli str. K12 substr. W3110]
 gi|157069061|gb|ABV08316.1| superoxide dismutase (Mn) [Escherichia coli HS]
 gi|169757008|gb|ACA79707.1| Superoxide dismutase [Escherichia coli ATCC 8739]
 gi|169891214|gb|ACB04921.1| superoxide dismutase, Mn [Escherichia coli str. K-12 substr. DH10B]
 gi|188490945|gb|EDU66048.1| superoxide dismutase (Mn) [Escherichia coli 53638]
 gi|226838561|gb|EEH70590.1| superoxide dismutase [Escherichia sp. 1_1_43]
 gi|238863611|gb|ACR65609.1| superoxide dismutase, Mn [Escherichia coli BW2952]
 gi|260451254|gb|ACX41676.1| Superoxide dismutase [Escherichia coli DH1]
 gi|299880596|gb|EFI88807.1| superoxide dismutase [Escherichia coli MS 196-1]
 gi|309704334|emb|CBJ03683.1| superoxide dismutase [Escherichia coli ETEC H10407]
 gi|310334181|gb|EFQ00386.1| superoxide dismutase [Mn] [Escherichia coli 1827-70]
 gi|315138475|dbj|BAJ45634.1| superoxide dismutase [Escherichia coli DH1]
 gi|315617703|gb|EFU98308.1| superoxide dismutase [Mn] [Escherichia coli 3431]
 gi|323934399|gb|EGB30812.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E1520]
 gi|323938991|gb|EGB35209.1| iron/manganese superoxide dismutase domain-containing protein
           [Escherichia coli E482]
 gi|332345904|gb|AEE59238.1| superoxide dismutase [Escherichia coli UMNK88]
          Length = 206

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|91213448|ref|YP_543434.1| superoxide dismutase [Escherichia coli UTI89]
 gi|117626176|ref|YP_859499.1| superoxide dismutase [Escherichia coli APEC O1]
 gi|237702939|ref|ZP_04533420.1| superoxide dismutase [Escherichia sp. 3_2_53FAA]
 gi|91075022|gb|ABE09903.1| Mn superoxide dismutase [Escherichia coli UTI89]
 gi|115515300|gb|ABJ03375.1| superoxide dismutase, Mn [Escherichia coli APEC O1]
 gi|226902876|gb|EEH89135.1| superoxide dismutase [Escherichia sp. 3_2_53FAA]
 gi|315289603|gb|EFU48996.1| superoxide dismutase [Escherichia coli MS 110-3]
          Length = 208

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|66047286|ref|YP_237127.1| superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
 gi|4581924|gb|AAD24797.1|AF121079_1 iron-superoxide dismutase [Pseudomonas syringae pv. syringae]
 gi|63257993|gb|AAY39089.1| Superoxide dismutase [Pseudomonas syringae pv. syringae B728a]
          Length = 193

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/198 (45%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY    L+P++S ETLEYHHD HH  Y  N   L    E    +LEEI+  S
Sbjct: 1   MAFELPPLPYEKTALAPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G      AL++AI+  FGSF+KFK +    + 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGALAEAINKAFGSFDKFKEEFSKTSI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGWGWL  K +G L ++ T  A NPL +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F  NLVNW++V +++ +
Sbjct: 177 AF-WNLVNWDFVAKQFAS 193


>gi|41152470|ref|NP_956270.1| superoxide dismutase [Mn], mitochondrial precursor [Danio rerio]
 gi|38511610|gb|AAH60895.1| Superoxide dismutase 2, mitochondrial [Danio rerio]
 gi|55962254|emb|CAI11702.1| superoxide dismutase 2, mitochondrial [Danio rerio]
          Length = 224

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++  E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HALPDLTYDYGALEPHICAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A    
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLEAIKRDFGSFQKMKEKISAATVAV 144

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  +    +L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGFEKESGRLRIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+VNWE V ER++ A  
Sbjct: 205 A-IWNVVNWENVSERFQAAKK 224


>gi|307545901|ref|YP_003898380.1| superoxide dismutase [Halomonas elongata DSM 2581]
 gi|307217925|emb|CBV43195.1| superoxide dismutase [Halomonas elongata DSM 2581]
          Length = 203

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 109/203 (53%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP + Y YD L P++   T+E HH  HH+ Y +N         +  + ++E++   
Sbjct: 1   MPHSLPEIAYQYDALEPHIDALTMEIHHTRHHQTYVNNLNAALEGTGLEEVPVDELVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH++FW  M    G       +++AID   G F+ FK    
Sbjct: 61  DRVPDDKRQAVINNGGGHSNHSMFWQMMSPQGGGQP-KGKVAEAIDSELGGFDAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA  +FGSGW WLSV    KL +  T N ++PL++G  P+LG+DVWEHAYYL ++ +R 
Sbjct: 120 KAALGRFGSGWAWLSVDPQGKLVVENTLNQDSPLMHGNTPVLGLDVWEHAYYLKYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            YI +F  N+V+W+ V  RY+ A
Sbjct: 180 DYIAAFF-NVVDWDEVERRYQAA 201


>gi|218692193|ref|YP_002400405.1| superoxide dismutase [Escherichia coli ED1a]
 gi|218429757|emb|CAR10581.1| superoxide dismutase, Mn [Escherichia coli ED1a]
          Length = 206

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|71066493|ref|YP_265220.1| superoxide dismutase [Psychrobacter arcticus 273-4]
 gi|71039478|gb|AAZ19786.1| probable superoxide dismutase [Psychrobacter arcticus 273-4]
          Length = 209

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 122/197 (61%), Gaps = 4/197 (2%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--IKSH 61
            LP LPY+ D L P++S ETLE+HHD HH  Y +   +L   + +   +L EII      
Sbjct: 5   TLPELPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEDKTLSEIIVATAKD 64

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
            S  G+FN A+Q +NH  +W CM  ++G G+    L   I+++FGS++KF+ +   AA T
Sbjct: 65  DSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKNAALT 124

Query: 122 QFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           QFGSGW WL       KL I+KT NA+ PL +  I +L  DVWEHAYY+D++ RR  Y++
Sbjct: 125 QFGSGWAWLVADKVGGKLSIAKTANADTPLAHDQIAVLTCDVWEHAYYVDYRNRRPEYVD 184

Query: 180 SFITNLVNWEYVCERYE 196
           +F+  LVNW+Y   +Y+
Sbjct: 185 TFLDKLVNWDYANAKYK 201


>gi|114331202|ref|YP_747424.1| superoxide dismutase [Nitrosomonas eutropha C91]
 gi|114308216|gb|ABI59459.1| Superoxide dismutase [Nitrosomonas eutropha C91]
          Length = 212

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 116/197 (58%), Gaps = 3/197 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS- 60
            + LP LPY+ + L P +S  TL +H+  HHK Y DN  KL         SLE+II+ + 
Sbjct: 17  TYVLPPLPYADNALEPVISAHTLSFHYGKHHKGYVDNLNKLVMGTPFAGQSLEQIIMATA 76

Query: 61  -HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
            H    G+FNNA+Q +NH  +W  +  N G    P AL   I++ FGS E FK +  TAA
Sbjct: 77  GHADKIGIFNNAAQVWNHMFYWNSLSPNGGGEP-PAALKQKIEEAFGSVEAFKQEFATAA 135

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            TQFGSGW WL+ +  KL I KT NA++PL     P+L IDVWEHAYYLDF+ RR  Y+ 
Sbjct: 136 ITQFGSGWAWLAQEGTKLTIIKTSNADSPLTRSIRPLLTIDVWEHAYYLDFQNRRPDYVN 195

Query: 180 SFITNLVNWEYVCERYE 196
           + I  L+NWE+      
Sbjct: 196 TVIDKLINWEFAAANLA 212


>gi|301055769|ref|YP_003793980.1| Mn containing superoxide dismutase [Bacillus anthracis CI]
 gi|300377938|gb|ADK06842.1| Mn containing superoxide dismutase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 211

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 80/213 (37%), Positives = 110/213 (51%), Gaps = 16/213 (7%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N          L     E +  
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELAD 60

Query: 60  -------------SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFG 106
                               + NN   + NH  FW  +  N G       L+ AI+  FG
Sbjct: 61  KSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFG 119

Query: 107 SFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAY 166
           SF+ FK +   A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAY
Sbjct: 120 SFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAY 179

Query: 167 YLDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           YL+++ RR  YI +F  N+V+W    +RY+ A 
Sbjct: 180 YLNYQNRRPDYIGAF-WNVVDWNAAEKRYQEAK 211


>gi|113866637|ref|YP_725126.1| superoxide dismutase [Ralstonia eutropha H16]
 gi|113525413|emb|CAJ91758.1| superoxide dismutase [Ralstonia eutropha H16]
          Length = 193

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E  + +LEEI+ KS
Sbjct: 1   MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENSTLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWDSMKPNGGGQP-TGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A  +L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNVVNWDFAGKNFA 192


>gi|26250673|ref|NP_756713.1| superoxide dismutase [Escherichia coli CFT073]
 gi|227885352|ref|ZP_04003157.1| superoxide dismutase [Escherichia coli 83972]
 gi|300975744|ref|ZP_07173160.1| superoxide dismutase [Escherichia coli MS 45-1]
 gi|300986004|ref|ZP_07177679.1| superoxide dismutase [Escherichia coli MS 200-1]
 gi|301048727|ref|ZP_07195736.1| superoxide dismutase [Escherichia coli MS 185-1]
 gi|26111104|gb|AAN83287.1|AE016770_87 Superoxide dismutase (Mn) [Escherichia coli CFT073]
 gi|227837728|gb|EEJ48194.1| superoxide dismutase [Escherichia coli 83972]
 gi|300299473|gb|EFJ55858.1| superoxide dismutase [Escherichia coli MS 185-1]
 gi|300306462|gb|EFJ60982.1| superoxide dismutase [Escherichia coli MS 200-1]
 gi|300410232|gb|EFJ93770.1| superoxide dismutase [Escherichia coli MS 45-1]
 gi|315292743|gb|EFU52095.1| superoxide dismutase [Escherichia coli MS 153-1]
 gi|315300219|gb|EFU59456.1| superoxide dismutase [Escherichia coli MS 16-3]
 gi|324006811|gb|EGB76030.1| superoxide dismutase [Escherichia coli MS 57-2]
 gi|324012545|gb|EGB81764.1| superoxide dismutase [Escherichia coli MS 60-1]
          Length = 208

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|223647010|gb|ACN10263.1| Superoxide dismutase, mitochondrial precursor [Salmo salar]
 gi|223672875|gb|ACN12619.1| Superoxide dismutase, mitochondrial precursor [Salmo salar]
          Length = 226

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HSLPDLTYDYGALEPHINAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L+ AI+ +FGSF+  K  +  A    
Sbjct: 88  LQPALRFNGGGHINHTIFWTNLSPNGGGEP-QGELAAAINRDFGSFQALKDKMSAATVAV 146

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       KL I+   N +      G +P+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGFDKESGKLRITACPNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYVK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER + A  
Sbjct: 207 A-IWNVINWENVSERLQAAKK 226


>gi|313497315|gb|ADR58681.1| SodA [Pseudomonas putida BIRD-1]
          Length = 203

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 110/205 (53%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 1   MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAALEGTEWAEWPVEKLVAAV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G   V Q L+ A+    G FE FK    
Sbjct: 61  KQLPENLRGAVTNHGGGHANHSLFWTVMSPQGGGEPVGQ-LAQAVTAQLGGFEAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLMVESSGNQDSPLMHGNAPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWVEVERRYLEALK 203


>gi|1711423|sp|P50059|SODM2_PLEBO RecName: Full=Superoxide dismutase [Mn] 2
 gi|608554|gb|AAA69952.1| superoxide dismutase [Leptolyngbya boryana]
          Length = 206

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/207 (37%), Positives = 110/207 (53%), Gaps = 8/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY+YD L PY+   T++ HHD HH  Y +N          L     E ++  
Sbjct: 1   MAFELKPLPYAYDALEPYIDATTMQLHHDKHHAAYVNNLNAAIEKYSDLQSMSVEDLVTH 60

Query: 61  -----HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH +FW  M  N        A+S+AI+++FGSF+ FK   
Sbjct: 61  LDRVPEDVRTTVRNNAGGHVNHTMFWEIMGANGSGAP-TGAISEAINNSFGSFDAFKQQF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + +FGSGW WL       L+I  T N ++PLI G  PI+G DVWEHAYYL ++ RR
Sbjct: 120 NDAGTKRFGSGWVWLVRSQQGDLQILSTPNQDSPLIEGHTPIMGNDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAMLA 201
             Y+ +   N++NWE +  R++ AM  
Sbjct: 180 PEYLNA-WWNVLNWEEINRRFDAAMSG 205


>gi|254258617|ref|ZP_04949671.1| superoxide dismutase [Burkholderia pseudomallei 1710a]
 gi|254217306|gb|EET06690.1| superoxide dismutase [Burkholderia pseudomallei 1710a]
          Length = 192

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET+++H+  HH+ Y  N   L   +E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGSEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|94309484|ref|YP_582694.1| manganese and iron superoxide dismutase [Cupriavidus metallidurans
           CH34]
 gi|93353336|gb|ABF07425.1| superoxide dismutase, Fe [Cupriavidus metallidurans CH34]
          Length = 192

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 126/197 (63%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP+LPY++D L+P++SKETLE+HHD HH+ Y  N   L    E    SLEEI+ KS
Sbjct: 1   MEHKLPSLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFESASLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  MK N G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWESMKPNGGGQP-TGALADAINAKWGSFDKFKEEFTKVAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+V+W++  + + 
Sbjct: 177 AF-WNVVSWDFASKNFA 192


>gi|326915675|ref|XP_003204139.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Meleagris
           gallopavo]
          Length = 235

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 39  HTLPDLPYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYKEALAKG--DVTAQVS 96

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  + G       L +AI  +FGSF  FK  L   +   
Sbjct: 97  LQPALKFNGGGHINHTIFWTNLSPSGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 155

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 156 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 215

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY +   
Sbjct: 216 A-IWNVINWENVSSRYASCKK 235


>gi|284040231|ref|YP_003390161.1| superoxide dismutase [Spirosoma linguale DSM 74]
 gi|283819524|gb|ADB41362.1| Superoxide dismutase [Spirosoma linguale DSM 74]
          Length = 204

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/206 (39%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L  LPY  D L P + K+T+E HH  HH  Y  N     +  EM + S+E+++   
Sbjct: 1   MAFVLDPLPYPSDSLEPNIDKQTMEIHHGKHHNAYVTNLNNAIAGTEMENKSIEDLLASV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +   + NN   +YNH LFW       G G+    L++AID  FGSF+ FK +   AA+
Sbjct: 61  SSAPVAVRNNGGGHYNHTLFW-NTISGSGGGQPTGTLAEAIDSKFGSFDAFKEEFTKAAT 119

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V    +L I+ + N +NPL++       PI+G+DVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLIVTPEGELAITSSPNQDNPLMDIAEVKGFPIIGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            YI ++  N+V+W    +RY+    A
Sbjct: 180 DYIAAYF-NVVDWAAAEKRYQQGKQA 204


>gi|318607986|emb|CBY29484.1| manganese superoxide dismutase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 207

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHTNHSLFWKGLK---LGTTLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|145219785|ref|YP_001130494.1| superoxide dismutase [Prosthecochloris vibrioformis DSM 265]
 gi|145205949|gb|ABP36992.1| Superoxide dismutase [Chlorobium phaeovibrioides DSM 265]
          Length = 201

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/202 (44%), Positives = 125/202 (61%), Gaps = 3/202 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L P++S +TL +H+  HH  Y  N   L     M  +SLEE+I ++
Sbjct: 1   MAYQQPALPWAENALEPHISAKTLGFHYGKHHAAYVTNFNNLVGGTPMDLMSLEEVIAQT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH+ +W  +    G G     L +AI  +FGSF+KF+ +L  A
Sbjct: 61  AGDSSKAGIFNNGAQAWNHSFYWNSLAP-AGGGVPTGELGEAITRDFGSFDKFRDELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +    L++ KT NAE P+ NG  PIL IDVWEHAYYLD++ RR  Y 
Sbjct: 120 AATQFGSGWAWLVLDGETLKVVKTGNAETPMTNGLKPILTIDVWEHAYYLDYQNRRPDYT 179

Query: 179 ESFITNLVNWEYVCERYETAML 200
            + I NL+NWE+    Y +A  
Sbjct: 180 AAVIENLLNWEFAAANYASARS 201


>gi|167580078|ref|ZP_02372952.1| superoxide dismutase [Burkholderia thailandensis TXDOH]
 gi|167618144|ref|ZP_02386775.1| superoxide dismutase [Burkholderia thailandensis Bt4]
 gi|257140029|ref|ZP_05588291.1| superoxide dismutase [Burkholderia thailandensis E264]
          Length = 192

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P++ IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|163942034|ref|YP_001646918.1| superoxide dismutase [Bacillus weihenstephanensis KBAB4]
 gi|229013495|ref|ZP_04170631.1| Superoxide dismutase [Bacillus mycoides DSM 2048]
 gi|229061970|ref|ZP_04199296.1| Superoxide dismutase [Bacillus cereus AH603]
 gi|229169023|ref|ZP_04296739.1| Superoxide dismutase [Bacillus cereus AH621]
 gi|163864231|gb|ABY45290.1| Superoxide dismutase [Bacillus weihenstephanensis KBAB4]
 gi|228614432|gb|EEK71541.1| Superoxide dismutase [Bacillus cereus AH621]
 gi|228717279|gb|EEL68952.1| Superoxide dismutase [Bacillus cereus AH603]
 gi|228747796|gb|EEL97663.1| Superoxide dismutase [Bacillus mycoides DSM 2048]
          Length = 203

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK++
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKAE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    + Y+ A 
Sbjct: 180 PDYIGAF-WNVVDWNVAEKLYQEAK 203


>gi|167561820|ref|ZP_02354736.1| superoxide dismutase [Burkholderia oklahomensis EO147]
 gi|167569043|ref|ZP_02361917.1| superoxide dismutase [Burkholderia oklahomensis C6786]
          Length = 192

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 86/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++S+ET++YH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQTYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +    G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPQGGGAP-TGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|240850110|ref|YP_002971503.1| superoxide dismutase [Bartonella grahamii as4aup]
 gi|240267233|gb|ACS50821.1| superoxide dismutase [Bartonella grahamii as4aup]
          Length = 200

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 114/197 (57%), Positives = 147/197 (74%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY YD LSPYMS+ETLEYHHD HH  Y +N      +  + + SLE+I+ KS
Sbjct: 1   MAFELPPLPYDYDALSPYMSRETLEYHHDKHHLAYLNNTNNFVKELGLENESLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK+ G  K+P+ L+ AID + G ++KF++D I AAS
Sbjct: 61  FGKNIGLFNNAAQYYNHNHFWLWMKKDGGGQKLPEKLAKAIDADLGGYDKFRADFIAAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+ES
Sbjct: 121 AQFGSGWAWVAVKDGKLEIMKTPNGENPLIHNARPILGVDVWEHSYYIDYRNARPKYLES 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV + YE 
Sbjct: 181 FVDHLINWDYVLKLYEE 197


>gi|86140885|ref|ZP_01059444.1| Superoxide dismutase [Leeuwenhoekiella blandensis MED217]
 gi|85832827|gb|EAQ51276.1| Superoxide dismutase [Leeuwenhoekiella blandensis MED217]
          Length = 202

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 115/205 (56%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY+YD L P+   +T+E HH  HH+ Y          A +    LE +  K 
Sbjct: 1   MSYELPELPYAYDALEPHFDAKTMEIHHTKHHQGYTTKLNAALESAGI-TEDLESLFSKI 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   +YNH LFW  +   D K     AL++AI + FGS E  K +   AA+
Sbjct: 60  STLSPAIRNNGGGFYNHKLFW-SVLTPDAKEAPEGALAEAITNTFGSLEALKDEFNQAAA 118

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V     L+++ T N +NPL++       PILG+DVWEHAYYL+++ +R 
Sbjct: 119 TQFGSGWAWLVVDAEGNLKVTSTPNQDNPLMDAAEVKGTPILGLDVWEHAYYLNYQNKRP 178

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNW+ V  RY  A  
Sbjct: 179 DYISAF-WNVVNWDEVSARYSAATK 202


>gi|156743654|ref|YP_001433783.1| superoxide dismutase [Roseiflexus castenholzii DSM 13941]
 gi|156234982|gb|ABU59765.1| Superoxide dismutase [Roseiflexus castenholzii DSM 13941]
          Length = 201

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/203 (39%), Positives = 108/203 (53%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F LP LPY +  L P +   T++ HH  HH+ Y  N          L  +  E I+  
Sbjct: 1   MAFTLPPLPYDFSALEPNIDTMTMQIHHGKHHQAYVTNLNAALEGHSSLQHATIEEILMN 60

Query: 59  ---KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH LFW  M  N G       L+ AI+D FGSF +FK+ +
Sbjct: 61  INDVPESIRQAVINNGGGHHNHTLFWTIMGPNGGGEP-RGELAKAINDAFGSFAEFKAKI 119

Query: 116 ITAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A   +FGSGW WL   K GKL I  T N ++PL+ G +PILG+DVWEHAYYL ++ RR
Sbjct: 120 KDAGVKRFGSGWAWLVKDKEGKLHIYSTANQDSPLMQGHMPILGVDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYET 197
             YI++   N VNW+ V ER+  
Sbjct: 180 PDYIDA-WWNTVNWDAVAERFGQ 201


>gi|307823562|ref|ZP_07653791.1| Manganese/iron superoxide dismutase-like protein [Methylobacter
           tundripaludum SV96]
 gi|307735547|gb|EFO06395.1| Manganese/iron superoxide dismutase-like protein [Methylobacter
           tundripaludum SV96]
          Length = 193

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 92/198 (46%), Positives = 120/198 (60%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L    E   LSLEEII+KS
Sbjct: 1   MAFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLVPGTEFEGLSLEEIIMKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G      AL+DAI+  FGSF KFK +    A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWNSLAPNAGGEP-SGALADAINTTFGSFAKFKEEFTKCAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL    +G L +  T NA  PL  G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TTFGSGWAWLVQNADGSLALVSTSNAGCPLTTGQKPLLTCDVWEHAYYIDYRNARPAYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F   LVNW++  + +  
Sbjct: 177 AF-WALVNWDFAAKNFSA 193


>gi|331685646|ref|ZP_08386229.1| superoxide dismutase (Mn) [Escherichia coli H299]
 gi|331077117|gb|EGI48332.1| superoxide dismutase (Mn) [Escherichia coli H299]
          Length = 206

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 120/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 118 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|304406403|ref|ZP_07388059.1| Manganese/iron superoxide dismutase-like protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304344461|gb|EFM10299.1| Manganese/iron superoxide dismutase-like protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 204

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/206 (39%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LPY+ + L P+  + T+E HHD HH  Y  N       A  L     E +I  
Sbjct: 1   MAHQLPALPYANNALEPHFDETTMEIHHDRHHNAYVTNLNAALESAPELQSKSIEDLIAD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G       L+DAI    G F+KFK D 
Sbjct: 61  LNSVPEAIRTAVRNNGGGHANHSLFWETIGPNGGGAP-TGKLADAIASELGGFDKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A +T+FGSGW WL++ ++GKL++    N ++P++ G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 AKAGATRFGSGWAWLALGQDGKLKVYSLPNQDSPIMEGDTPLLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N+VNWE V +RYE A  
Sbjct: 180 PDYIAAF-WNVVNWEAVGQRYEAAAK 204


>gi|193212804|ref|YP_001998757.1| Superoxide dismutase [Chlorobaculum parvum NCIB 8327]
 gi|193086281|gb|ACF11557.1| Superoxide dismutase [Chlorobaculum parvum NCIB 8327]
          Length = 200

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/201 (44%), Positives = 128/201 (63%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++ P LPY+ + L P++S  T+ +H+  HH  Y  N   L        +SLEE+I+K 
Sbjct: 1   MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGLVEGTPFDSMSLEEVILKT 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S  G+FNN +Q +NH+ +W C+  N G       ++  I ++FGS EKFK +L TA
Sbjct: 61  ADDASKVGVFNNGAQAWNHSFYWNCLSPNGGGEP-TGDVAAKIVEDFGSVEKFKEELKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L++ KT NA+NP+ +G  P+L IDVWEHAYYLD++ RR  ++
Sbjct: 120 AATQFGSGWAWLVLDNGTLKVVKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHV 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
            + I NL+NWE+V E Y+ A 
Sbjct: 180 AAVIDNLLNWEFVNENYKAAK 200


>gi|160901799|ref|YP_001567380.1| superoxide dismutase [Petrotoga mobilis SJ95]
 gi|160359443|gb|ABX31057.1| Superoxide dismutase [Petrotoga mobilis SJ95]
          Length = 204

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/202 (41%), Positives = 112/202 (55%), Gaps = 8/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M F+LP L Y YD L PY+   T+E HH  HH  Y  N         E    S+E+I+  
Sbjct: 1   MAFELPKLSYPYDALEPYIDATTMEIHHTKHHGGYVKNLNAALEKYPEWASKSIEDILKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   +YNH++FW  M  N G       L+++ID  FGSF+KFK + 
Sbjct: 61  LDNIPEDIRTTVRNNGGGHYNHSIFWTIMGPNGGGEP-SGKLAESIDKTFGSFDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FGSGW WL + N   L I  T N +NP+     P+LG+DVWEHAYYL ++ +R
Sbjct: 120 SNAAVTRFGSGWAWLVLDNYGHLSILSTPNQDNPITYSLKPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYE 196
             YI++   N+VNWE V +RYE
Sbjct: 180 PEYIQA-WWNIVNWEAVTKRYE 200


>gi|251794836|ref|YP_003009567.1| superoxide dismutase [Paenibacillus sp. JDR-2]
 gi|247542462|gb|ACS99480.1| Superoxide dismutase [Paenibacillus sp. JDR-2]
          Length = 203

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ D L P++   T+E HH  HH  Y  N       A  L     E ++ +
Sbjct: 1   MAHQLPALPYAKDALEPHIDALTMEIHHGRHHNAYVTNLNAALEQAPELQDKSLEELLAN 60

Query: 61  H------GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
           +           + NN   + NH+LFW  +  N G      AL+ AID   G F+ FK++
Sbjct: 61  NLAIVPDAIKTAVRNNGGGHANHSLFWEVIGPNGGGAP-TGALAAAIDSELGGFDAFKAE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              AA+T+FGSGW WLSVK+GKL++S   N ++P+  G  PILG+DVWEHAYYL+++ +R
Sbjct: 120 FAKAATTRFGSGWAWLSVKDGKLKVSSLPNQDSPIFEGETPILGLDVWEHAYYLNYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+VNW  V +RYE A+
Sbjct: 180 PDYIAAF-WNVVNWAEVGKRYEAAV 203


>gi|283785132|ref|YP_003364997.1| superoxide dismutase [Fe] [Citrobacter rodentium ICC168]
 gi|282948586|emb|CBG88177.1| superoxide dismutase [Fe] [Citrobacter rodentium ICC168]
          Length = 193

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  +
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF  FK+    AA 
Sbjct: 61  DG---GVFNNAAQVWNHTFYWNCLAPNAGGEP-TGELADAIVASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL   K+GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGKDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F   LVNW +V + +  
Sbjct: 177 NF-WALVNWAFVAKNFAA 193


>gi|22127949|ref|NP_671372.1| superoxide dismutase [Yersinia pestis KIM 10]
 gi|45443696|ref|NP_995235.1| superoxide dismutase [Yersinia pestis biovar Microtus str. 91001]
 gi|51598210|ref|YP_072401.1| superoxide dismutase [Yersinia pseudotuberculosis IP 32953]
 gi|108809015|ref|YP_652931.1| superoxide dismutase [Yersinia pestis Antiqua]
 gi|108813868|ref|YP_649635.1| superoxide dismutase [Yersinia pestis Nepal516]
 gi|145597356|ref|YP_001161431.1| superoxide dismutase [Yersinia pestis Pestoides F]
 gi|150260998|ref|ZP_01917726.1| superoxide dismutase [Mn] [Yersinia pestis CA88-4125]
 gi|153946969|ref|YP_001403064.1| superoxide dismutase [Yersinia pseudotuberculosis IP 31758]
 gi|162421209|ref|YP_001608084.1| superoxide dismutase [Yersinia pestis Angola]
 gi|165926104|ref|ZP_02221936.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936868|ref|ZP_02225434.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009681|ref|ZP_02230579.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213171|ref|ZP_02239206.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398912|ref|ZP_02304436.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420944|ref|ZP_02312697.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167470044|ref|ZP_02334748.1| superoxide dismutase (Mn) [Yersinia pestis FV-1]
 gi|170022297|ref|YP_001718802.1| superoxide dismutase [Yersinia pseudotuberculosis YPIII]
 gi|186897438|ref|YP_001874550.1| superoxide dismutase [Yersinia pseudotuberculosis PB1/+]
 gi|218931043|ref|YP_002348918.1| superoxide dismutase [Yersinia pestis CO92]
 gi|229839766|ref|ZP_04459925.1| superoxide dismutase, Mn [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229841850|ref|ZP_04462006.1| superoxide dismutase, Mn [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229896728|ref|ZP_04511892.1| superoxide dismutase, Mn [Yersinia pestis Pestoides A]
 gi|229904388|ref|ZP_04519499.1| superoxide dismutase, Mn [Yersinia pestis Nepal516]
 gi|270488331|ref|ZP_06205405.1| superoxide dismutase (Mn) [Yersinia pestis KIM D27]
 gi|294505592|ref|YP_003569654.1| superoxide dismutase [Yersinia pestis Z176003]
 gi|21961091|gb|AAM87623.1|AE014009_5 superoxide dismutase, manganese [Yersinia pestis KIM 10]
 gi|45438566|gb|AAS64112.1| superoxide dismutase (Mn) [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591492|emb|CAH23163.1| superoxide dismutase [Mn] [Yersinia pseudotuberculosis IP 32953]
 gi|108777516|gb|ABG20035.1| superoxide dismutase (Mn) [Yersinia pestis Nepal516]
 gi|108780928|gb|ABG14986.1| superoxide dismutase (Mn) [Yersinia pestis Antiqua]
 gi|115349654|emb|CAL22634.1| superoxide dismutase [Mn] [Yersinia pestis CO92]
 gi|145209052|gb|ABP38459.1| superoxide dismutase (Mn) [Yersinia pestis Pestoides F]
 gi|149290406|gb|EDM40483.1| superoxide dismutase [Mn] [Yersinia pestis CA88-4125]
 gi|152958464|gb|ABS45925.1| superoxide dismutase (Mn) [Yersinia pseudotuberculosis IP 31758]
 gi|162354024|gb|ABX87972.1| superoxide dismutase (Mn) [Yersinia pestis Angola]
 gi|165915110|gb|EDR33721.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921964|gb|EDR39141.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991603|gb|EDR43904.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205469|gb|EDR49949.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961073|gb|EDR57094.1| superoxide dismutase [Mn] [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051416|gb|EDR62824.1| superoxide dismutase [Mn] [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|169748831|gb|ACA66349.1| Superoxide dismutase [Yersinia pseudotuberculosis YPIII]
 gi|186700464|gb|ACC91093.1| manganese and iron superoxide dismutase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678506|gb|EEO74611.1| superoxide dismutase, Mn [Yersinia pestis Nepal516]
 gi|229691189|gb|EEO83242.1| superoxide dismutase, Mn [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696132|gb|EEO86179.1| superoxide dismutase, Mn [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700267|gb|EEO88302.1| superoxide dismutase, Mn [Yersinia pestis Pestoides A]
 gi|262363757|gb|ACY60478.1| superoxide dismutase [Yersinia pestis D106004]
 gi|262367692|gb|ACY64249.1| superoxide dismutase [Yersinia pestis D182038]
 gi|270336835|gb|EFA47612.1| superoxide dismutase (Mn) [Yersinia pestis KIM D27]
 gi|294356051|gb|ADE66392.1| superoxide dismutase [Yersinia pestis Z176003]
 gi|320017388|gb|ADW00960.1| superoxide dismutase, Mn [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 207

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/211 (40%), Positives = 121/211 (57%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+  LS+E++I  
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLAGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLING------AIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|73945750|ref|XP_533463.2| PREDICTED: similar to Superoxide dismutase [Mn], mitochondrial
           precursor isoform 1 [Canis familiaris]
          Length = 223

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 6/201 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N      +  +  L     I     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNT-IEEKYLEALEKASDITAQIA 84

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              GL  N   + NH++FW  +    G G+    L +AI  +FGSF+KFK  L T +   
Sbjct: 85  LQPGLKFNGGGHINHSIFWTNLSP-KGGGEPKGELLEAIKRDFGSFDKFKEKLTTVSVGV 143

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 144 QGSGWGWLGFNKEQGRLQIAACFNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 203

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 204 A-IWNVINWENVTERYMACKK 223


>gi|62638119|gb|AAX92665.1| chloroplast iron superoxide dismutase [Dunaliella salina]
          Length = 227

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--G 62
           L  LPY+ D L P+MSK T E+HH  HH+ YADN  K  +  E     L+ I++ S   G
Sbjct: 30  LKPLPYAPDALEPHMSKATFEFHHGKHHRAYADNLNKQIAGKEWDQKDLDTIVMASWNNG 89

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +    FNNA+Q +NH  FW  MK N G      AL +AI  +FGSF++FK+    A  TQ
Sbjct: 90  NPTPEFNNAAQVWNHEFFWESMKPNGGGEP-TGALMEAIKRDFGSFDEFKNQFKAAGMTQ 148

Query: 123 FGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           FGSGW WL      KL I+KT NA  P++ G  PIL +DVWEHAYYLD++ RR  +I++F
Sbjct: 149 FGSGWAWLVTDKSGKLSIAKTPNAVVPVVEGKSPILTVDVWEHAYYLDYQNRRPDFIQTF 208

Query: 182 ITNLVNWEYVCERYETA 198
           +  LV+W+ V  RY  A
Sbjct: 209 LDKLVSWDAVSNRYAKA 225


>gi|300938412|ref|ZP_07153157.1| superoxide dismutase [Escherichia coli MS 21-1]
 gi|300456613|gb|EFK20106.1| superoxide dismutase [Escherichia coli MS 21-1]
          Length = 208

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|1711458|sp|P53655|SODM_YEREN RecName: Full=Superoxide dismutase [Mn]
 gi|1237254|emb|CAA65596.1| sodA [Yersinia enterocolitica]
 gi|146263092|gb|ABQ15316.1| SodA [Yersinia enterocolitica]
          Length = 207

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EAAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|329917205|ref|ZP_08276440.1| Superoxide dismutase (Fe) [Oxalobacteraceae bacterium IMCC9480]
 gi|327544617|gb|EGF30090.1| Superoxide dismutase (Fe) [Oxalobacteraceae bacterium IMCC9480]
          Length = 192

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 124/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLEYH+  HH+ Y  N   L    E    +LE+II KS
Sbjct: 1   MEHTLPALPYAMDALAPHISKETLEYHYGKHHQTYVTNLNNLVKGTEFESATLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  +W C+  N G      AL+DAI+  FGSFEKFK D   +A 
Sbjct: 61  TG---GVFNNSAQVWNHTFYWNCLTPNGGGAP-TGALADAINAKFGSFEKFKEDFTKSAL 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++++ T NA  PL     P++  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGSVDLANTSNAGCPLTGADTPLMTCDVWEHAYYVDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V + + 
Sbjct: 177 AF-WNLVNWDFVAKNFA 192


>gi|299773461|gb|ADJ38805.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 114/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
           + AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 VLAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|157152707|gb|ABV24053.1| Mn superoxide dismutase [Takifugu obscurus]
          Length = 227

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 31  HTLPDLTYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKR--DVTAQVA 88

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A    
Sbjct: 89  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELMEAIKRDFGSFQKMKEKMSAATVAV 147

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL    + G+L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 148 QGSGWGWLGYSKETGRLCIAACGNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 207

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER +TA  
Sbjct: 208 A-IWNVINWENVSERLQTAKK 227


>gi|167425438|ref|ZP_02317191.1| superoxide dismutase [Mn] [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167055452|gb|EDR65245.1| superoxide dismutase [Mn] [Yersinia pestis biovar Mediaevalis str.
           K1973002]
          Length = 209

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/211 (40%), Positives = 121/211 (57%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+  LS+E++I  
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 63  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLAGDLKAAIERDFGSVDSFKEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLING------AIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 120 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYL 179

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 180 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 209


>gi|307151980|ref|YP_003887364.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
 gi|306982208|gb|ADN14089.1| Manganese/iron superoxide dismutase-like protein [Cyanothece sp.
           PCC 7822]
          Length = 244

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            F LP LPY+Y+ L PY+ +ET+ +HHD HH  Y  N     +    L     E +IK  
Sbjct: 42  PFTLPPLPYAYNALEPYIDQETMRFHHDKHHAAYTKNLNGAVNKYPQLKGKSAEDLIKNI 101

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   Y NH++FW  M  N   GK    ++ AI+ +FGSFE F++   
Sbjct: 102 NSLPQDIQTTVRNNGGGYVNHDMFWKIMSPN-AGGKPKGEIAKAINQDFGSFEAFQAAFN 160

Query: 117 TAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A  ++FGSGW WL   KNGKL++S T N ++PL+ G  PI+G DVWEHAYYL +K  R 
Sbjct: 161 KAGESRFGSGWAWLILDKNGKLKVSSTANQDSPLMEGIYPIMGNDVWEHAYYLKYKNNRG 220

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y++    N+VNW+ V +R++ A  
Sbjct: 221 QYLQQ-WWNVVNWDEVNKRFQQAKS 244


>gi|285017906|ref|YP_003375617.1| manganese and iron superoxide dismutase [Xanthomonas albilineans
           GPE PC73]
 gi|283473124|emb|CBA15630.1| probable manganese and iron superoxide dismutase protein
           [Xanthomonas albilineans]
          Length = 203

 Score =  202 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 108/204 (52%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+Y DL P++  +T+E HH  HH  Y  N        E   L +E ++ K 
Sbjct: 1   MAYTLPKLPYAYADLEPHIDAQTMEIHHSKHHNTYITNVNAALEGTEYADLPVEVLLSKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH  FW  M  N G       ++ AI+   G F+KFK    
Sbjct: 61  KSLPENLQGSVRNNGGGHANHLQFWTVMAPNAGGTPSGN-VAKAIERELGGFDKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA  +FGSGW W+SV   K L +  T N ++PL  G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALARFGSGWAWMSVTPNKTLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+++W+ V  RY  A+
Sbjct: 180 DYIGAFF-NVIDWKEVERRYNAAI 202


>gi|299065875|emb|CBJ37054.1| superoxide dismutase [Ralstonia solanacearum CMR15]
          Length = 192

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 121/197 (61%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  +LSLE+I+ KS
Sbjct: 1   MAHTLPQLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   GLFNNA+Q +NH  +W  +K N G      AL+DAI+  +GSF+ FK      A 
Sbjct: 61  SG---GLFNNAAQVWNHTFYWNGLKPNGGGAP-TGALADAINAKWGSFDAFKEAFTKVAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++V   + 
Sbjct: 177 AF-WSLVNWDFVASNFA 192


>gi|300719105|ref|YP_003743908.1| Manganese superoxide dismutase [Erwinia billingiae Eb661]
 gi|299064941|emb|CAX62061.1| Manganese superoxide dismutase [Erwinia billingiae Eb661]
          Length = 207

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 116/209 (55%), Gaps = 14/209 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E   L ++E+I K 
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALEGTEFADLPVDELIAKL 62

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                   A L NNA  + NH+ FW  +K       +   L  AI+ +FGS + FK++  
Sbjct: 63  DQVPADKKAALRNNAGGHSNHSFFWKGLKT---GTTLSGDLKAAIEKDFGSVDAFKAEFE 119

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N ++PL+          PILG+DVWEHAYYL +
Sbjct: 120 KAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPILGLDVWEHAYYLKY 179

Query: 171 KYRRAHYIESFITNLVNWEYVCERYETAM 199
           + +R  YI++F  ++ NW+     +  A 
Sbjct: 180 QNKRPDYIKAF-WDVANWDQAAALFSAAK 207


>gi|261868657|ref|YP_003256579.1| superoxide dismutase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413989|gb|ACX83360.1| superoxide dismutase (Mn) [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 214

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/215 (38%), Positives = 118/215 (54%), Gaps = 18/215 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA     +   L    E    K 
Sbjct: 1   MAYTLPELGYAYDALEPHFDAQTMEIHHSKHHQAYVNNANAALENPPELQALSEGCPGKL 60

Query: 60  -------SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFK 112
                  +      L NN   + NH+LFW  +KK      +   L DAI+ +FGS E FK
Sbjct: 61  LAHLSEITPEKRPALRNNVGGHLNHSLFWKSLKK---GTTLKGPLKDAIERDFGSVENFK 117

Query: 113 SDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAY 166
           ++   AA+T+FGSGW WL ++NGKL +  T N +NP++         +PI G+DVWEHAY
Sbjct: 118 AEFEKAAATRFGSGWAWLVLENGKLAVVSTANQDNPIMGKEYAGCSGVPIFGLDVWEHAY 177

Query: 167 YLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           YL F+ RR  YI+ F  N++NW++  ER+E  +  
Sbjct: 178 YLKFQNRRPDYIKEF-WNVLNWDFANERFEKILAG 211


>gi|37781188|gb|AAP34300.1| manganese superoxide dismutase [Danio rerio]
          Length = 224

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++  E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HALPDLTYDYGALEPHICAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A    
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLEAIKRDFGSFQKMKEKISAATVAV 144

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  +    +L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGFEKESGRLRIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+VNWE V ER++ A  
Sbjct: 205 A-IWNVVNWENVGERFQAAKK 224


>gi|269925461|ref|YP_003322084.1| Superoxide dismutase [Thermobaculum terrenum ATCC BAA-798]
 gi|269789121|gb|ACZ41262.1| Superoxide dismutase [Thermobaculum terrenum ATCC BAA-798]
          Length = 203

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 115/204 (56%), Gaps = 8/204 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
            +LP LPY Y+ L PY+ ++T+  HHD HH  Y +N  +       L     E +++   
Sbjct: 2   HELPPLPYDYNALEPYIDEQTMRLHHDKHHGTYVNNLNQALEKYPELQNKSAEDLLRDIN 61

Query: 63  S-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S        + NN   + NH++FW  MK N G       ++DAI   FGSFE+FK     
Sbjct: 62  SIPEDIRTAVRNNGGGHVNHSMFWVIMKPNGGGEPYGP-IADAIKQTFGSFEEFKRQFND 120

Query: 118 AASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A + +FGSGW WL    +G+L++  T N ++PL+ G  PI+G DVWEHAYYL ++ RRA 
Sbjct: 121 AGAKRFGSGWVWLVRTPDGQLQVISTANQDSPLMEGLYPIMGNDVWEHAYYLKYQNRRAE 180

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           Y+E+   N+VNW+ +  R+E +  
Sbjct: 181 YLEA-WWNVVNWDEINRRFEQSSK 203


>gi|332163485|ref|YP_004300062.1| superoxide dismutase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|146263094|gb|ABQ15317.1| SodA [Yersinia enterocolitica]
 gi|146263100|gb|ABQ15320.1| SodA [Yersinia kristensenii]
 gi|146263102|gb|ABQ15321.1| SodA [Yersinia kristensenii]
 gi|325667715|gb|ADZ44359.1| superoxide dismutase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330861704|emb|CBX71878.1| superoxide dismutase [Mn] [Yersinia enterocolitica W22703]
          Length = 207

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|209526156|ref|ZP_03274687.1| Superoxide dismutase [Arthrospira maxima CS-328]
 gi|284053428|ref|ZP_06383638.1| Superoxide dismutase [Arthrospira platensis str. Paraca]
 gi|209493412|gb|EDZ93736.1| Superoxide dismutase [Arthrospira maxima CS-328]
          Length = 201

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 130/201 (64%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F+LP+LP+  D L    MS  TL YHH  HH  Y  N        +M ++SLEEII  
Sbjct: 1   MAFELPSLPFDQDALESSKMSANTLSYHHGKHHAAYVKNLNAAIEGTDMANMSLEEIIKA 60

Query: 60  SHG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           ++   S +G+FNNA+Q +NH+ FW C+K N G      AL+D I  +FGSF+ F  +   
Sbjct: 61  TYNDPSKSGIFNNAAQVWNHSFFWKCLKPNGGGQP-TGALADKIQADFGSFDAFIQEFKN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL + NG L+++KT NA NP++ G  P+L +DVWEHAYYLDF+  R  +
Sbjct: 120 AAATQFGSGWAWLVLDNGTLKVTKTANAVNPMVEGKTPLLTLDVWEHAYYLDFQNARPGF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++FI NLVNW++V E   +A
Sbjct: 180 IDNFIENLVNWDFVAENLASA 200


>gi|17227566|ref|NP_484114.1| superoxide dismutase [Nostoc sp. PCC 7120]
 gi|17135048|dbj|BAB77594.1| superoxide dismutase [Nostoc sp. PCC 7120]
          Length = 270

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 106/206 (51%), Gaps = 8/206 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK---- 59
           +LP LPY YD L   +  ET++ HHD HH  Y +N          L  S  E +++    
Sbjct: 67  ELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNS 126

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH +FW  M   DG G+    ++  I+  FGSFE+FK     A
Sbjct: 127 VPEDIRTTVRNNGGGHLNHTIFWQIMSP-DGGGQPTGDIAQEINQTFGSFEEFKKQFNQA 185

Query: 119 ASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
              +FGSGW WL      +L+I  T N ++P++ G+ PI+G DVWEHAYYL ++ RR  Y
Sbjct: 186 GGDRFGSGWVWLVRNPQGQLQIVSTPNQDSPIMEGSYPIMGNDVWEHAYYLRYQNRRPEY 245

Query: 178 IESFITNLVNWEYVCERYETAMLAQK 203
           + +   N+VNW  +  R + +  +  
Sbjct: 246 LNN-WWNVVNWSEINRRTQASRQSNS 270


>gi|147899555|ref|NP_001083968.1| superoxide dismutase 2, mitochondrial [Xenopus laevis]
 gi|34305125|gb|AAQ63483.1| manganese superoxide dismutase [Xenopus laevis]
          Length = 224

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 106/201 (52%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N     ++ +      +  +     
Sbjct: 28  HTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLN--ITEEKYAEALAKGDVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
             A L  N   + NH +FW  +  N G       L DAI  +FGSFEKFK  L T +   
Sbjct: 86  LQAALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLDAIKRDFGSFEKFKEKLNTVSVGV 144

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     + +L+++   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKDSNRLQLAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY+ +  
Sbjct: 205 A-IWNVINWENVTERYQASKK 224


>gi|47224642|emb|CAG03626.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 225

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 29  HTLPDLTYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVA 86

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L + I  +FGSF+K K  +  A    
Sbjct: 87  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELMETIKRDFGSFQKMKEKMSAATVAV 145

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 146 QGSGWGWLGYSKDTGSLCIAACGNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 205

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER +TA  
Sbjct: 206 A-IWNVINWENVSERLQTAKK 225


>gi|311281636|ref|YP_003943867.1| Manganese/iron superoxide dismutase-like protein [Enterobacter
           cloacae SCF1]
 gi|308750831|gb|ADO50583.1| Manganese/iron superoxide dismutase-like protein [Enterobacter
           cloacae SCF1]
          Length = 206

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA               E +I  
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYINNANAALESLPEFASLSAEALIAQ 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDKLPADKKTVLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIERDFGSVDSFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI++F  ++VNW+    R+  
Sbjct: 178 FQNRRPDYIKAF-WDVVNWDEAAARFAA 204


>gi|300947229|ref|ZP_07161436.1| superoxide dismutase [Escherichia coli MS 116-1]
 gi|300954635|ref|ZP_07167078.1| superoxide dismutase [Escherichia coli MS 175-1]
 gi|301645096|ref|ZP_07245056.1| superoxide dismutase [Escherichia coli MS 146-1]
 gi|331644644|ref|ZP_08345763.1| superoxide dismutase (Mn) [Escherichia coli H736]
 gi|300318397|gb|EFJ68181.1| superoxide dismutase [Escherichia coli MS 175-1]
 gi|300453153|gb|EFK16773.1| superoxide dismutase [Escherichia coli MS 116-1]
 gi|301076616|gb|EFK91422.1| superoxide dismutase [Escherichia coli MS 146-1]
 gi|331036106|gb|EGI08342.1| superoxide dismutase (Mn) [Escherichia coli H736]
          Length = 208

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 63  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL 
Sbjct: 120 EKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLK 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 180 FQNRRPDYIKEF-WNVVNWDEAAARFAA 206


>gi|186686501|ref|YP_001869697.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
 gi|186468953|gb|ACC84754.1| manganese and iron superoxide dismutase [Nostoc punctiforme PCC
           73102]
          Length = 200

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 94/201 (46%), Positives = 122/201 (60%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSP-YMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F  P LP+  + L P  M  ET EYH+  HHK Y DN  KL    E+    LEE+I  
Sbjct: 1   MVFVQPPLPFDKNALEPNGMKAETFEYHYGKHHKAYVDNLNKLTEGTELADKPLEEVIKI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S AG+FNNA+Q +NH  FW  +K N G       L+  ID +FGSF+KFK +   
Sbjct: 61  SFQDSSKAGIFNNAAQVWNHTFFWNSLKPNGGGAP-TGDLAARIDKDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+D++  R  +
Sbjct: 120 AAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NLVNW++  E    A
Sbjct: 180 IKNFLDNLVNWDFAAENLAKA 200


>gi|326336596|ref|ZP_08202765.1| superoxide dismutase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691261|gb|EGD33231.1| superoxide dismutase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 201

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 124/201 (61%), Gaps = 6/201 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+Y+ L PY+   T+E H+  HHK Y DN     +  E+   S+E+I++  
Sbjct: 1   MSFNLPELPYAYNALEPYIDARTMEIHYTKHHKAYTDNLNNAITGTELEGKSIEDILLNL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   YYNHNLFW  +  N G     + LS+AID  FGSF+ FK     AA+
Sbjct: 61  DPENKAVRNNGGGYYNHNLFWEILTPNKGMTP-SKELSEAIDKAFGSFKAFKEIFSKAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN---GAIPILGIDVWEHAYYLDFKYRRAH 176
           TQFGSGW WL+V K GK+E+  T N +NPL+       PILGIDVWEHAYYL+++ RRA 
Sbjct: 120 TQFGSGWAWLTVHKGGKIEVCATANQDNPLMPHIQCGSPILGIDVWEHAYYLNYQNRRAD 179

Query: 177 YIESFITNLVNWEYVCERYET 197
           YIE+F  N++NW  V E Y  
Sbjct: 180 YIEAFF-NVINWNKVSELYHK 199


>gi|163797602|ref|ZP_02191551.1| Superoxide dismutase [alpha proteobacterium BAL199]
 gi|159177077|gb|EDP61639.1| Superoxide dismutase [alpha proteobacterium BAL199]
          Length = 201

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+YD L+PYMS ETLE+HHD HH  Y  N   L  D+ +   SLEE++  S
Sbjct: 1   MAFELPPLPYAYDALAPYMSAETLEFHHDKHHNAYVVNGNNLLKDSGLEGKSLEEVVKAS 60

Query: 61  HGSNA--GLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           + ++   GLFNNA+Q++NH  FW  MK   G G +P  L   I  +FGS  KFK D + A
Sbjct: 61  YKNDKLAGLFNNAAQHWNHIEFWQWMKP-KGGGAMPGELEKRIAADFGSVAKFKEDFVNA 119

Query: 119 ASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
             TQFGSGW WL+V  +GKL+++KT N  NP+  G   +LG DVWEH+YY+D++ RR  Y
Sbjct: 120 GVTQFGSGWCWLAVGSDGKLKVTKTANGVNPVALGETALLGCDVWEHSYYIDYRNRRPDY 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           +++F+ ++VNWE V E    A
Sbjct: 180 VKAFLDSMVNWERVAELLGKA 200


>gi|291243826|ref|XP_002741802.1| PREDICTED: superoxide dismutase 2, mitochondrial-like [Saccoglossus
           kowalevskii]
          Length = 222

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 101/201 (50%), Gaps = 7/201 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
              LP+LPY Y  LSP +S E +E HH  HH+ Y +N        ++   + +  I K  
Sbjct: 26  AHTLPDLPYDYGALSPVISSEIMELHHKKHHQTYVNNFNNAEE--QLKEATNKGDISKII 83

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
                L  N   + NH++FW  +  N G       L + I+ +FGS++ F   +  +   
Sbjct: 84  SLAPALKFNGGGHLNHSIFWKNLSPNGGGQP-SGDLLEQINKDFGSYDNFVKTMSASTIA 142

Query: 122 QFGSGWGWLSVKN--GKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             GSGWGWL       KL ++   N +      G +P+LGIDVWEHAYYL +K  R  Y+
Sbjct: 143 IQGSGWGWLGYDRATSKLVVATCANQDPLQSTTGLVPLLGIDVWEHAYYLQYKNVRPDYV 202

Query: 179 ESFITNLVNWEYVCERYETAM 199
           ++ I  +VNW+ V ER+  A 
Sbjct: 203 KA-IWEIVNWKDVSERFVGAK 222


>gi|299773433|gb|ADJ38791.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|45861258|gb|AAS78511.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861266|gb|AAS78515.1| superoxide dismutase [Staphylococcus xylosus]
 gi|45861272|gb|AAS78518.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 197

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/201 (39%), Positives = 110/201 (54%), Gaps = 8/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           F+LPNLPY +D L P++ ++T+E HH  HH  Y           ++   S+EEI+     
Sbjct: 1   FELPNLPYGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANLDS 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH+LFW  +  N  +        D I + +GS + FK +    
Sbjct: 61  VPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFADK 117

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  YI
Sbjct: 118 AAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYI 177

Query: 179 ESFITNLVNWEYVCERYETAM 199
            +F  N+VNWE V E Y  A 
Sbjct: 178 SAF-WNVVNWEKVDELYNAAK 197


>gi|88801534|ref|ZP_01117062.1| superoxide dismutase, Mn family protein [Polaribacter irgensii
           23-P]
 gi|88782192|gb|EAR13369.1| superoxide dismutase, Mn family protein [Polaribacter irgensii
           23-P]
          Length = 202

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 89/204 (43%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+Y+ L P +  +T+E HH  HH  Y        +  ++   S+E+I+   
Sbjct: 1   MAFQLPELDYAYNALEPNIDAQTMEIHHSKHHNAYTAKLNGAVAGTDLEGKSIEDILANL 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN G+ NN   +YNH+LFW  M   +GKG +   L +AID  FGS E F      AA+
Sbjct: 61  DMSNGGVRNNGGGFYNHSLFWKVMSP-EGKGALSGELKEAIDAAFGSKEAFMEAFSNAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           TQFGSGW WL V K GK+E+  T N +NPL+     G  PILG+DVWEHAYYL+++ RR 
Sbjct: 120 TQFGSGWAWLCVHKGGKVEVCSTPNQDNPLMPGVTCGGTPILGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N++NW  V  R+  A 
Sbjct: 180 DYINAFF-NVINWTEVERRFNEAK 202


>gi|317494597|ref|ZP_07953010.1| iron/manganese superoxide dismutase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917527|gb|EFV38873.1| iron/manganese superoxide dismutase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 210

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/212 (37%), Positives = 116/212 (54%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA         L     E +I  
Sbjct: 3   MSYTLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLPELAKLTAEELIAQ 62

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+ FW  +K      ++   L  AI+ +FGS +KFK + 
Sbjct: 63  LDKVPTEKRTALRNNAGGHANHSFFWKGLK---LGTELKGDLKAAIERDFGSVDKFKEEF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI G+DVWEHAYYL
Sbjct: 120 EKAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGYPIAGLDVWEHAYYL 179

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F  ++VNW+   +R+  A  
Sbjct: 180 KYQNRRPDYIKAF-WSVVNWDEAAKRFAEAKK 210


>gi|34810954|pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-Superoxide Dismutase From The
           Thermophilic Cyanobacterium Thermosynechococcus
           Elongatus : Correlation Of Epr And Structural
           Characteristics
 gi|34810955|pdb|1MY6|B Chain B, The 1.6 A Structure Of Fe-Superoxide Dismutase From The
           Thermophilic Cyanobacterium Thermosynechococcus
           Elongatus : Correlation Of Epr And Structural
           Characteristics
          Length = 199

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/200 (45%), Positives = 130/200 (65%), Gaps = 4/200 (2%)

Query: 2   DFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
            F    LP+    L PY MS +TLE+H+  HHK Y DN  KL  D E+   SLE++I  +
Sbjct: 1   AFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTT 60

Query: 61  HGS--NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +G     G+FNNA+Q +NH  FW  +K   G G     ++  I+  FGS+++FK+    A
Sbjct: 61  YGDAAKVGIFNNAAQVWNHTFFWNSLKP-GGGGVPTGDVAARINSAFGSYDEFKAQFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL ++ G L+++KT NAENPL++G +P+L IDVWEHAYYLD++ RR  +I
Sbjct: 120 AATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
           ++F+  LVNW++V +    A
Sbjct: 180 DNFLNQLVNWDFVAKNLAAA 199


>gi|33151556|ref|NP_872909.1| manganese superoxide dismutase [Haemophilus ducreyi 35000HP]
 gi|34588121|sp|O30826|SODM_HAEDU RecName: Full=Superoxide dismutase [Mn]
 gi|33147776|gb|AAP95298.1| manganese superoxide dismutase [Haemophilus ducreyi 35000HP]
          Length = 213

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/208 (37%), Positives = 114/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+YD L PY  KET+E HH  HH+ Y +N+  L      L        L++
Sbjct: 1   MTYQLPELGYAYDALEPYFDKETMEIHHSKHHQAYVNNSNALLEKHPELLEKCPGALLKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS E F+++ 
Sbjct: 61  LTQVPAEKRTAVRNNLGGHVNHTLFWKGLKT---GTTLQGALKDAIIRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL ++ GKL +  T N ++P++          PI  +DVWEHAYYL 
Sbjct: 118 EQAAATRFGSGWAWLVLEEGKLAVVSTANQDSPIMGKDVAGVSGYPIFTLDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEASRRFEE 204


>gi|260424826|ref|ZP_05733401.2| superoxide dismutase, Mn [Dialister invisus DSM 15470]
 gi|260403302|gb|EEW96849.1| superoxide dismutase, Mn [Dialister invisus DSM 15470]
          Length = 207

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK 59
           M F LP+LPY++D L P +  +T+E HH  HH  Y  N  K      E    S+E++II 
Sbjct: 7   MAFVLPDLPYAFDALEPIIDAKTMEIHHGRHHAAYVANLNKAVENYPEWAEKSIEDVIIH 66

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   +YNH+LFW  M    G+ K   +L   ID++FGSF++FK   
Sbjct: 67  LNEVPEAIRTAVRNNGGGHYNHSLFWKMMAPV-GQTKPSASLLAKIDESFGSFDEFKKQF 125

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+++FGSGW WL    GKL++  T N + PL +G  PIL +DVWEHAYYL ++ RRA
Sbjct: 126 AAAATSRFGSGWAWLVADGGKLDVLSTANQDCPLEDGKKPILCLDVWEHAYYLKYQNRRA 185

Query: 176 HYIESFITNLVNWEYVCERYETA 198
            Y E+F   +VNW++V E    A
Sbjct: 186 DYAENFF-QVVNWDFVEELLGKA 207


>gi|157147301|ref|YP_001454620.1| superoxide dismutase [Citrobacter koseri ATCC BAA-895]
 gi|157084506|gb|ABV14184.1| hypothetical protein CKO_03093 [Citrobacter koseri ATCC BAA-895]
          Length = 210

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 120/208 (57%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA     +  E  +L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTALQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL ++  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLQGDKLAVVSTANQDSPLMGEAISGVSGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|45861256|gb|AAS78510.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 197

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/201 (39%), Positives = 110/201 (54%), Gaps = 8/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           F+LPNLPY +D L P++ ++T+E HH  HH  Y           ++   S+EEI+     
Sbjct: 1   FELPNLPYGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANLDS 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH+LFW  +  N  +        D I + +GS + FK +    
Sbjct: 61  VPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDTFKEEFADK 117

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  YI
Sbjct: 118 AAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYI 177

Query: 179 ESFITNLVNWEYVCERYETAM 199
            +F  N+VNWE V E Y  A 
Sbjct: 178 SAF-WNVVNWEKVDELYNAAK 197


>gi|110283002|sp|Q8HXP3|SODM_MACFA RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
 gi|84579211|dbj|BAE73039.1| hypothetical protein [Macaca fascicularis]
          Length = 222

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSFEKFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFEKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|299773437|gb|ADJ38793.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  Y+++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYVKAF-WNVVNWDEAARRFES 204


>gi|322515166|ref|ZP_08068167.1| superoxide dismutase [Actinobacillus ureae ATCC 25976]
 gi|322118831|gb|EFX91026.1| superoxide dismutase [Actinobacillus ureae ATCC 25976]
          Length = 213

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP L Y+YD L P+  K T+E HH  HH+ Y +NA         L       +IK 
Sbjct: 1   MAYQLPELGYAYDALEPHFDKATMEIHHSKHHQAYVNNANAALEAHPELLEKCPSALIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +  AL D I  +FGS E F+++ 
Sbjct: 61  LSQVPAEKRTAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDTIVRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL VK+GKL +  T N +NP++          P+L +DVWEHAYYL+
Sbjct: 118 EKAAATRFGSGWAWLVVKDGKLAVVSTANQDNPVMGKEIAGVSGYPLLCLDVWEHAYYLN 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEE 204


>gi|307133175|ref|YP_003885191.1| superoxide dismutase, Mn [Dickeya dadantii 3937]
 gi|306530704|gb|ADN00635.1| superoxide dismutase, Mn [Dickeya dadantii 3937]
          Length = 208

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/212 (39%), Positives = 117/212 (55%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLPEFAGLSAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDQLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLTGELKAAIERDFGSVDAFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+ +DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTPNQDSPLMGEAISGASGYPIVALDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F   +VNW+   +R+  A  
Sbjct: 178 QYQNRRPDYIKAFWF-VVNWDEAAKRFAEAKK 208


>gi|15419940|gb|AAK97214.1| MnSOD [Gallus gallus]
          Length = 224

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HTLPDLPYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYKEALAKG--DVTAQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH + W  +  + G       L +AI  +FGSF  FK  L   +   
Sbjct: 86  LQPALKFNGGGHINHTILWTNLSPSGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 144

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE    RYE+   
Sbjct: 205 A-IWNVINWENASSRYESCRK 224


>gi|146263088|gb|ABQ15314.1| SodA [Yersinia enterocolitica subsp. enterocolitica]
 gi|146263090|gb|ABQ15315.1| SodA [Yersinia enterocolitica subsp. enterocolitica]
          Length = 207

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLAGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EAAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|213963271|ref|ZP_03391528.1| superoxide dismutase [Mn] [Capnocytophaga sputigena Capno]
 gi|213954133|gb|EEB65458.1| superoxide dismutase [Mn] [Capnocytophaga sputigena Capno]
          Length = 201

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 97/199 (48%), Positives = 123/199 (61%), Gaps = 7/199 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+Y+ L PY+   T+E HH  HH  Y  N     + A +   S+EEI+   + 
Sbjct: 2   FTLPALPYAYNALEPYIDARTMEIHHTKHHNAYTTNLNAALAPAGVEGKSIEEILTNLNM 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           +NA L NNA  +YNHNLFW  M  N G GK    L+ AID+ FGSFE FK     AA+T+
Sbjct: 62  NNAALRNNAGGFYNHNLFWEIMSPN-GGGKPTGELAKAIDEAFGSFEGFKEAFSKAAATR 120

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GK+EI  T N +NPL+        PILG+DVWEHAYYL+++ RR  Y
Sbjct: 121 FGSGWAWLCVHKGGKVEICSTANQDNPLMPNTGCGGFPILGLDVWEHAYYLNYQNRRPDY 180

Query: 178 IESFITNLVNWEYVCERYE 196
           IE+F  +++NW  V E Y 
Sbjct: 181 IEAFF-SVINWAKVAELYN 198


>gi|85859098|ref|YP_461300.1| superoxide dismutase (Fe) [Syntrophus aciditrophicus SB]
 gi|85722189|gb|ABC77132.1| superoxide dismutase (Fe) [Syntrophus aciditrophicus SB]
          Length = 203

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 90/192 (46%), Positives = 125/192 (65%), Gaps = 3/192 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP+LPY  + L PY+S  TLE+HH  HH+ Y DNA KL  +  +L+ ++E +I K+    
Sbjct: 11  LPDLPYPKNALEPYISARTLEFHHGKHHQAYVDNANKLLPEMVLLNETMESVIEKTSADP 70

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S  G+FNN +Q +NH  +W CMK N G       ++  I D +GSFEKF  +   A  TQ
Sbjct: 71  SKVGIFNNVAQVWNHTFYWNCMKPNGGGQPTGN-IAVRIKDTWGSFEKFAEEFKNAGMTQ 129

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL ++   L+I KT NA+NPL +G  P+L +DVWEHAYYLD++ RRA Y+ +F+
Sbjct: 130 FGSGWAWLVLEQDSLKIVKTGNADNPLTHGQKPLLTVDVWEHAYYLDYQNRRAEYLNTFV 189

Query: 183 TNLVNWEYVCER 194
             L+NW++V  R
Sbjct: 190 DKLINWDFVNSR 201


>gi|37781196|gb|AAO43100.1| Mn superoxide dismutase [Haemophilus parasuis]
 gi|299773423|gb|ADJ38786.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773429|gb|ADJ38789.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKQVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|304398093|ref|ZP_07379968.1| Superoxide dismutase [Pantoea sp. aB]
 gi|304354379|gb|EFM18751.1| Superoxide dismutase [Pantoea sp. aB]
          Length = 205

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 83/200 (41%), Positives = 116/200 (58%), Gaps = 14/200 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L +EE+I K 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +K       +   L  AI+ +FGS EKF+ +  
Sbjct: 61  DQLPADKKGPLRNNAGGHANHSLFWKGLKT---GTTLQGDLKAAIEKDFGSVEKFQEEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N +NPL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAAATRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAVAGVSGFPIIGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWEY 190
           + +R  YI++F  N+VNW+ 
Sbjct: 178 QNKRPDYIKAF-WNVVNWDE 196


>gi|299773421|gb|ADJ38785.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773425|gb|ADJ38787.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773427|gb|ADJ38788.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773439|gb|ADJ38794.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 112/208 (53%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  + L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDFLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|270158352|ref|ZP_06187009.1| superoxide dismutase (Fe) [Legionella longbeachae D-4968]
 gi|289163406|ref|YP_003453544.1| superoxide dismutase, iron [Legionella longbeachae NSW150]
 gi|269990377|gb|EEZ96631.1| superoxide dismutase (Fe) [Legionella longbeachae D-4968]
 gi|288856579|emb|CBJ10384.1| superoxide dismutase, iron [Legionella longbeachae NSW150]
          Length = 192

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 116/197 (58%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ + L P++S ETLEYH+  HH+ Y  N  KL    E   + LEEII  S
Sbjct: 1   MTFTLPELPYAKNALEPHISSETLEYHYGKHHQAYVTNLNKLIPGTEFESMKLEEIIKNS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       +++AI+  FGSF+ FK      A 
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHCLSPNGGGEP-QGKVAEAINKYFGSFDSFKEKFTQTAI 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   +  +L+I  T NA  P+  G   +L  DVWEHAYY+D++  R  Y+ 
Sbjct: 117 TTFGSGWAWLVQDSAGELKIISTSNAGTPMTEGLTALLTCDVWEHAYYIDYRNARPDYVT 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V +  +
Sbjct: 177 AF-WNLVNWDFVADNMK 192


>gi|229135100|ref|ZP_04263902.1| Superoxide dismutase [Bacillus cereus BDRD-ST196]
 gi|228648329|gb|EEL04362.1| Superoxide dismutase [Bacillus cereus BDRD-ST196]
          Length = 203

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIII 58
           M   +LPNLPY+YD L P+  KET+  HH  HH  Y  N        AE+   S+EE++ 
Sbjct: 1   MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA 60

Query: 59  K----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                       + NN   + NH  FW  +  N G       L+ AI+  FGSF+ FK++
Sbjct: 61  NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQP-VGELATAIEAKFGSFDAFKAE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              A +T+FGSGW WL V NG+LE++ T N ++PL  G  P++G+DVWEHAYYL+++ RR
Sbjct: 120 FAKAGATRFGSGWAWLVVNNGELEVTSTSNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W    + Y+ A 
Sbjct: 180 PDYIGAF-WNVVDWNVAEKLYQEAK 203


>gi|299773441|gb|ADJ38795.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKQVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  Y+++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYVKAF-WNVVNWDEAARRFES 204


>gi|45861268|gb|AAS78516.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 199

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 80/203 (39%), Positives = 109/203 (53%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M F+LPNLPY  D L P++ ++T+  HH  HH  Y           ++   S+EEI+   
Sbjct: 1   MAFELPNLPYGCDALEPHIDQQTMVIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  N  +        D I + +GS + FK +  
Sbjct: 61  DSVPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  
Sbjct: 118 DKAAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI +F  N+VNWE V E Y  A 
Sbjct: 178 YISAF-WNVVNWEKVDELYNAAK 199


>gi|310639319|ref|YP_003944078.1| Superoxide dismutase [Ketogulonicigenium vulgare Y25]
 gi|308752895|gb|ADO44039.1| Superoxide dismutase [Ketogulonicigenium vulgare Y25]
          Length = 227

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 115/203 (56%), Gaps = 7/203 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F LP LPY+ D L P +S +T+E HH  HH+ Y  N     +  +    +  E ++   G
Sbjct: 24  FTLPELPYASDALEPVISAQTMELHHGKHHQAYVTNLNNAIAAGDAPADATLETLVADAG 83

Query: 63  SNAG-LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           +    + NNA  ++NH  FW  M   D +G++   LSDAI   +GS E F++    A + 
Sbjct: 84  TFTPAIRNNAGGHWNHTFFWESMAPADSRGEMSAELSDAITAVYGSDEAFRTAFEEAGAG 143

Query: 122 QFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           QFGSGW WL V  + +LEI+ T N +NPL++       P+LG DVWEHAYYL ++ RR  
Sbjct: 144 QFGSGWVWLIVNADDQLEITSTPNQDNPLMDVAEVQGTPLLGNDVWEHAYYLSYENRRPE 203

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+ +   ++V+W  V +RY  A+
Sbjct: 204 YLTA-WWDVVDWGKVSDRYAEAL 225


>gi|134296728|ref|YP_001120463.1| superoxide dismutase [Burkholderia vietnamiensis G4]
 gi|134139885|gb|ABO55628.1| Superoxide dismutase [Burkholderia vietnamiensis G4]
          Length = 192

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 88/197 (44%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  LG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-SGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|196248749|ref|ZP_03147449.1| Superoxide dismutase [Geobacillus sp. G11MC16]
 gi|196211625|gb|EDY06384.1| Superoxide dismutase [Geobacillus sp. G11MC16]
          Length = 449

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 70/200 (35%), Positives = 96/200 (48%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPYSYD L P++S+E +  HH  HH++Y D   K          +    ++K   
Sbjct: 248 HVLPPLPYSYDALEPHISEEIMRLHHTKHHQSYVDGLNKAERMMAEARRTNNFELLKHWE 307

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
                  N S +Y H +FW  M    G G+    L   I+ +FGSF  F+     AA + 
Sbjct: 308 --REAAFNGSGHYLHTIFWHNMHP-QGGGEPRGELRAQIERDFGSFAAFRRHFTEAAKSV 364

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            G GW  L    +  +LEI +T+  +       IP+L +DVWEHAYYL +K  R  YIE 
Sbjct: 365 EGVGWALLVWVPRAHRLEILQTEKHQLMTQWDTIPLLVLDVWEHAYYLQYKNDRGAYIE- 423

Query: 181 FITNLVNWEYVCERYETAML 200
              N+VNW  V  R+  A  
Sbjct: 424 HWWNVVNWRNVEARFAEARK 443


>gi|138895856|ref|YP_001126309.1| superoxide dismutase [Geobacillus thermodenitrificans NG80-2]
 gi|134267369|gb|ABO67564.1| Superoxide dismutase [Geobacillus thermodenitrificans NG80-2]
          Length = 449

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 70/200 (35%), Positives = 96/200 (48%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPYSYD L P++S+E +  HH  HH++Y D   K          +    ++K   
Sbjct: 248 HVLPPLPYSYDALEPHISEEIMRLHHTKHHQSYVDGLNKAERMMAEARRTNNFELLKHWE 307

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
                  N S +Y H +FW  M    G G+    L   I+ +FGSF  F+     AA + 
Sbjct: 308 --REAAFNGSGHYLHTIFWHNMHP-QGGGEPRGELRAQIERDFGSFAAFRRHFTEAAKSV 364

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            G GW  L    +  +LEI +T+  +       IP+L +DVWEHAYYL +K  R  YIE 
Sbjct: 365 EGVGWALLVWVPRAHRLEILQTEKHQLMTQWDTIPLLVLDVWEHAYYLQYKNDRGAYIE- 423

Query: 181 FITNLVNWEYVCERYETAML 200
              N+VNW  V  R+  A  
Sbjct: 424 HWWNVVNWRNVEARFAEARK 443


>gi|190574739|ref|YP_001972584.1| putative superoxide dismutase [Stenotrophomonas maltophilia K279a]
 gi|190012661|emb|CAQ46289.1| putative superoxide dismutase [Mn] [Stenotrophomonas maltophilia
           K279a]
          Length = 209

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 76/212 (35%), Positives = 109/212 (51%), Gaps = 14/212 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P+    T+E HH  HH+ Y +N       A +    +E +I   
Sbjct: 1   MSYSLPPLPYAYDALEPHFDARTMEIHHSKHHQTYVNNLNAAIEQAGIAEQPVEALIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +  +   G     L+ AID + G F+ FK    
Sbjct: 61  DAVPEAQRGAVRNNGGGHANHSLFWTVLSPH--GGAPDGELAAAIDRDLGGFDAFKDAFT 118

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGA------IPILGIDVWEHAYYLD 169
            AA T+FGSGW WL+     +L++  + N ++PL+  A       PIL +DVWEHAYYL 
Sbjct: 119 KAAQTRFGSGWAWLTSDRDGRLQVESSANQDSPLMGAAVGLSGNTPILALDVWEHAYYLH 178

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           ++ RR  YI +F  N++NW  V  RY  A  +
Sbjct: 179 YQNRRPDYIGAFF-NIINWAEVGRRYRQARAS 209


>gi|298715494|emb|CBJ28064.1| manganese superoxide dismutase [Ectocarpus siliculosus]
          Length = 300

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 115/208 (55%), Gaps = 11/208 (5%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            + LP+LPYSYD L PY+   T+++HHD HH  Y  NA K  +       +   + ++  
Sbjct: 92  PYNLPDLPYSYDALEPYIDAATMKFHHDKHHAAYVGNANKALAGK----TAPSLLDLQKD 147

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
               G+ N    +YNH LFW  +  ++  G     L+ AID+ FGS ++ K+   T A+ 
Sbjct: 148 AIKTGVRNAGGGHYNHCLFWNTLCNHESSGAPSGTLAKAIDEAFGSMDEMKAQFGTTAAG 207

Query: 122 QFGSGWGWL-SVKNGKLEISKTQNAENPLI-----NGAIPILGIDVWEHAYYLDFKYRRA 175
            FGSGW WL    +GKL I+ T N +NPL+        +PILG+DVWEHAYYL ++ RR 
Sbjct: 208 VFGSGWAWLGCTPDGKLAITGTPNQDNPLMEGAAGTAMVPILGLDVWEHAYYLKYQNRRP 267

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQK 203
            YI +F  N+VNW  V E YE      K
Sbjct: 268 EYISAF-WNVVNWAVVSENYEMYASQGK 294


>gi|498260|gb|AAA30655.1| manganous superoxide dismutase [Bos taurus]
          Length = 231

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 35  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYREALEKG--DVTAQIA 92

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF KFK  L   +   
Sbjct: 93  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-QGELLEAIKRDFGSFAKFKEKLTAVSVGV 151

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 152 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 211

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY     
Sbjct: 212 A-IWNVINWENVTARYTACSK 231


>gi|32035144|ref|ZP_00135190.1| COG0605: Superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126207739|ref|YP_001052964.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           L20]
 gi|165975709|ref|YP_001651302.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|303252779|ref|ZP_07338939.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307245064|ref|ZP_07527158.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247236|ref|ZP_07529286.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307249463|ref|ZP_07531452.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307256277|ref|ZP_07538061.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260708|ref|ZP_07542398.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|1399534|gb|AAB03279.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126096531|gb|ABN73359.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875810|gb|ABY68858.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302648340|gb|EFL78536.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854052|gb|EFM86263.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306856294|gb|EFM88447.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306858537|gb|EFM90604.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306865241|gb|EFM97140.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306869629|gb|EFN01416.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 213

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 79/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+YD L P+  K T+E HH  HH+ Y +NA         L        +++
Sbjct: 1   MAYQLPELGYAYDALEPHFDKATMEIHHTKHHQTYVNNANAALEAHPELLEKCPGALIKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS E F+++ 
Sbjct: 61  LSQVPAEKRTAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDAIVRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL V+ GKL +  T N +NP++          PIL +DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVVEGGKLAVVSTANQDNPIMGKEVAGVSGFPILALDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEE 204


>gi|255037950|ref|YP_003088571.1| Superoxide dismutase [Dyadobacter fermentans DSM 18053]
 gi|254950706|gb|ACT95406.1| Superoxide dismutase [Dyadobacter fermentans DSM 18053]
          Length = 201

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L  LPY+ + L P+    T+E HHD HH+ Y  N     +  E+   ++EE++   
Sbjct: 1   MAFTLDPLPYANNALEPHFDALTMEIHHDRHHQAYVTNLNAAVAGTELEGKTIEELLAGI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             + A + NN   ++NH+ FW  +  N G       L  AI   FGSF+ FK +   AA+
Sbjct: 61  SKAPAPVRNNGGGHWNHSFFWKSLSSNGGGEP-TGELGKAITAKFGSFQAFKDEFKKAAT 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
            +FGSGW WL      + I+ T N +NPL++       PI+G+DVWEHAYYL ++ +R  
Sbjct: 120 GRFGSGWAWLIKSGDGVAITSTPNQDNPLMDIAEVKGTPIIGLDVWEHAYYLKYQNKRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           YI+++  N+V+W+     Y  A 
Sbjct: 180 YIDAY-WNVVDWKAADALYTAAK 201


>gi|330813526|ref|YP_004357765.1| superoxide dismutase, iron-dependent [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486621|gb|AEA81026.1| superoxide dismutase, iron-dependent [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 197

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 97/198 (48%), Positives = 132/198 (66%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y  + L+P MS+ETL+ HH  HH+ Y  N      D ++  LSLEEII K+
Sbjct: 1   MTFELPTLNYPKNALAPVMSEETLDLHHGKHHQTYITNLNNFVKDTDLSGLSLEEIISKT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S AG+FNNA Q++NH LFW CMK   G G +P  L   I  +FGS ++FK D I A
Sbjct: 61  AADTSKAGIFNNAGQHWNHILFWNCMKP-KGGGAMPPELEKRIISDFGSVDQFKQDFIQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL++ NGKL ++KT NA NPL++   PI G DVWEH+YY+D++ RR  Y+
Sbjct: 120 GTTQFGSGWAWLAINNGKLVVTKTANASNPLVDNMKPIFGCDVWEHSYYVDYRNRRPDYL 179

Query: 179 ESFITNLVNWEYVCERYE 196
           ++F+ +L NWE+V  + +
Sbjct: 180 KAFVNDLANWEFVASQLD 197


>gi|29466962|dbj|BAC66948.1| chloroplastic iron superoxide dismutase [Marchantia paleacea var.
           diptera]
          Length = 254

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 88/205 (42%), Positives = 129/205 (62%), Gaps = 3/205 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F L + PY  D L P+MSKETLE+H   HH+ Y +N      ++++   +LEEI+  S+ 
Sbjct: 44  FDLKDPPYPLDALEPHMSKETLEFHWGKHHRAYVNNLNGQIENSDLERNTLEEIVQSSYN 103

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA Q +NH+ FW  MK   G       +++ I+ +FGS++ F  +   A +
Sbjct: 104 NGNPTPAFNNAGQIWNHDFFWQSMKPGGGG-PPTGEVAELINRDFGSYDNFVKEFKAAGA 162

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL +KNGKL I KT NA  P++ G+IP+L +DVWEHAYYLDF+ RR  Y+ +
Sbjct: 163 TQFGSGWAWLVLKNGKLAIEKTPNAVTPILWGSIPLLVVDVWEHAYYLDFQNRRPDYLST 222

Query: 181 FITNLVNWEYVCERYETAMLAQKVT 205
           F+ +L++W+ V ER   A  +  ++
Sbjct: 223 FVNDLISWDAVNERLARAKASVNLS 247


>gi|299530632|ref|ZP_07044048.1| manganese and iron superoxide dismutase [Comamonas testosteroni
           S44]
 gi|298721376|gb|EFI62317.1| manganese and iron superoxide dismutase [Comamonas testosteroni
           S44]
          Length = 211

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 116/212 (54%), Gaps = 11/212 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y Y  L P++  +T+E H+  HH+ Y +N       +E     L ++++K 
Sbjct: 1   MSYTLPPLAYDYAALEPHIDAQTMEIHYSRHHQTYVNNLNAALEGSEYAQWPLNDLLVKI 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G    AL+ AID + GSFE FK++  
Sbjct: 61  ESLPQPLRQAVRNNGGGHANHSLFWQVMSP-KGGGLPQGALAAAIDRDLGSFENFKTEFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFK 171
            AA ++FGSGW WLSV    KL +  + N ++PL+     G  PIL +DVWEHAYYL ++
Sbjct: 120 KAAISRFGSGWAWLSVDYSGKLHVESSANQDSPLMPGIGSGNTPILTLDVWEHAYYLKYQ 179

Query: 172 YRRAHYIESFITNLVNWEYVCERYETAMLAQK 203
            RR  YI +F  N+V+W  V  R+ TA  A +
Sbjct: 180 NRRPEYIAAFY-NVVDWNEVARRFATATQAVR 210


>gi|123444307|ref|YP_001008274.1| superoxide dismutase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122091268|emb|CAL14154.1| superoxide dismutase [Mn] [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 207

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGSIDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|264679191|ref|YP_003279098.1| manganese and iron superoxide dismutase [Comamonas testosteroni
           CNB-2]
 gi|262209704|gb|ACY33802.1| manganese and iron superoxide dismutase [Comamonas testosteroni
           CNB-2]
          Length = 211

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 117/212 (55%), Gaps = 11/212 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y Y  L P++  +T+E H+  HH+ Y +N       +E     L ++++K 
Sbjct: 1   MSYTLPPLAYDYAALEPHIDAQTMEIHYSRHHQTYVNNLNAALEGSEYAQWPLNDLLVKI 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  M    G G    AL+ AID + GSFE FK++  
Sbjct: 61  ESLPQPLRQAVRNNGGGHANHSLFWQVMSP-KGGGLPQGALAAAIDRDLGSFENFKTEFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFK 171
            AA ++FGSGW WLSV +  KL +  + N ++PL+     G  PIL +DVWEHAYYL ++
Sbjct: 120 KAAISRFGSGWAWLSVDHSGKLHVESSANQDSPLMPGIGSGNTPILTLDVWEHAYYLKYQ 179

Query: 172 YRRAHYIESFITNLVNWEYVCERYETAMLAQK 203
            RR  YI +F  N+V+W  V  R+ TA  A +
Sbjct: 180 NRRPEYIAAFY-NVVDWNEVARRFATATQAVR 210


>gi|183219454|ref|YP_001837450.1| superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189909599|ref|YP_001961154.1| superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|106879732|emb|CAJ90435.1| superoxide dismutase-[Fe] [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|167774275|gb|ABZ92576.1| Superoxide dismutase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167777876|gb|ABZ96174.1| Superoxide dismutase (Fe) [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 190

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 89/195 (45%), Positives = 119/195 (61%), Gaps = 5/195 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+ KLP LPY+ D L+P++S ETLE+H+  HH+ Y  N   L    E    SLE+I+ KS
Sbjct: 1   MEHKLPELPYAKDALAPHISAETLEFHYGKHHQTYITNLNNLIKGTEFESASLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G      A++D I  +FGSF+ FK     +A 
Sbjct: 61  SG---GIFNNAAQVWNHTFYWHSLSPNGGGAP-KGAVADLITKSFGSFDAFKEKFTQSAV 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           T FGSGW WL  K   LEI  T NA +PL +G   +L IDVWEHAYY+DF+  R  Y+E+
Sbjct: 117 TNFGSGWTWLVKKGDGLEIVNTSNAGSPLKDGMQALLTIDVWEHAYYIDFRNARPKYVEA 176

Query: 181 FITNLVNWEYVCERY 195
           F  NLVNW++  +  
Sbjct: 177 F-WNLVNWDFANKNL 190


>gi|324604965|dbj|BAJ79013.1| Mn-superoxide dismutase [Paralichthys olivaceus]
          Length = 225

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++S E ++ HH  HH  Y +N        +         +     
Sbjct: 29  HTLPDLTYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVA 86

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G G     L +AI+ +FGS +K K  +  A    
Sbjct: 87  LQPALKFNGGGHINHTIFWTNLSPNGGDGP-QGELMEAINRDFGSLQKLKEKMSAATVAV 145

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       +L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 146 QGSGWGWLGYDKESGRLRIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 205

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER + A  
Sbjct: 206 A-IWNVINWENVTERLQIAKK 225


>gi|34496322|ref|NP_900537.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
 gi|34102175|gb|AAQ58542.1| superoxide dismutase [Chromobacterium violaceum ATCC 12472]
          Length = 234

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 85/195 (43%), Positives = 121/195 (62%), Gaps = 3/195 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG-- 62
           LP LPY+ + L P +S  T+ +H+  HHK Y DN  KL +  +   L LE+I+ +S G  
Sbjct: 41  LPPLPYADNALEPVISARTIGFHYGKHHKAYLDNLNKLIAGRDYADLPLEDILTRSFGPA 100

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S+A +FNNA+Q +NH  +W  M+   G G  PQ L + I+ +FGS +  K  L  AA +Q
Sbjct: 101 SDAAVFNNAAQLWNHTFYWRSMRP-KGGGIPPQGLREKIEASFGSVDACKRQLAGAAISQ 159

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL     KL + KT NA+NPL +G  P+L +DVWEHAYYLD++ RRA Y+ + +
Sbjct: 160 FGSGWAWLVQDGDKLRVVKTGNADNPLTSGLTPLLNVDVWEHAYYLDYQNRRADYVNAVL 219

Query: 183 TNLVNWEYVCERYET 197
             L++WE+     + 
Sbjct: 220 DKLIDWEFAQRNLKA 234


>gi|313585711|gb|ADR70997.1| MnSOD [Crassostrea hongkongensis]
          Length = 225

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 101/202 (50%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY Y+ L PY+S + ++ HH  HH+ Y +N        ++     ++ + K 
Sbjct: 27  MKHTLPDLPYDYNALEPYISADIMKLHHTKHHQTYVNNLNIAEE--KLAEAMEKKDVNKI 84

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A +  N   + NH++FW  +    G      AL D I + F +F+  K  L  A+ 
Sbjct: 85  IQLQAAIRFNGGGHLNHSIFWETLSPKGGGEPQDGALKDLILEEFVTFDALKKALTEASV 144

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHY 177
              GSGWGWL        L +    N +  L      P+ GIDVWEHAYYL +K  R  Y
Sbjct: 145 GVQGSGWGWLGYDKAAHSLRVVTCANQDPLLATTGLYPLFGIDVWEHAYYLQYKNVRPDY 204

Query: 178 IESFITNLVNWEYVCERYETAM 199
           + + I ++++W+ V ER++ A+
Sbjct: 205 VNA-IWHIIDWKSVNERFKAAL 225


>gi|254448612|ref|ZP_05062071.1| superoxide dismutase [gamma proteobacterium HTCC5015]
 gi|198261801|gb|EDY86087.1| superoxide dismutase [gamma proteobacterium HTCC5015]
          Length = 193

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 87/198 (43%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P +S ETLE+HH  HH  Y +    +    E  +LSLEEII KS
Sbjct: 1   MSFELPTLPYEKNALEPTISAETLEFHHGKHHAAYVNKLNDMIQGTEFENLSLEEIIQKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FN A+Q +NH  ++  +  N G      AL+DAI+  FGSF++FK+    A +
Sbjct: 61  SG---GMFNQAAQIWNHTFYFTGLSPNGGGEP-TGALADAINAEFGSFDEFKAKFNAAGA 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL      KLEI  T +AE PL NG  P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKNAEGKLEIVNTDDAETPLTNGQTPVITVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
             I N+++W    ER+  
Sbjct: 177 E-IWNIIDWSVAAERFGA 193


>gi|254492459|ref|ZP_05105631.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Methylophaga thiooxidans DMS010]
 gi|224462351|gb|EEF78628.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Methylophaga thiooxydans DMS010]
          Length = 195

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ + L P +S ETLEYH+  HH+ Y +N   L    E    SLE+II  +
Sbjct: 3   MAFELPPLPYAQNALEPTISAETLEYHYGKHHQTYVNNLNNLVPGTEFDGKSLEDIITSA 62

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W CM   D KG     L+ AID  FGSF+ FK +   +A+
Sbjct: 63  SG---GIFNNAAQVWNHTFYWNCMTP-DAKGAPSGELAAAIDSTFGSFDAFKEEFSKSAA 118

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL    +G + I+ T NA  PL +G  P+L +DVWEHAYY+DF+  R  Y+E
Sbjct: 119 TNFGSGWTWLVKNADGSIAIANTSNAGCPLTDGQTPLLTVDVWEHAYYIDFRNARPKYLE 178

Query: 180 SFITNLVNWEYVCERYET 197
           +F   LVNW++V   +  
Sbjct: 179 AF-WGLVNWDFVAANFAA 195


>gi|262369513|ref|ZP_06062841.1| superoxide dismutase [Acinetobacter johnsonii SH046]
 gi|262315581|gb|EEY96620.1| superoxide dismutase [Acinetobacter johnsonii SH046]
          Length = 206

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 118/208 (56%), Gaps = 7/208 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N     +  E   LS+E+++ K 
Sbjct: 1   MAYSLPALPYAYDALEPNIDAKTMEIHHSKHHQTYINNINGAIAGTEWEKLSVEDLVAKV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NNA  + NH+LFW  M    G      A++ AID+  G F+ FK    
Sbjct: 61  NEVPTDLKNMVINNAGGHANHSLFWTVMSPQGGGQP-TGAVAKAIDEQLGGFDAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV   + L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAISRFGSGWAWLSVTPERNLIVESSANQDSPLMHGHTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQK 203
            YI +F  N+V+W  V  RY  A+  + 
Sbjct: 180 EYINAFY-NVVDWNEVNRRYHAALQTKN 206


>gi|303251627|ref|ZP_07337800.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307251780|ref|ZP_07533683.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|302649469|gb|EFL79652.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860781|gb|EFM92791.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 213

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 79/208 (37%), Positives = 114/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+YD L P+  K T+E HH  HH+ Y +NA         L        +++
Sbjct: 1   MAYQLPELGYAYDALEPHFDKATMEIHHTKHHQTYVNNANAALEAHPELLEKCPGALIKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS E F+++ 
Sbjct: 61  LSQVPAEKRTAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDAIVRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL V++GKL +  T N +NP++          PIL +DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVVEDGKLAVVSTANQDNPIMGKEVAGVSGFPILALDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEE 204


>gi|197100007|ref|NP_001127035.1| superoxide dismutase [Mn], mitochondrial [Pongo abelii]
 gi|73620995|sp|Q8HXP6|SODM_PONPY RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
 gi|55733589|emb|CAH93471.1| hypothetical protein [Pongo abelii]
          Length = 222

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|30584207|gb|AAP36352.1| Homo sapiens superoxide dismutase 2, mitochondrial [synthetic
           construct]
 gi|61370084|gb|AAX43435.1| superoxide dismutase 2 mitochondrial [synthetic construct]
 gi|61370092|gb|AAX43436.1| superoxide dismutase 2 mitochondrial [synthetic construct]
          Length = 223

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|226227454|ref|YP_002761560.1| manganese superoxide dismutase [Gemmatimonas aurantiaca T-27]
 gi|226090645|dbj|BAH39090.1| manganese superoxide dismutase [Gemmatimonas aurantiaca T-27]
          Length = 201

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/202 (36%), Positives = 100/202 (49%), Gaps = 7/202 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ + L P++  +T+  HH  HH+ Y  N       A  L     + + + 
Sbjct: 1   MAHTLPALPYAPEALEPHIDAQTMNIHHGKHHQAYVTNLNAAIEKAPELASWSLDDLCRR 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   ++NH+LFW  M    G       L  AI   FGSF  FK   
Sbjct: 61  INEVPEAVRTAVRNNGGGHWNHSLFWELMAPKAGGEP-TGELGAAITKAFGSFSAFKEQF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             A   +FGSGW WL   +G L I  T N +NPL+ G   +LG+DVWEHAYYL ++ RRA
Sbjct: 120 QAAGMGRFGSGWAWLVSTDGALSIVSTPNQDNPLMEGKHALLGVDVWEHAYYLHYQNRRA 179

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +   N+VNW  V +RY  
Sbjct: 180 DYLGA-WWNVVNWSAVAKRYAA 200


>gi|281348210|gb|EFB23794.1| hypothetical protein PANDA_014884 [Ailuropoda melanoleuca]
          Length = 214

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 105/201 (52%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N   +              I     
Sbjct: 18  HSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNAIEEKYLEALEKG--DITAQVA 75

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              GL  N   + NH++FW  +    G G+    L +AI  +FGSFEKFK  L T +   
Sbjct: 76  LQPGLKFNGGGHINHSIFWTNLSP-KGGGEPKGELLEAIKRDFGSFEKFKEKLTTVSVGV 134

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 135 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 194

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 195 A-IWNVINWENVTERYMAGKK 214


>gi|209966488|ref|YP_002299403.1| superoxide dismutase (Mn) [Rhodospirillum centenum SW]
 gi|209959954|gb|ACJ00591.1| superoxide dismutase (Mn) [Rhodospirillum centenum SW]
          Length = 260

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 109/209 (52%), Gaps = 8/209 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK- 59
            F LP LPY    L P++   T+  HH  HH+ Y  N    LA  +++  LSL +++ + 
Sbjct: 54  PFTLPELPYDVTALEPHIDARTMGLHHGKHHQAYVTNLNNALAEHSQLHGLSLTDLLKRL 113

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                G    + NN   + NH++FW  M  N G      A+ +AI  +FG+FE FK    
Sbjct: 114 GELPEGIRTAVRNNGGGHANHSMFWTIMGPNGGGEP-TGAVGEAIARDFGAFEDFKKTFN 172

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A + QFGSGW +++V    +LEI    N + PL++G   ++G DVWEHAYYL ++ RRA
Sbjct: 173 EAGTKQFGSGWVFVTVDPAGRLEIVARPNQDTPLMDGRPVLMGNDVWEHAYYLTYQNRRA 232

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQKV 204
            Y+ +   N VNW  V +R         +
Sbjct: 233 DYLAA-WWNTVNWGAVNQRLSAIRNGSVL 260


>gi|62182516|ref|YP_218933.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62130149|gb|AAX67852.1| superoxide dismutase, manganese [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 206

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+  HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMAIHHTKHHQTYVNNANAALENLPEFADLPVEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAA 204


>gi|167464819|ref|ZP_02329908.1| superoxide dismutase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 204

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 85/206 (41%), Positives = 115/206 (55%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP LPY+ + L P++ + T+  HHD HH  Y  N        + L     E +I  
Sbjct: 1   MAYQLPALPYANNALEPHIDETTMMIHHDRHHNTYVTNLNAALEGHDNLSSKSVEDLISD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  N G GK   AL+ AID   G FEKFK D 
Sbjct: 61  LNSVPENIRTAVRNNGGGHANHSLFWKLLSPN-GGGKPAGALAQAIDQELGGFEKFKEDF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA+T+FGSGW WLSV    KL +  T N +NPL+ G  P+LGIDVWEHAYYL ++ +R
Sbjct: 120 AKAATTRFGSGWAWLSVDKAGKLVVHSTGNQDNPLMEGLTPVLGIDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N++NW+   ++YE A  
Sbjct: 180 PDYIAAF-WNVINWDEANKQYEAAKK 204


>gi|255536504|ref|YP_003096875.1| Manganese superoxide dismutase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342700|gb|ACU08813.1| Manganese superoxide dismutase [Flavobacteriaceae bacterium
           3519-10]
          Length = 208

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 80/202 (39%), Positives = 114/202 (56%), Gaps = 9/202 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +  +T+E HH  HH+ Y DN  K     E+   S  E I K+
Sbjct: 11  MAFELPKLGYAYDALEPIIDAKTMEIHHTKHHQAYIDNLNKAIEGTELEGKS-IEEICKT 69

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + NN   ++NH+LFW  +     K  V      A  + +G F+KFK+D   AA 
Sbjct: 70  GVDKAAVRNNGGGHFNHSLFWDILTPGGSKEPVGN--VKAALETYGGFDKFKTDFAEAAK 127

Query: 121 TQFGSGWGWLS-VKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL   ++G + +  T N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 128 TRFGSGWAWLCKTQDGSVAVCSTANQDNPLMPIVDVQETPILGLDVWEHAYYLNYQNRRP 187

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F   ++NW+ V ER+  
Sbjct: 188 DYVSAFF-EVINWDKVEERFNK 208


>gi|45861254|gb|AAS78509.1| superoxide dismutase [Staphylococcus xylosus]
          Length = 197

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 79/201 (39%), Positives = 110/201 (54%), Gaps = 8/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           F+LPNLP+ +D L P++ ++T+E HH  HH  Y           ++   S+EEI+     
Sbjct: 1   FELPNLPFGFDALEPHIDQQTMEIHHGKHHNTYVTKLNAAVEGTDLESKSIEEIVANLDS 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH+LFW  +  N  +        D I + +GS + FK +    
Sbjct: 61  VPENIQTAVRNNGGGHLNHSLFWELLTPNSEEKGTVV---DKIKEQWGSLDAFKEEFADK 117

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+ +FGSGW WL V NG LEI  T N +NP+  G  PILG+DVWEHAYYL ++ +R  YI
Sbjct: 118 AAARFGSGWAWLVVNNGNLEIVTTPNQDNPITEGKTPILGLDVWEHAYYLKYQNKRPDYI 177

Query: 179 ESFITNLVNWEYVCERYETAM 199
            +F  N+VNWE V E Y  A 
Sbjct: 178 SAF-WNVVNWEKVDELYNAAK 197


>gi|167590713|ref|ZP_02383101.1| superoxide dismutase [Burkholderia ubonensis Bu]
          Length = 192

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +S+ET++YH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|50084269|ref|YP_045779.1| superoxide dismutase [Acinetobacter sp. ADP1]
 gi|6685985|sp|Q59094|SODM_ACIAD RecName: Full=Superoxide dismutase [Mn]; Flags: Precursor
 gi|1359472|emb|CAA86923.1| superoxide dismutase (Fe/Mn family) [Acinetobacter sp. ADP1]
 gi|49530245|emb|CAG67957.1| superoxide dismutase [Mn] [Acinetobacter sp. ADP1]
          Length = 228

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 112/205 (54%), Gaps = 7/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKS 60
           +FK   LPY+ + L P + ++T+E H+  HHK Y DN         E+    L ++  + 
Sbjct: 24  EFKQAPLPYATNALQPAIDQQTMEIHYGKHHKAYVDNLNAQIKTYPELDKTDLIQLQKQI 83

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  + NN   ++NH  FW  +   +  G+   AL   I  +FGS + FK     AAS
Sbjct: 84  SKYNTAVRNNGGGHFNHTFFWESLAATNKTGQPSPALVKQITQDFGSLDAFKQKFNEAAS 143

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRA 175
            +FGSGW WL V    KL ++ T N +NPL+        P+LG+DVWEHAYYL ++ RRA
Sbjct: 144 GRFGSGWAWLIVTPNGKLAVTSTPNQDNPLMDLSETKGTPLLGLDVWEHAYYLKYQNRRA 203

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI++F  ++VNW  V ERY  A+ 
Sbjct: 204 DYIKAF-WSVVNWNKVNERYNEAIK 227


>gi|15551671|emb|CAC69393.1| manganese superoxide dismutase. [Erwinia chrysanthemi]
          Length = 213

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 83/212 (39%), Positives = 117/212 (55%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 6   MSYSLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLPEFAGLSAEELITK 65

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 66  LDQLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLTGELKAAIERDFGSVDAFKEKF 122

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+ +DVWEHAYYL
Sbjct: 123 EQAAATRFGSGWAWLVLKDDGKLAVVSTPNQDSPLMGEAISGASGYPIVALDVWEHAYYL 182

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F   +VNW+   +R+  A  
Sbjct: 183 QYQNRRPDYIKAFWF-VVNWDEAAKRFAEAKK 213


>gi|67782305|ref|NP_000627.2| superoxide dismutase [Mn], mitochondrial isoform A precursor [Homo
           sapiens]
 gi|67782307|ref|NP_001019636.1| superoxide dismutase [Mn], mitochondrial isoform A precursor [Homo
           sapiens]
 gi|15214595|gb|AAH12423.1| Superoxide dismutase 2, mitochondrial [Homo sapiens]
 gi|30016937|gb|AAP03428.1| superoxide dismutase 2, mitochondrial [Homo sapiens]
 gi|30582773|gb|AAP35613.1| superoxide dismutase 2, mitochondrial [Homo sapiens]
 gi|56204992|emb|CAI21845.1| superoxide dismutase 2, mitochondrial [Homo sapiens]
 gi|61360280|gb|AAX41837.1| superoxide dismutase 2 mitochondrial [synthetic construct]
 gi|61360285|gb|AAX41838.1| superoxide dismutase 2 mitochondrial [synthetic construct]
 gi|117644438|emb|CAL37714.1| hypothetical protein [synthetic construct]
 gi|119568015|gb|EAW47630.1| superoxide dismutase 2, mitochondrial, isoform CRA_b [Homo sapiens]
 gi|119568016|gb|EAW47631.1| superoxide dismutase 2, mitochondrial, isoform CRA_b [Homo sapiens]
 gi|123994153|gb|ABM84678.1| superoxide dismutase 2, mitochondrial [synthetic construct]
 gi|124126863|gb|ABM92204.1| superoxide dismutase 2, mitochondrial [synthetic construct]
 gi|189053656|dbj|BAG35908.1| unnamed protein product [Homo sapiens]
 gi|261860798|dbj|BAI46921.1| mitochondrial superoxide dismutase 2 [synthetic construct]
          Length = 222

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|313679842|ref|YP_004057581.1| superoxide dismutase [Oceanithermus profundus DSM 14977]
 gi|313152557|gb|ADR36408.1| Superoxide dismutase [Oceanithermus profundus DSM 14977]
          Length = 206

 Score =  201 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 114/205 (55%), Gaps = 8/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS- 60
            F+LP+L Y+YD L P++   T+E HH  HH  Y +N  K       LH +  E ++   
Sbjct: 4   PFELPDLGYAYDALEPHIDARTMEIHHTKHHGGYVNNLNKALEGHAFLHGAGLEELLTHL 63

Query: 61  ----HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +            L+ AI+D FGSF+ FK    
Sbjct: 64  SALPAEIQTAVRNNGGGHLNHSLFWEVIAPGGAHAP-SGELAWAIEDAFGSFDAFKDVFA 122

Query: 117 TAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA+T+FGSGW WL++   G+L +  T N +NP++ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 123 KAAATRFGSGWAWLALDPWGRLHVLSTPNQDNPVMQGLTPILGLDVWEHAYYLKYQNRRP 182

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VN++ V E++  A  
Sbjct: 183 DYIAAF-WNVVNFDVVGEKFAAARR 206


>gi|285028840|gb|ADC34695.1| Mn-superoxide dismutase [Tegillarca granosa]
          Length = 227

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y+ L PY+S + ++ HH  HH+ Y +N                + I +   
Sbjct: 29  HTLPDLPYDYNALEPYISADIMKLHHQKHHQTYVNNLNAAEEQLAEAMHK--DNINQIIK 86

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L   I  +FGSF++ K +L       
Sbjct: 87  LQPVLKFNGGGHINHSIFWEVLSPNGGGEP-TGDLMHIITRDFGSFDRMKEELTNVTVAI 145

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       +L ++   N +      G IP+ GIDVWEHAYYL +K  R  Y++
Sbjct: 146 QGSGWGWLGYNPNSFRLRVAALPNQDPLQPTTGLIPLFGIDVWEHAYYLQYKNVRPDYVK 205

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+VNW  V ER   A  
Sbjct: 206 A-IWNIVNWNAVSERLAAAKQ 225


>gi|115372548|ref|ZP_01459856.1| superoxide dismutase (Fe) [Stigmatella aurantiaca DW4/3-1]
 gi|310819120|ref|YP_003951478.1| superoxide dismutase, fe [Stigmatella aurantiaca DW4/3-1]
 gi|115370510|gb|EAU69437.1| superoxide dismutase (Fe) [Stigmatella aurantiaca DW4/3-1]
 gi|309392192|gb|ADO69651.1| Superoxide dismutase, Fe [Stigmatella aurantiaca DW4/3-1]
          Length = 194

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 123/197 (62%), Gaps = 4/197 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY  D L+P+MS ETL+YHH  HH  Y +   +L +       SL +II+ S
Sbjct: 1   MPFMLPELPYPKDALAPHMSAETLDYHHGKHHATYVNKLNELLAGKPEADKSLVDIILSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    +FNNA+Q +NH  FW CMK + G       L+DAI+ +FGS++ FK     AA+
Sbjct: 61  DG---PVFNNAAQVWNHTFFWHCMKPSGGGAP-AGELADAINRDFGSYDNFKKAFSEAAT 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL     KL + KT NA+ P+ +G   +L IDVWEHAYY+D++  R  +IE+
Sbjct: 117 TQFGSGWAWLVQDGSKLAVMKTANADLPMKHGKKALLTIDVWEHAYYIDYRNARPKFIET 176

Query: 181 FITNLVNWEYVCERYET 197
           F+T+LVNW++V    + 
Sbjct: 177 FLTSLVNWDFVAGNLKN 193


>gi|307254019|ref|ZP_07535867.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307258474|ref|ZP_07540212.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306863045|gb|EFM94991.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306867479|gb|EFM99329.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 213

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 112/208 (53%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+YD L P+  K T+E HH  HH+ Y +NA         L        +++
Sbjct: 1   MAYQLPELGYAYDALEPHFDKATMEIHHTKHHQTYVNNANAALEAHPELLEKCPGALIKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS E F+++ 
Sbjct: 61  LSQVPAEKRTAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDAIVRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
              A+T+FGSGW WL V+ GKL +  T N +NP++          PIL +DVWEHAYYL 
Sbjct: 118 EKTAATRFGSGWAWLVVEGGKLAVVSTANQDNPIMGKEVAGVSGFPILALDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEE 204


>gi|312795276|ref|YP_004028198.1| Superoxide dismutase [Burkholderia rhizoxinica HKI 454]
 gi|312167051|emb|CBW74054.1| Superoxide dismutase (EC 1.15.1.1) [Burkholderia rhizoxinica HKI
           454]
          Length = 213

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 81/197 (41%), Positives = 118/197 (59%), Gaps = 7/197 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M    LP LP++ + L+P++S+ETLE+H+  HH+ Y  N   L    E  +LSLEEI+ +
Sbjct: 20  MAQHTLPPLPFAKNALAPHISEETLEFHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKR 79

Query: 60  SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           S G   G+FNNA+Q +NH  FW  +    G       L DAI+  +GS++ FK      A
Sbjct: 80  SSG---GIFNNAAQVWNHTFFWNSLSPQGGGAP-TGKLGDAINAKWGSYDAFKEAFTKVA 135

Query: 120 STQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
              FGSGW WL  K +G L+I  T NA  PL   A P+L +DVWEHAYY+D++  R  ++
Sbjct: 136 IGTFGSGWAWLVKKADGSLDIVSTSNAATPLTTDATPLLTLDVWEHAYYIDYRNARPKFV 195

Query: 179 ESFITNLVNWEYVCERY 195
           ++F  N+VNW++  + +
Sbjct: 196 DAF-WNVVNWDFAAKNF 211


>gi|54020900|ref|NP_001005694.1| superoxide dismutase 2, mitochondrial [Xenopus (Silurana)
           tropicalis]
 gi|49670623|gb|AAH75257.1| superoxide dismutase 2, mitochondrial [Xenopus (Silurana)
           tropicalis]
 gi|89268255|emb|CAJ81602.1| superoxide dismutase 2, mitochondrial [Xenopus (Silurana)
           tropicalis]
          Length = 224

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 104/201 (51%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N     ++ +      +  +     
Sbjct: 28  HTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLN--ITEEKYAEALAKGDVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
             A L  N   + NH +FW  +  N G       L DAI  +FGSFEKFK  L T +   
Sbjct: 86  LQAALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLDAIKRDFGSFEKFKEKLSTVSVGV 144

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       +L+++   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKESNRLQLAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYMK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY  +  
Sbjct: 205 A-IWNVINWENVAERYRASKK 224


>gi|36518|emb|CAA30687.1| unnamed protein product [Homo sapiens]
          Length = 222

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKLDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|23200074|pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic
           Portion Of A Cyanobacterial Membrane-Bound Manganese
           Superoxide Dismutase
 gi|23200075|pdb|1GV3|B Chain B, The 2.0 Angstrom Resolution Structure Of The Catalytic
           Portion Of A Cyanobacterial Membrane-Bound Manganese
           Superoxide Dismutase
          Length = 248

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 106/206 (51%), Gaps = 8/206 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK---- 59
           +LP LPY YD L   +  ET++ HHD HH  Y +N          L  S  E +++    
Sbjct: 39  ELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNS 98

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH +FW  M   DG G+    ++  I+  FGSFE+FK     A
Sbjct: 99  VPEDIRTTVRNNGGGHLNHTIFWQIMSP-DGGGQPTGDIAQEINQTFGSFEEFKKQFNQA 157

Query: 119 ASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
              +FGSGW WL      +L++  T N +NP++ G+ PI+G DVWEHAYYL ++ RR  Y
Sbjct: 158 GGDRFGSGWVWLVRNPQGQLQVVSTPNQDNPIMEGSYPIMGNDVWEHAYYLRYQNRRPEY 217

Query: 178 IESFITNLVNWEYVCERYETAMLAQK 203
           + +   N+VNW  +  R + +  +  
Sbjct: 218 LNN-WWNVVNWSEINRRTQASRQSNS 242


>gi|226952758|ref|ZP_03823222.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
 gi|226836497|gb|EEH68880.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
          Length = 227

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKSH 61
           F    LPY  D L P + ++T+E H+  HHK Y DN         E+  L++E+I  +  
Sbjct: 25  FTQAPLPYKSDALEPAIDQQTMEIHYGKHHKAYVDNLNAQIKTYPELDKLNIEQIQQQIS 84

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
             NA + NN   ++NH  FW  +   D  GKV   L   I+ +FGSF+ F+     AA++
Sbjct: 85  KYNAAVRNNGGGHFNHAFFWESLAPTDRTGKVSLKLLKKINQDFGSFKAFQEQFNQAATS 144

Query: 122 QFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           +FGSGW WL V    KLEI+ T N +NPL++       P+LG+DVWEHAYYL ++ RRA 
Sbjct: 145 RFGSGWAWLIVNPQGKLEITSTPNQDNPLMDIAEKKGQPLLGLDVWEHAYYLKYQNRRAD 204

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           Y  +F  ++VNW  V +RY+ A  
Sbjct: 205 YTNAF-WSVVNWNKVNDRYQKASK 227


>gi|188026470|ref|ZP_02962197.2| hypothetical protein PROSTU_04296 [Providencia stuartii ATCC 25827]
 gi|188019806|gb|EDU57846.1| hypothetical protein PROSTU_04296 [Providencia stuartii ATCC 25827]
          Length = 224

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 114/209 (54%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P+  K+T+E HH  HH+ Y +N          L     + +I+ 
Sbjct: 17  MSYTLPALPYAYDALEPHFDKQTMEIHHTKHHQTYVNNTNTALEKLPELANLDIDDLIQQ 76

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K      ++   L  AI+ +FGS + FK   
Sbjct: 77  LDKVPADQRTFVRNNAGGHSNHSLFWKGLK---LGTELSGDLKAAIERDFGSVDAFKEQF 133

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+++FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 134 EKAAASRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIIGLDVWEHAYYL 193

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            ++ RR  YI++F  ++VNW+   +R+  
Sbjct: 194 KYQNRRPDYIKAF-WSVVNWDEAAKRFAE 221


>gi|145300589|ref|YP_001143430.1| iron/manganese superoxide dismutase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|32492801|gb|AAP85516.1| SodA [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853361|gb|ABO91682.1| iron/manganese superoxide dismutase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 204

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 108/206 (52%), Gaps = 8/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+L Y+YD L P++   T+E HH  HH+ Y  N          L     + ++  
Sbjct: 1   MSHTLPDLSYAYDALEPHIDALTMEIHHSRHHQTYITNLNVALEAFPELAALPVDELLAR 60

Query: 61  HGS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
             S        + N+   + NH+LFW  M    G  +    L++AI  + G  + FK   
Sbjct: 61  FDSLPVKVQGAVRNHGGGHANHSLFWQVMSP-QGGSEPTGELAEAIRRDLGGLDAFKQAF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA ++FGSGW WL V    KL++  + N ++PL+ G  PILG+DVWEHAYYL ++ +R
Sbjct: 120 TQAALSRFGSGWAWLVVDKEGKLQVESSANQDSPLMQGHAPILGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAML 200
             YI +F  N+++W+ V  RY  A+ 
Sbjct: 180 PDYIAAFY-NVIDWDEVERRYRQALA 204


>gi|308275172|emb|CBX31769.1| Superoxide dismutase [Fe] [uncultured Desulfobacterium sp.]
          Length = 245

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 92/196 (46%), Positives = 123/196 (62%), Gaps = 3/196 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS- 60
            FKLP LPY  D LSPY+S  T+++H+  HH+ Y D       + E    SLEEII K+ 
Sbjct: 48  PFKLPPLPYGNDALSPYISANTIKFHYGKHHQGYIDKINSFIQNTEFAKYSLEEIIKKTA 107

Query: 61  -HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
               +  +FNNA+Q +NH  +W  MK  +G G    AL+  +D +FGS EKFK     AA
Sbjct: 108 TIKDHIAIFNNAAQAWNHGFYWKSMKP-EGGGAPTGALAKKLDADFGSLEKFKKAFGDAA 166

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           +TQFGSGW WL    G L + KT NA+ PL +G +PIL IDVWEHAYYLD++ RR  YI 
Sbjct: 167 ATQFGSGWAWLVADRGNLAVVKTSNADTPLAHGQVPILTIDVWEHAYYLDYQNRRTDYIA 226

Query: 180 SFITNLVNWEYVCERY 195
           +F+ +LVNW++  + +
Sbjct: 227 AFLDHLVNWDFAEKNF 242


>gi|268680516|ref|YP_003304947.1| superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
 gi|268618547|gb|ACZ12912.1| Superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
          Length = 232

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 117/205 (57%), Gaps = 7/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKS 60
            F L  LPY YD L P + KET++ HH  HH+ Y  N     +   E+  +S+E+I+   
Sbjct: 29  AFSLAPLPYGYDALEPVIDKETMQIHHGKHHQAYVSNLNAQVATYPELKGMSVEQIMASI 88

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              NA + NN   +YNH LFW  M      G    +LS AI+ +FGS EK K     A +
Sbjct: 89  SKYNAAVRNNGGGHYNHALFWKLMAPVGKGGTPSASLSKAIERDFGSLEKMKEAFEKAGA 148

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW W+ V  + KL ++ T N +NPL++      +PIL  DVWEHAYYL ++ +RA
Sbjct: 149 TRFGSGWAWVIVTADKKLAVTSTPNQDNPLMDVTEAKGMPILAADVWEHAYYLKYQNKRA 208

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+++   ++VNW  V  R++ AM 
Sbjct: 209 DYLKN-WWSVVNWNEVNARFDAAMK 232


>gi|34711|emb|CAA68533.1| unnamed protein product [Homo sapiens]
          Length = 222

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKQRGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|322717014|gb|EFZ08585.1| manganese superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 210

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+  HH  HH+ Y +NA     +  E   L +EE+I K
Sbjct: 5   MSYTLPSLPYAYDALEPHFDKQTMAIHHTKHHQTYVNNANAALENLPEFADLPVEELITK 64

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 65  LDQVPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 121

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 122 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 181

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           F+ RR  YI+ F  N+VNW+    R+  
Sbjct: 182 FQNRRPDYIKEF-WNVVNWDEAAARFAA 208


>gi|254360578|ref|ZP_04976727.1| superoxide dismutase [Mannheimia haemolytica PHL213]
 gi|261493403|ref|ZP_05989929.1| Superoxide dismutase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496668|ref|ZP_05993048.1| Superoxide dismutase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|2500830|sp|Q59679|SODM_PASHA RecName: Full=Superoxide dismutase [Mn]
 gi|1161158|gb|AAA85362.1| superoxide dismutase [Mannheimia haemolytica serotype 1]
 gi|153091118|gb|EDN73123.1| superoxide dismutase [Mannheimia haemolytica PHL213]
 gi|261307871|gb|EEY09194.1| Superoxide dismutase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311047|gb|EEY12224.1| Superoxide dismutase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 213

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA         L        +++
Sbjct: 1   MAYTLPELGYAYDALEPHFDAKTMEIHHSKHHQAYINNANAALEAHPELLEKCPGALIKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL +AI+ +FGS E F+S+ 
Sbjct: 61  LSQVPAEKRIAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKEAIERDFGSVEAFQSEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+ GSGW WL ++ GKL +  T N +NPL+          PIL +DVWEHAYYL+
Sbjct: 118 EKAATTRVGSGWAWLVLEEGKLAVVSTANQDNPLMGKEVAGVSGYPILVLDVWEHAYYLN 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  +I++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDFIKAF-WNVVNWDEAARRFEE 204


>gi|224048090|ref|XP_002189327.1| PREDICTED: putative mitochondrial superoxide dismutase 2 variant 1
           isoform 1 [Taeniopygia guttata]
 gi|197128243|gb|ACH44741.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
 gi|197128244|gb|ACH44742.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
 gi|197128246|gb|ACH44744.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
 gi|197128248|gb|ACH44746.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
 gi|197129937|gb|ACH46435.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
          Length = 224

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 28  HTLPDLPYDYGALEPHINAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKG--DVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF  FK  L   +   
Sbjct: 86  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 144

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY T   
Sbjct: 205 A-IWNVINWENVSSRYATCKK 224


>gi|81299612|ref|YP_399820.1| superoxide dismutase [Synechococcus elongatus PCC 7942]
 gi|81168493|gb|ABB56833.1| Superoxide dismutase [Synechococcus elongatus PCC 7942]
          Length = 229

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 92/192 (47%), Positives = 127/192 (66%), Gaps = 3/192 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LP+ Y  L+PY++KETLE+HHD HH  Y +N      D ++    +E +I   
Sbjct: 29  MSYELPALPFDYTALAPYITKETLEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAI 88

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AGLFNNA+Q +NH+ +W  +K N G      AL+D I  +FGSFE F ++   A
Sbjct: 89  AGDASKAGLFNNAAQAWNHSFYWNSIKPNGGGAP-TGALADKIAADFGSFENFVTEFKQA 147

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL + NG L+I+KT NA+ P+ +G  P+L IDVWEHAYYLD++ RR  YI
Sbjct: 148 AATQFGSGWAWLVLDNGTLKITKTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYI 207

Query: 179 ESFITNLVNWEY 190
            +F+  L NW++
Sbjct: 208 STFVEKLANWDF 219


>gi|12084342|pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
 gi|12084343|pdb|1DT0|B Chain B, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
 gi|12084344|pdb|1DT0|C Chain C, Cloning, Sequence, And Crystallographic Structure Of
           Recombinant Iron Superoxide Dismutase From Pseudomonas
           Ovalis
          Length = 197

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 93/196 (47%), Positives = 123/196 (62%), Gaps = 6/196 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F+LP LPY++D L P++SKETLE+HHD HH  Y  N   L    E    +LEEI+  S 
Sbjct: 1   AFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSS 60

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
           G   G+FNNA+Q +NH  +W C+  N G      AL+DAI+  FGSF+KFK +    +  
Sbjct: 61  G---GIFNNAAQVWNHTFYWNCLSPNAGGQP-TGALADAINAAFGSFDKFKEEFTKTSVG 116

Query: 122 QFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            FGSGWGWL  K +G L ++ T  A  PL  G  P+L  DVWEHAYY+D++  R  Y+E+
Sbjct: 117 TFGSGWGWLVKKADGSLALASTIGAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEA 176

Query: 181 FITNLVNWEYVCERYE 196
           F  NLVNW +V E++E
Sbjct: 177 F-WNLVNWAFVAEQFE 191


>gi|315633716|ref|ZP_07889006.1| superoxide dismutase [Aggregatibacter segnis ATCC 33393]
 gi|315477758|gb|EFU68500.1| superoxide dismutase [Aggregatibacter segnis ATCC 33393]
          Length = 214

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 85/215 (39%), Positives = 121/215 (56%), Gaps = 18/215 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA  +  ++  L         K 
Sbjct: 1   MAYTLPELGYAYDALEPHFDAQTMEIHHTKHHQAYVNNANAVLENSPELQELASGCPGKL 60

Query: 60  -------SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFK 112
                  +      L NNA  + NH+LFW  +KK      +  AL DAI+ +FGS E FK
Sbjct: 61  LAHLHEVAPEKRPALRNNAGGHLNHSLFWKSLKK---GTTLQGALKDAIERDFGSVENFK 117

Query: 113 SDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAY 166
           ++   AA+T+FGSGW WL ++NGKL +  T N +NP++          PI G+DVWEHAY
Sbjct: 118 AEFEKAAATRFGSGWAWLVLENGKLAVVSTANQDNPIMGKEFAGCSGTPIFGLDVWEHAY 177

Query: 167 YLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           YL F+ RR  YI+ F  N++NW++  ER+E A+  
Sbjct: 178 YLKFQNRRPDYIKEF-WNVLNWDFANERFEKALAG 211


>gi|318041596|ref|ZP_07973552.1| superoxidase dismutase [Synechococcus sp. CB0101]
          Length = 241

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 74/205 (36%), Positives = 110/205 (53%), Gaps = 8/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKS 60
           +F LP LPY+ D L P +   T+  HHD HH  Y  N       + ++  LSL+ +  + 
Sbjct: 38  EFTLPPLPYAPDALEPAIDATTMTIHHDKHHGAYVANLNGQIKGNPQLAKLSLDALQGQI 97

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH+ FWA M      G     L  AI+ +FGS +  ++    AA+
Sbjct: 98  SRFPVAVRNNGGGHWNHSQFWAVMAPAGEGGAPSPELLAAIEASFGSLQAMQTQFSQAAA 157

Query: 121 TQFGSGWGWL-SVKNGKLEISKTQNAENPLIN-----GAIPILGIDVWEHAYYLDFKYRR 174
            +FGSGW WL    +G L I+ T N +NPL++        P+LG+DVWEHAYYL+++ RR
Sbjct: 158 ARFGSGWAWLIRTPDGGLAITSTANQDNPLMDLPEIERGTPLLGLDVWEHAYYLNYQNRR 217

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +   +LVNW  V  R+  ++
Sbjct: 218 PDYISA-WWDLVNWNEVNRRFSASV 241


>gi|146263084|gb|ABQ15312.1| SodA [Yersinia aldovae]
          Length = 207

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LDTTLTGDLKAAIERDFGSVDSFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|50084526|ref|YP_046036.1| superoxide dismutase [Acinetobacter sp. ADP1]
 gi|49530502|emb|CAG68214.1| superoxide dismutase [Fe] [Acinetobacter sp. ADP1]
          Length = 208

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 100/199 (50%), Positives = 129/199 (64%), Gaps = 5/199 (2%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
              LP LPY+YD L P++SKETLEYHHD HH+ Y  N   L    E+    LE+II  S 
Sbjct: 3   TITLPALPYAYDALEPHISKETLEYHHDKHHQTYVTNLNNLIKGTELEGQELEDIIKASA 62

Query: 62  G--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           G  S AG+FNNA+Q +NH  +W  +  N G GK   AL+  ID+ FGS+EKF  +  TAA
Sbjct: 63  GDSSKAGIFNNAAQVWNHTFYWNSIAPN-GGGKPTGALAAKIDEAFGSYEKFAEEFTTAA 121

Query: 120 STQFGSGWGWLSVK--NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           +TQFGSGW WL     NGKL I+KT NA+ PL +G + +L IDVWEHAYY+D++  R  Y
Sbjct: 122 TTQFGSGWAWLVADEINGKLSITKTSNADTPLAHGQVAVLTIDVWEHAYYIDYRNARPKY 181

Query: 178 IESFITNLVNWEYVCERYE 196
           I +F+ +LVNW+Y   +  
Sbjct: 182 ISTFLESLVNWDYANAKLA 200


>gi|88707070|ref|ZP_01104766.1| Superoxide dismutase (Fe) [Congregibacter litoralis KT71]
 gi|88698720|gb|EAQ95843.1| Superoxide dismutase (Fe) [Congregibacter litoralis KT71]
          Length = 192

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 86/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY  + L P++S ETLEYH+  HHK Y D    + +   M   SLE++I +S
Sbjct: 1   MAFELPALPYEQNALEPHISAETLEYHYGKHHKTYVDKLNGMVAGTAMESASLEDVIRQS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L++AI+  FGSF+KFK +   AA+
Sbjct: 61  EG---GMFNNAAQVWNHTFYWNCLSPNGGGEP-TGKLAEAINAAFGSFDKFKEEFSAAAA 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL       + IS T NA  P+     P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVQNTDGSVAISNTSNAGCPVTEDVTPLLTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNW++V     
Sbjct: 177 AF-WNLVNWDFVSGNMA 192


>gi|330816307|ref|YP_004360012.1| putative superoxide dismutase [Burkholderia gladioli BSR3]
 gi|327368700|gb|AEA60056.1| putative superoxide dismutase [Burkholderia gladioli BSR3]
          Length = 206

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 82/206 (39%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P++  +T+E H+  HH+ Y +N       A +    +EE++   
Sbjct: 1   MPYALPPLPYAYDALEPHIDAQTMEIHYTRHHQTYVNNVNAALEGAGLPFPPIEELVAGI 60

Query: 61  HGS----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +    G G+    L  AID + GSF+ FK    
Sbjct: 61  ESLPEAVRGAVRNNGGGHANHSLFWR-VMTPGGGGQPQGRLGTAIDADLGSFDSFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    KL +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVSPQKKLVVESSGNQDSPLMHGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            YI +F   ++NW  V  RYE A+ A
Sbjct: 180 EYIAAFY-QVINWPEVARRYEAALAA 204


>gi|50593186|gb|AAT79387.1| Mn-SOD [Paragonimus westermani]
          Length = 222

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 103/199 (51%), Gaps = 7/199 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY YD L P +S E +  HH  HH  Y +N   +    ++     +        
Sbjct: 26  HTLPDLPYDYDALEPTISAEIMRLHHSKHHATYVNNLNVIEE--KIAEAQSKNDTSSIIS 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +    G      +L++AI+ +FGSFE+FK+ L TA    
Sbjct: 84  LQPALRFNGGGHINHSIFWKNLSPKGGGAP-SGSLANAINRDFGSFEEFKTQLSTATIAI 142

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWLS      +L+I   QN +      G  P+LGIDVWEHAYYL +K  RA Y++
Sbjct: 143 QGSGWGWLSYNPVTKRLQIVTCQNQDPLEATTGLKPLLGIDVWEHAYYLQYKNARADYVK 202

Query: 180 SFITNLVNWEYVCERYETA 198
           + I  L+NW  V ER   A
Sbjct: 203 A-IWKLINWSDVSERLSCA 220


>gi|271498643|ref|YP_003331668.1| Superoxide dismutase [Dickeya dadantii Ech586]
 gi|270342198|gb|ACZ74963.1| Superoxide dismutase [Dickeya dadantii Ech586]
          Length = 208

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 119/212 (56%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+   +T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 1   MSYSLPSLPYAYDALEPHFDAQTMEIHHSKHHQAYVNNANAALESLPEFASLSAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS ++FK+  
Sbjct: 61  LDQLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLEGELKAAIERDFGSVDEFKTKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          P++ +DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGASGYPLIALDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F  ++VNW+   +R+  A  
Sbjct: 178 KYQNRRPDYIKAF-WSVVNWDEAAKRFAEAKK 208


>gi|159027369|emb|CAO90555.1| sodB [Microcystis aeruginosa PCC 7806]
          Length = 236

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 85/205 (41%), Positives = 116/205 (56%), Gaps = 8/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK- 59
            + L  LPYSYD L PY+ KET+++HHD HH  Y +N    +A   E+   ++ E+I   
Sbjct: 34  PYSLIALPYSYDALEPYIDKETMQFHHDKHHAAYVNNLNTAVAKYPELQKKTVVELIKNL 93

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN     NH +FW  M   DG G+    +  AI   FGSFE+FK+   
Sbjct: 94  DSLPADIRTTIRNNGGGDLNHTMFWQIMSP-DGGGEPTGEIGAAIIAKFGSFEEFKNTFN 152

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A +  FGSGW WL + K+G+LEI  T N ++PL+ G  PI+G DVWEHAYYL ++ +RA
Sbjct: 153 QAGTKLFGSGWTWLVLNKSGQLEIISTANQDSPLMMGLQPIMGNDVWEHAYYLKYRNQRA 212

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y++    N+VNWE V  RY  A  
Sbjct: 213 EYLKQ-WWNVVNWEEVNRRYLQAKA 236


>gi|134665|sp|P04179|SODM_HUMAN RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
          Length = 222

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|86142975|ref|ZP_01061397.1| superoxide dismutase [Leeuwenhoekiella blandensis MED217]
 gi|85830420|gb|EAQ48879.1| superoxide dismutase [Leeuwenhoekiella blandensis MED217]
          Length = 203

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 125/205 (60%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP LPY+Y  L PY+   T+E HH  HH+ Y         +AE++   LE++  K 
Sbjct: 1   MSYQLPALPYAYVALEPYIDAATMEIHHTKHHQGYTTKLNAALEEAELIDEDLEDLFTKV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G+ NN   YYNH LFW  +    G G+   A++ AI+D +GSFE FK     AA+
Sbjct: 61  SELPKGIRNNGGGYYNHKLFWTILSP-KGGGEPTGAVAKAINDAYGSFEAFKDAFDAAAA 119

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL V ++ K++++ T N +NPL+    +   PILG+DVWEHAYYL+++ +R 
Sbjct: 120 TRFGSGWAWLIVGEDKKVKVTSTPNQDNPLMDVADDNGTPILGLDVWEHAYYLNYQNKRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F   LVNW+ V +RY+ A+ 
Sbjct: 180 EYIGAF-WKLVNWDEVEKRYQEAIK 203


>gi|332245317|ref|XP_003271807.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like isoform 1
           [Nomascus leucogenys]
          Length = 222

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|161523933|ref|YP_001578945.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|189351306|ref|YP_001946934.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|221199221|ref|ZP_03572265.1| superoxide dismutase [Burkholderia multivorans CGD2M]
 gi|221205877|ref|ZP_03578892.1| superoxide dismutase [Burkholderia multivorans CGD2]
 gi|221211446|ref|ZP_03584425.1| superoxide dismutase [Burkholderia multivorans CGD1]
 gi|160341362|gb|ABX14448.1| Superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|189335328|dbj|BAG44398.1| superoxide dismutase [Burkholderia multivorans ATCC 17616]
 gi|221168807|gb|EEE01275.1| superoxide dismutase [Burkholderia multivorans CGD1]
 gi|221174715|gb|EEE07147.1| superoxide dismutase [Burkholderia multivorans CGD2]
 gi|221180506|gb|EEE12909.1| superoxide dismutase [Burkholderia multivorans CGD2M]
          Length = 192

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  ++ LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENMPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GSF+ FK     AA 
Sbjct: 61  SG---GIFNNAAQVWNHTFFWNSLSPNGGGAP-SGALGDAINAKWGSFDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+ NW++  + + 
Sbjct: 177 AF-WNIANWDFAAKNFA 192


>gi|86747733|ref|YP_484229.1| superoxide dismutase [Rhodopseudomonas palustris HaA2]
 gi|86570761|gb|ABD05318.1| Superoxide dismutase [Rhodopseudomonas palustris HaA2]
          Length = 244

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 113/206 (54%), Gaps = 9/206 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIK- 59
            F LP LPY    L P++  +T+E HH  HH+ Y  N    A    ++  +S+ +++ K 
Sbjct: 38  PFTLPPLPYPAAALEPHIDAKTMEIHHGKHHQAYVSNMNGFAKDHPKLAQMSVPDVLGKL 97

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                    G+ NN   + NH +FW  M  N   GK    ++ AID + G  +KF++D  
Sbjct: 98  GDVPEAIRTGVRNNLGGHANHTMFWQIMGPN--GGKPSGEVAAAIDRDLGGMDKFQADFN 155

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A   QFGSGW +++V K+GKL I    N + PL++G   +LG DVWEHAYYL+++ RRA
Sbjct: 156 AAGGKQFGSGWVFVTVGKDGKLAIEARPNQDTPLMDGKRVLLGNDVWEHAYYLNYQNRRA 215

Query: 176 HYIESFITNLVNWEYVCERYETAMLA 201
            Y+++   N VNW  V ERY  A   
Sbjct: 216 DYLKA-WWNTVNWSKVGERYAAAKAG 240


>gi|23099387|ref|NP_692853.1| manganese superoxide dismutase [Oceanobacillus iheyensis HTE831]
 gi|22777616|dbj|BAC13888.1| manganese superoxide dismutase [Oceanobacillus iheyensis HTE831]
          Length = 203

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 84/205 (40%), Positives = 114/205 (55%), Gaps = 8/205 (3%)

Query: 1   MD-FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M  F+LP LPY+YD L P + KET+  HH  HH  Y             L     E +I 
Sbjct: 1   MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNDALEGHADLQSKSVEELIS 60

Query: 60  -----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
                   +   + NN   + NH+LFW  +  N G       L+D I+  FGS +KFK +
Sbjct: 61  NLDAVPENAKTAVRNNGGGHANHSLFWKLLSPNGGGEP-TGELADKINAKFGSLDKFKEE 119

Query: 115 LITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
              AA+ +FGSGW WL V NG+LEI+ T N ++PL+ G  P+LG+DVWEHAYYL ++ +R
Sbjct: 120 FAAAAAGRFGSGWAWLIVNNGELEITSTPNQDSPLMEGKTPVLGLDVWEHAYYLKYQNKR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+VNW+ V + YE A 
Sbjct: 180 PEYISAF-WNVVNWDQVAKNYEEAK 203


>gi|302024218|ref|ZP_07249429.1| superoxide dismutase [Streptococcus suis 05HAS68]
          Length = 231

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 113/209 (54%), Gaps = 8/209 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDA----EMLHLSLEEI 56
           M   LP+LPY+YD L P++  ET+  HHD HH  Y  NA           E L   L ++
Sbjct: 1   MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDV 60

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NN   + NH LFW  +     K ++   L+  ID  FGSF+ FK    
Sbjct: 61  EQIPADIRQALINNGGGHLNHALFWELLSP--EKTEISAELAADIDATFGSFDAFKEAFT 118

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA+T+FGSGW +L V K GKLE+  T N + P++ G  PIL +DVWEHAYYL+++  R 
Sbjct: 119 AAATTRFGSGWAFLVVNKEGKLEVISTANQDTPIMQGLKPILALDVWEHAYYLNYRNVRP 178

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQKV 204
           +YI++F   ++NW+ V +  +  +    +
Sbjct: 179 NYIKAFF-EVINWDKVNDFIKQLIKNSSL 206


>gi|34707|emb|CAA32502.1| Manganese superoxide dismutase [Homo sapiens]
 gi|36537|emb|CAA68791.1| unnamed protein product [Homo sapiens]
 gi|338286|gb|AAA36622.1| superoxide dismutase [Homo sapiens]
          Length = 222

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQTA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|21674036|ref|NP_662101.1| superoxide dismutase [Chlorobium tepidum TLS]
 gi|21647185|gb|AAM72443.1| superoxide dismutase [Chlorobium tepidum TLS]
          Length = 200

 Score =  200 bits (508), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 84/201 (41%), Positives = 126/201 (62%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY+ + L P++S  T+ +H+  HH  Y  N            +SLEE+II++
Sbjct: 1   MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGFVEGTPYDAMSLEEVIIQT 60

Query: 61  --HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
               S  G+FNN +Q +NH+ +W C+  N G       ++  I ++FGS +KFK +L  A
Sbjct: 61  ASDASKTGIFNNGAQAWNHSFYWNCLTPNGGGEP-TGEIATKITEDFGSVDKFKEELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +  GKL+++KT NA+NP+ +G  P+L IDVWEHAYYLD++ RR  ++
Sbjct: 120 AATQFGSGWAWLVLDGGKLKVTKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHV 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
            + I NL+NWE++   Y  A 
Sbjct: 180 AAVIENLINWEFINANYAAAK 200


>gi|194336611|ref|YP_002018405.1| Superoxide dismutase [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309088|gb|ACF43788.1| Superoxide dismutase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 200

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 84/200 (42%), Positives = 121/200 (60%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P L Y+ + L P++S +TL +H+  HH  Y  N   L +   +  +SLEE+I  S
Sbjct: 1   MAYQQPALLYAENALEPFISAKTLGFHYGKHHVAYITNYNNLVAGTPLDTMSLEEVIAHS 60

Query: 61  HGSNAG--LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   +FNN +Q +NH+ +W C+  N G       L   I ++FGSF+KFK +L +A
Sbjct: 61  AADPQKVGIFNNGAQAWNHSFYWNCLTPNGGGEP-SGELGAKITEDFGSFDKFKEELKSA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +    L++ KT NA+ P  +G  PIL IDVWEHAYYLD++ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDGTTLKVVKTANAQTPSTSGQKPILTIDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETA 198
            + I NL+NWE+  E +  A
Sbjct: 180 ATVIDNLLNWEFAAENFRAA 199


>gi|242237532|ref|YP_002985713.1| superoxide dismutase [Dickeya dadantii Ech703]
 gi|242129589|gb|ACS83891.1| Superoxide dismutase [Dickeya dadantii Ech703]
          Length = 208

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/212 (39%), Positives = 119/212 (56%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFASLSAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDQLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLEGELKAAIERDFGSVDAFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K +GKL +  T N ++PL+          P++ +DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEAISGASGYPLVALDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F  ++VNW+   +R+  A  
Sbjct: 178 KYQNRRPDYIKAF-WSVVNWDEAAKRFAEATK 208


>gi|239827578|ref|YP_002950202.1| superoxide dismutase [Geobacillus sp. WCH70]
 gi|239807871|gb|ACS24936.1| Superoxide dismutase [Geobacillus sp. WCH70]
          Length = 348

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/200 (36%), Positives = 100/200 (50%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPYSYD L P++S+E +  HH  HH++Y D   K     +    + +  ++K   
Sbjct: 147 HVLPPLPYSYDALEPHISREIMRLHHTKHHQSYVDGLNKAEKMMKKARETNDYELLKHWE 206

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
                  + S +Y H +FW  M    G       L + I  +FGSFE+FK     AA + 
Sbjct: 207 --REAAFHGSGHYLHTIFWNNMHPKGGGQP-RGELLEQIKRDFGSFERFKRHFTEAAKSV 263

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            G GW  L       +LEI +T+  +       IP+L IDVWEHAYYL +K  RA YI +
Sbjct: 264 EGVGWALLVWSPRSHRLEILQTEKHQFMTQWDTIPLLVIDVWEHAYYLQYKNDRAAYINN 323

Query: 181 FITNLVNWEYVCERYETAML 200
              N+V+W  V ER+E A  
Sbjct: 324 -WWNVVHWRDVEERFEQARK 342


>gi|196229462|ref|ZP_03128327.1| Superoxide dismutase [Chthoniobacter flavus Ellin428]
 gi|196226694|gb|EDY21199.1| Superoxide dismutase [Chthoniobacter flavus Ellin428]
          Length = 209

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 74/211 (35%), Positives = 106/211 (50%), Gaps = 13/211 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M  +LP LP++Y DL P +   T E H+  HH+ Y +N  K    A  L     E +IK 
Sbjct: 1   MAHELPKLPFAYTDLEPTIDAATAEIHYSKHHQAYVNNLNKALESAPDLASKSAEDLIKN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+ FW  +K           L++AI   FG F + +   
Sbjct: 61  LSGVPEAIRGAVRNNGGGHVNHSFFWKLLKAKGEGAP-VGKLAEAIKSTFGDFAQLQEKF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYYLD 169
             A  ++FGSGW WL V  GKLE+  T N ++PL+          P+LG+DVWEHAYYL 
Sbjct: 120 NAAGGSRFGSGWAWLVVNGGKLEVGSTANQDSPLMGKAVAGIEGTPVLGVDVWEHAYYLH 179

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAML 200
           ++ RR  Y+++ I N++NW    E Y  A+ 
Sbjct: 180 YQNRRPDYLKA-IWNVINWAQAEENYLAALK 209


>gi|220898261|gb|ACL81495.1| FeSOD [Ginkgo biloba]
          Length = 239

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 89/198 (44%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PYS+D L P+MSK T E+H   HH+ Y DN  K     E+   +L ++I  ++ 
Sbjct: 41  FELKPPPYSFDALEPHMSKRTFEFHWGKHHRAYVDNLNKQIEGTELEGYTLGDVIKATYS 100

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G     FNNA+Q +NH  FW CM    GK K    +   I+ +FGS+++F  +   AA+
Sbjct: 101 NGEPQPAFNNAAQAWNHEFFWECMSPGGGK-KPGGEILKLIEKDFGSYDEFLKEFKQAAA 159

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WL +K+ KL + K+ NA NPLI G  P+L IDVWEHAYYLD++ RR  YI  
Sbjct: 160 TQFGSGWAWLVLKDKKLVVEKSPNAINPLIWGHTPLLTIDVWEHAYYLDYQNRRPDYISV 219

Query: 181 FITNLVNWEYVCERYETA 198
           F+  LV+W+ V  R + A
Sbjct: 220 FMNELVSWDGVNARLDRA 237


>gi|162447168|ref|YP_001620300.1| Fe/Mn family superoxide dismutase [Acholeplasma laidlawii PG-8A]
 gi|161985275|gb|ABX80924.1| superoxide dismutase, Fe/Mn-binding family [Acholeplasma laidlawii
           PG-8A]
          Length = 203

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 84/206 (40%), Positives = 111/206 (53%), Gaps = 11/206 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F L  LPY+YD L P++  +T+E HH  HH+ Y  N          LH+   + +I  
Sbjct: 1   MAFTLDKLPYAYDALEPFIDAKTMEIHHGKHHQAYITNLNAALEKHPELHVHTMDDLIVL 60

Query: 59  ------KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFK 112
                         + NN   +YNH  FW  +KKNDGK      L DAI  +FGSFE F+
Sbjct: 61  LADLNKVPVDIQGAVRNNGGGHYNHAFFWPLLKKNDGKKP-AGKLMDAITQSFGSFEAFQ 119

Query: 113 SDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKY 172
                AA T+FGSGW WL  K  KL ++ T N + PL     P+LG+DVWEHAYYL+++ 
Sbjct: 120 EAFSNAAKTRFGSGWAWLIKKGDKLVVTSTPNQDTPL-AEGTPLLGLDVWEHAYYLNYQN 178

Query: 173 RRAHYIESFITNLVNWEYVCERYETA 198
           RR  Y+ +F  N+VNWE V   +  A
Sbjct: 179 RRPDYVAAFF-NVVNWEAVEALFNKA 203


>gi|253690520|ref|YP_003019710.1| Superoxide dismutase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|251757098|gb|ACT15174.1| Superoxide dismutase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 208

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/212 (39%), Positives = 115/212 (54%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  KET+E HH  HH+ Y +NA         L     E +I  
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSVEELIAQ 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                    A L NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 61  LDKVPAEKKAALRNNAGGHANHSLFWKGLK---VGTTLTGDLKAAIERDFGSVDAFKEKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            F+ RR  Y ++F  N+VNW+    R+ +A  
Sbjct: 178 KFQNRRPDYAKAF-WNVVNWDEAAARFASAKK 208


>gi|2407235|gb|AAC46219.1| manganese superoxide dismutase [Haemophilus ducreyi]
          Length = 213

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 114/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+YD L PY  KET+E HH  HH+ Y +N+  L      L        L++
Sbjct: 1   MTYQLPELGYAYDALEPYFDKETMEIHHSKHHQAYVNNSNALLEKHPELLEKCPGALLKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS + F+++ 
Sbjct: 61  LTQVPAEKRTAVRNNLGGHVNHTLFWKGLKT---GTTLQGALKDAIIRDFGSVKAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL ++ GKL +  T N ++P++          PI  +DVWEHAYYL 
Sbjct: 118 EQAAATRFGSGWAWLVLEEGKLAVVSTANQDSPIMGKDVAGVSGYPIFTLDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEASRRFEE 204


>gi|56182538|gb|AAV84021.1| iron superoxide dismutase [Nostoc commune CHEN]
          Length = 200

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 121/201 (60%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPY-MSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK 59
           M F    LP+  D L PY M  ET EYH+  HHK Y DN  KL    E+   SLEE+I  
Sbjct: 1   MAFVQLPLPFEKDALEPYGMKAETFEYHYGKHHKAYVDNLNKLTEGTELADKSLEEVIKI 60

Query: 60  SH--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
           S    S  G+FNNA+Q +NH  FW  +K   G       L+  ID +FGSF+KFK +   
Sbjct: 61  SFQDSSKVGIFNNAAQVWNHTFFWNSLKPQGGGTP-TGELAAKIDKDFGSFDKFKEEFSN 119

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+TQFGSGW WL    G L++ KT NAENPL +G   +L +DVWEHAYY+D+K  R  +
Sbjct: 120 AAATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYKNARPAF 179

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ NLVNW++  E    A
Sbjct: 180 IKNFLENLVNWDFAAENLAKA 200


>gi|332283950|ref|YP_004415861.1| superoxide dismutase [Pusillimonas sp. T7-7]
 gi|330427903|gb|AEC19237.1| superoxide dismutase [Pusillimonas sp. T7-7]
          Length = 192

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/196 (44%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P +SKETLEYH+  HH++Y  N   L +  E    SLEE++ KS
Sbjct: 1   MAFTLPPLPYALDALAPTISKETLEYHYGKHHQSYVTNLNNLVAGTEFESSSLEEVVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G      AL DAI+  +GS + FK     +A+
Sbjct: 61  SG---GIFNNAAQIWNHTFYWNSLSPNGGGEP-SGALLDAINAKWGSVDGFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL    +P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGTLDIVNTSNAATPLTTSDVPLLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERY 195
           SF   +VNW++     
Sbjct: 177 SF-WAIVNWDFAAANL 191


>gi|33413303|emb|CAE22480.1| superoxide dismutase [Fe] [Solanum lycopersicum]
          Length = 249

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 119/200 (59%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 49  FDLIPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 108

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  MK N G       L + I+ +FGS++ F  +   AA+
Sbjct: 109 NGAPLPAFNNAAQAWNHQFFWESMKPNGGGEP-SGELLELINRDFGSYDTFVKEFKAAAA 167

Query: 121 TQFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K    KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 168 TQFGSGWAWLAYKPEDKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 227

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 228 SIFMEKLVSWEAVSIRLKAA 247


>gi|302808782|ref|XP_002986085.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
 gi|300146233|gb|EFJ12904.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
          Length = 208

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 97/198 (48%), Positives = 130/198 (65%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY  + L P+MSK TLE+H   H + Y DN  K  S  E+  L LE+II K++G
Sbjct: 8   FELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIITKTYG 67

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +    FNNA+Q +NH+ F+  M    GK      +S  I+ + GS++ F  +  TAA+
Sbjct: 68  GGNAQPSFNNAAQAWNHDFFFHSMTAKGGKAP-SGDISGLINRDLGSYDNFVKEFKTAAT 126

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLS+K+GKL + KT NA NPL++G  P+L +DVWEHAYYLDF+ RR  Y+E+
Sbjct: 127 TQFGSGWAWLSLKDGKLIVQKTANAVNPLVSGETPLLVLDVWEHAYYLDFQNRRPDYVET 186

Query: 181 FITNLVNWEYVCERYETA 198
           F+  LVNW+ V  R ETA
Sbjct: 187 FLRELVNWDTVNARLETA 204


>gi|188535538|ref|YP_001909335.1| Manganese superoxide dismutase [Erwinia tasmaniensis Et1/99]
 gi|259910268|ref|YP_002650624.1| Manganese superoxide dismutase [Erwinia pyrifoliae Ep1/96]
 gi|188030580|emb|CAO98475.1| Manganese superoxide dismutase [Erwinia tasmaniensis Et1/99]
 gi|224965890|emb|CAX57423.1| Manganese superoxide dismutase [Erwinia pyrifoliae Ep1/96]
 gi|310765848|gb|ADP10798.1| superoxide dismutase, manganese [Erwinia sp. Ejp617]
          Length = 205

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 80/199 (40%), Positives = 115/199 (57%), Gaps = 14/199 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L +EE+I K 
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+ FW  +K     G     L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGG---DLKAAIEKDFGSVDAFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYYL +
Sbjct: 118 KAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIVGLDVWEHAYYLKY 177

Query: 171 KYRRAHYIESFITNLVNWE 189
           + +R  YI++F  ++VNW+
Sbjct: 178 QNKRPDYIKAF-WDVVNWD 195


>gi|221136195|ref|XP_002170998.1| PREDICTED: similar to superoxide dismutase [Hydra magnipapillata]
          Length = 199

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LPNLPY    L P++S +TL +HH  HH+ Y  N   L  + E+ + +LEEII   
Sbjct: 1   MTHTLPNLPYDIAALEPHISAKTLTFHHGKHHQAYVTNLNNLIQNTELANKTLEEIIHAT 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
             +   AG+FNNA+Q +NH  FW CMK   G       L   ID  FGS+E F +D   A
Sbjct: 61  AKNPEKAGIFNNAAQVWNHTFFWNCMKPQGGGQP-TGDLKAMIDKTFGSYEAFAADFKQA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL V+ G L I KT NA+ P+++GA  +L  DVWEHAYYLD++ RR  Y+
Sbjct: 120 AITQFGSGWAWLVVERGVLRIMKTPNADLPMVHGATALLTCDVWEHAYYLDYQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYE 196
           ++F+++LVNW++      
Sbjct: 180 DTFLSHLVNWDFASALLN 197


>gi|323495119|ref|ZP_08100205.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
 gi|323310620|gb|EGA63798.1| superoxide dismutase [Vibrio brasiliensis LMG 20546]
          Length = 205

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/207 (41%), Positives = 120/207 (57%), Gaps = 6/207 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D  +    D+E+   +L +I  + 
Sbjct: 1   MSHTFPELPYTYDALEPYIDAKTMEVHYSKHHRTYYDKFIAAIKDSELESTNLSDIFAQI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM  N G      AL+ AI+D FGSF +F+     AA 
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWNCMAPNGGGTP-SGALAQAINDTFGSFAEFQDQFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+G+L IS T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGQLLISSTTNQDNPLMDVAEVQGEPILALDVWEHAYYISYQNRRPD 179

Query: 177 YIESFITNLVNWEYVCERYETAMLAQK 203
           YI++   N+VNW+ V E Y  A+   +
Sbjct: 180 YIDA-WWNVVNWDAVSEFYAVALAQGR 205


>gi|190149522|ref|YP_001968047.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307262840|ref|ZP_07544465.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|189914653|gb|ACE60905.1| manganese superoxide dismutase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306871855|gb|EFN03574.1| Superoxide dismutase [Mn] [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 213

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 114/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLS-----LEE 55
           M ++LP L Y+Y+ L P+  K T+E HH  HH+ Y +NA         L        +++
Sbjct: 1   MAYQLPELGYAYNALEPHFDKATMEIHHTKHHQTYVNNANAALEAHPELLEKCPGALIKD 60

Query: 56  IIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
           +          + NN   + NH LFW  +K       +  AL DAI  +FGS E F+++ 
Sbjct: 61  LSQVPAEKRTAVRNNVGGHVNHTLFWKGLKT---GTTLQGALKDAIVRDFGSVEAFQAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL V++GKL +  T N +NP++          PIL +DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVVEDGKLAVVSTANQDNPIMGKEVAGVSGFPILALDVWEHAYYLH 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E 
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFEE 204


>gi|299773483|gb|ADJ38816.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 116/208 (55%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L + +++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYSDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E+F+  L
Sbjct: 61  LEQVPVEKQVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVERFQEHL 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTSNQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  Y+++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYVKAF-WNVVNWDEAARRFES 204


>gi|146263086|gb|ABQ15313.1| SodA [Yersinia bercovieri]
          Length = 207

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 123/211 (58%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+   S+EE+I  
Sbjct: 1   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEELIQD 60

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FG FEKF++  
Sbjct: 61  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGDFEKFQATF 117

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K +GKL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 178 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 207


>gi|238783087|ref|ZP_04627114.1| Superoxide dismutase [Mn] [Yersinia bercovieri ATCC 43970]
 gi|238716088|gb|EEQ08073.1| Superoxide dismutase [Mn] [Yersinia bercovieri ATCC 43970]
          Length = 209

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 123/211 (58%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEII-- 57
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E+   S+EE+I  
Sbjct: 3   MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEELIQD 62

Query: 58  --IKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FG FEKF++  
Sbjct: 63  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGDFEKFQATF 119

Query: 116 ITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K +GKL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 120 EQAAATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYL 179

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 180 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 209


>gi|171323164|ref|ZP_02911764.1| Superoxide dismutase [Burkholderia ambifaria MEX-5]
 gi|171091442|gb|EDT37105.1| Superoxide dismutase [Burkholderia ambifaria MEX-5]
          Length = 192

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 88/197 (44%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +LSLEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-SGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|149275665|gb|ABR23158.1| manganese superoxide dismutase [Ulva fasciata]
          Length = 232

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 104/204 (50%), Gaps = 7/204 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGS 63
            LP+LPY Y  L PY+S E +E HH  HH+ Y  N  K     +      ++  + +   
Sbjct: 32  SLPDLPYEYSALEPYISAEIMELHHSKHHQAYVTNYNKALE--QWAESESKQDAVSAPKI 89

Query: 64  NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQF 123
           ++ L  N   + NH++FW  +            L DAI  +FGS ++ ++ L   A+   
Sbjct: 90  SSALHFNGGGHLNHSIFWKNLCPAKDAQPCSGNLLDAIKRDFGSMQQLQTKLAADAAAVQ 149

Query: 124 GSGWGWLSVKNG--KLEISKTQNAEN--PLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           GSGWGWL  K    +L I  + N +    +  G  PILGIDVWEHAYYL +K  R  Y++
Sbjct: 150 GSGWGWLVCKRETGRLAIMTSPNQDTVAHVAPGFHPILGIDVWEHAYYLQYKNVRPDYLK 209

Query: 180 SFITNLVNWEYVCERYETAMLAQK 203
           + I N++NW+    RYE A    K
Sbjct: 210 A-IWNVINWQDAAARYEEAQCQGK 232


>gi|28199854|ref|NP_780168.1| superoxide dismutase [Xylella fastidiosa Temecula1]
 gi|182682604|ref|YP_001830764.1| superoxide dismutase [Xylella fastidiosa M23]
 gi|28057975|gb|AAO29817.1| superoxide dismutase [Xylella fastidiosa Temecula1]
 gi|182632714|gb|ACB93490.1| Superoxide dismutase [Xylella fastidiosa M23]
 gi|307578888|gb|ADN62857.1| superoxide dismutase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 203

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 112/205 (54%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++  +T+E H+  HH  Y +N        E   L +EE++   
Sbjct: 1   MAYTLPILPYAYDALEPHIDAQTMEIHYTKHHATYINNLNAALEGTEYADLPIEELLRNL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   + NH+LFW  +   DG GK    ++ AID   G FE FK    
Sbjct: 61  KSLPESLQVPVRNNGGGHANHSLFWT-VMAQDGGGKPKGEVAKAIDQQLGGFETFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW  L+V   K L +  + N ++PL +G   IL +DVWEHAYYL ++ RRA
Sbjct: 120 KAALSRFGSGWSLLNVTPSKTLVVESSANQDSPLCDGKTSILCLDVWEHAYYLHYQNRRA 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +F  N++NW+ V  RY  AM 
Sbjct: 180 DYVNAFY-NVINWDEVERRYVVAMS 203


>gi|312882794|ref|ZP_07742528.1| superoxide dismutase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369578|gb|EFP97096.1| superoxide dismutase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 203

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D  +      E+  LSL++I    
Sbjct: 1   MSHTFPELPYAYDSLEPYIDAKTMEVHYSKHHRTYFDKFISAVEGTELASLSLKDIFANI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   YYNH ++W CM  N G       L   +   FGSF++FK     AA 
Sbjct: 61  SKHAPAIRNNGGGYYNHIVYWNCMSPNGGGEP-QGKLKQELLSTFGSFDEFKQQFAQAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLI----NGAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+ KL I+ T N +NPL+    +   PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLIVKDKKLVITSTSNQDNPLMDVAQDKGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAML 200
           YI++   N+V+W+ V   YE AM 
Sbjct: 180 YIDA-WWNVVDWDAVNANYEAAMS 202


>gi|296199549|ref|XP_002747206.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like isoform 1
           [Callithrix jacchus]
          Length = 222

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 102/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNDTEEKYKEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +   DG G+    L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSP-DGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|225708570|gb|ACO10131.1| Superoxide dismutase, mitochondrial precursor [Osmerus mordax]
          Length = 226

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 95/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HTLPDLSYDYGALEPHINAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+  K  +  A    
Sbjct: 88  LQPALRFNGGGHINHTIFWTNLSPNGGGEP-QGELMEAIKRDFGSFQNMKDKMSAATVAV 146

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGFDKERASLRIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N +NWE V ER ++A  
Sbjct: 207 A-IWNAINWENVSERLQSAKK 226


>gi|167650956|gb|ABZ90958.1| manganese-superoxide dismutase [Crassostrea gigas]
          Length = 225

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 64/202 (31%), Positives = 100/202 (49%), Gaps = 6/202 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY Y+ L PY+S + ++ HH  HH+ Y +N        ++     ++ + K 
Sbjct: 27  MKHTLPDLPYDYNALEPYISADIMKLHHSKHHQTYVNNLNVAEE--KLAEAMEKKDVNKI 84

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A +  N   + NH++FW  +    G      AL D I + F +F+  K  L  A+ 
Sbjct: 85  IQLQAAIRFNGGGHLNHSIFWETLSPQGGGEPQDGALKDLILEEFVTFDALKKALTEASV 144

Query: 121 TQFGSGWGWLSVKN--GKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHY 177
              GSGW WL        L +    N +  L      P+ GIDVWEHAYYL +K  R  Y
Sbjct: 145 GVQGSGWSWLGYDKAAHSLRVVTCANQDPLLATTGLYPLFGIDVWEHAYYLQYKNVRPDY 204

Query: 178 IESFITNLVNWEYVCERYETAM 199
           + + I ++++W+ V ER++ A+
Sbjct: 205 VNA-IWHIIDWKSVTERFKAAL 225


>gi|293391789|ref|ZP_06636123.1| superoxide dismutase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952323|gb|EFE02442.1| superoxide dismutase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 214

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/215 (38%), Positives = 118/215 (54%), Gaps = 18/215 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP L Y+YD L P+   +T+E HH  HH+ Y +NA     +   L    E    K 
Sbjct: 1   MAYTLPELGYAYDALEPHFDAQTMEIHHSKHHQAYVNNANAALENPPELQALSEGCPGKL 60

Query: 60  -------SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFK 112
                  +      L NN   + NH+LFW  +KK      +   L DAI+ +FGS E FK
Sbjct: 61  LAHLSEITPEKRLALRNNVGGHLNHSLFWKSLKK---GTTLKGPLKDAIERDFGSVENFK 117

Query: 113 SDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAY 166
           ++   AA+T+FGSGW WL ++NGKL +  T N +NP++         +PI G+DVWEHAY
Sbjct: 118 AEFEKAAATRFGSGWAWLVLENGKLAVVSTANQDNPIMGKEYAGCSGVPIFGLDVWEHAY 177

Query: 167 YLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           YL F+ RR  YI+ F  N++NW++  ER+E  +  
Sbjct: 178 YLKFQNRRPDYIKEF-WNVLNWDFANERFEKILAG 211


>gi|256420366|ref|YP_003121019.1| superoxide dismutase [Chitinophaga pinensis DSM 2588]
 gi|256035274|gb|ACU58818.1| Superoxide dismutase [Chitinophaga pinensis DSM 2588]
          Length = 246

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 82/205 (40%), Positives = 112/205 (54%), Gaps = 9/205 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F++P LPY YD L P++ K T+E HHD HH  Y  N       +    L+LE+I+ K  
Sbjct: 45  PFEVPPLPYGYDALEPHIDKATMEIHHDKHHGAYVKNLNDAVKGSAFESLTLEQILAKVK 104

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
             +  + NNA  ++NH+LFW  +     K      L  AI++ F S+EKF+    TAA  
Sbjct: 105 PEDKAVRNNAGGHFNHSLFWTLLSP--QKTTPSDKLKAAINETFTSWEKFQEIFNTAAKG 162

Query: 122 QFGSGWGWLSVKN-GKLEISKTQNAENPLING-----AIPILGIDVWEHAYYLDFKYRRA 175
            FGSGW WL V    KL +  T N +NPL++        PIL +DVWEHAYYL +   RA
Sbjct: 163 VFGSGWAWLIVTPGKKLSVISTPNQDNPLMDNIVKERGTPILALDVWEHAYYLKYHNVRA 222

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            Y+ +F  N+VNW  V + Y  A+ 
Sbjct: 223 DYVTAF-WNVVNWTEVDKLYAAAIK 246


>gi|73945748|ref|XP_862586.1| PREDICTED: similar to Superoxide dismutase [Mn], mitochondrial
           precursor isoform 4 [Canis familiaris]
          Length = 220

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 105/201 (52%), Gaps = 9/201 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N   +              I     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNTIEEKYLEPDCD----ITAQIA 81

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              GL  N   + NH++FW  +    G G+    L +AI  +FGSF+KFK  L T +   
Sbjct: 82  LQPGLKFNGGGHINHSIFWTNLSP-KGGGEPKGELLEAIKRDFGSFDKFKEKLTTVSVGV 140

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 141 QGSGWGWLGFNKEQGRLQIAACFNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 200

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 201 A-IWNVINWENVTERYMACKK 220


>gi|74195562|dbj|BAE39593.1| unnamed protein product [Mus musculus]
          Length = 222

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 101/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKG--GVTTQVA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +    G G+    L +AI  +FGSFEKFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHTIFWTNLSP-KGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAVCSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYTACKK 222


>gi|254496709|ref|ZP_05109572.1| superoxide dismutase, iron [Legionella drancourtii LLAP12]
 gi|254354137|gb|EET12809.1| superoxide dismutase, iron [Legionella drancourtii LLAP12]
          Length = 211

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 88/197 (44%), Positives = 122/197 (61%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKET+EYH+  HH+ Y +N  KL    E   +SLEEII ++
Sbjct: 20  MTFTLPALPYAMDALAPHISKETIEYHYGKHHQAYVNNLNKLIPGTEFASMSLEEIIKQA 79

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI+ +FGSF +FK     AA+
Sbjct: 80  KG---GIFNNAAQIWNHTFYWHCLSPNGGGEP-TGKLADAINSHFGSFNEFKEQFTQAAA 135

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   +   L+I  T NA  P+  G   +L  DVWEHAYY+D++  R  YI 
Sbjct: 136 TTFGSGWAWLVQDSTGALKIISTSNAGTPMTEGLTALLTCDVWEHAYYIDYRNARPDYIS 195

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LV+W++V    +
Sbjct: 196 AF-WSLVHWDFVASNLK 211


>gi|153828349|ref|ZP_01981016.1| superoxide dismutase, Mn [Vibrio cholerae 623-39]
 gi|148876179|gb|EDL74314.1| superoxide dismutase, Mn [Vibrio cholerae 623-39]
          Length = 222

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  L      E     L EI  + 
Sbjct: 18  MPHLFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARV 77

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + N+   YYNH ++W CMK N G       L+  I+  FGSF +FK     AA 
Sbjct: 78  STLPAAVRNHGGGYYNHIVYWNCMKPNGGGEP-QGELAAEIERQFGSFAQFKEAFSQAAV 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V+ G+L I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 137 NTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPE 196

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNWE V E Y  A+   
Sbjct: 197 YIDA-WWNVVNWEAVSENYAIALTQA 221


>gi|42523851|ref|NP_969231.1| hypothetical protein Bd2407 [Bdellovibrio bacteriovorus HD100]
 gi|39576058|emb|CAE80224.1| sodB [Bdellovibrio bacteriovorus HD100]
          Length = 193

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 97/197 (49%), Positives = 124/197 (62%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P+MS ETLEYHH  HHK Y DN  KL    E    +LE+II+ S
Sbjct: 1   MTFELPALPYAKDALAPHMSAETLEYHHGKHHKTYVDNLNKLVPGTEHEGKTLEQIIMSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW C+    G G+    L+ AI  +FGS EKFK     A+ 
Sbjct: 61  SG---GVFNNAAQIWNHTFFWNCLSP-KGGGEPTGELAQAIVRDFGSIEKFKELFADASI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            QFGSGWGWL   K GKLEI  T NAE P+  G   IL  DVWEHAYY+D++  R +++ 
Sbjct: 117 KQFGSGWGWLVKNKEGKLEILSTSNAETPMTKGHTAILTCDVWEHAYYIDYRNSRPNFLA 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F   LVNWE+  + ++
Sbjct: 177 AF-WKLVNWEFAAKNFK 192


>gi|302800493|ref|XP_002982004.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
 gi|300150446|gb|EFJ17097.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
          Length = 208

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 96/198 (48%), Positives = 129/198 (65%), Gaps = 3/198 (1%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP LPY  + L P+MSK TLE+H   H + Y DN  K  S  E+  L LE+II K++G
Sbjct: 8   FELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIITKTYG 67

Query: 63  --SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             +    FNNA+Q +NH+ F+  M    GK      +S  I+ + GS++ F  +   AA+
Sbjct: 68  GGNAQPAFNNAAQAWNHDFFFHSMTAKGGKAP-SGDISGLINRDLGSYDNFVKEFKAAAT 126

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGW WLS+K+GKL + KT NA NPL++G  P+L +DVWEHAYYLDF+ RR  Y+E+
Sbjct: 127 TQFGSGWAWLSLKDGKLIVQKTANAVNPLVSGETPLLVLDVWEHAYYLDFQNRRPDYVET 186

Query: 181 FITNLVNWEYVCERYETA 198
           F+  LVNW+ V  R ETA
Sbjct: 187 FLRELVNWDTVNARLETA 204


>gi|225158891|ref|ZP_03725205.1| Superoxide dismutase [Opitutaceae bacterium TAV2]
 gi|224802509|gb|EEG20767.1| Superoxide dismutase [Opitutaceae bacterium TAV2]
          Length = 289

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/207 (34%), Positives = 103/207 (49%), Gaps = 7/207 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE-----EI 56
            F LP LP++ D L P +   T+  HH  HH+ Y  NA         L           +
Sbjct: 77  PFVLPPLPFAPDALEPSIGARTMSIHHGKHHQAYITNANTALKSHPQLLSLSAAQLLQNL 136

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACM-KKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                     + NN   + NH+ FW  +   +   G    AL  AI + FGS + F +  
Sbjct: 137 DSIPEEIRTAVRNNVGGHANHSFFWPLLTASSPSPGHAHGALRTAIVETFGSLDAFIAGF 196

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA++ FGSGW WL  ++G+L I  T N ++PL  GA P++G+DVWEHAYYLD++ RRA
Sbjct: 197 NQAAASCFGSGWAWLVWQDGRLAIISTANQDSPLSLGARPVIGLDVWEHAYYLDYQNRRA 256

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            Y ++F   ++NW      Y  A+  Q
Sbjct: 257 DYTKAF-WAVLNWSQAEANYTAAIGGQ 282


>gi|153803683|ref|ZP_01958269.1| superoxide dismutase, Mn [Vibrio cholerae MZO-3]
 gi|124120779|gb|EAY39522.1| superoxide dismutase, Mn [Vibrio cholerae MZO-3]
          Length = 222

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  L      E     L EI  + 
Sbjct: 18  MPHLFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARV 77

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + N+   YYNH ++W CMK N G       L+  I+  FGSF +FK     AA 
Sbjct: 78  STLPAAVRNHGGGYYNHIVYWNCMKPNGGGEP-QGELAAEIERQFGSFAQFKEAFSQAAV 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V+ G+L I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 137 NTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPE 196

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNWE V E Y  A+   
Sbjct: 197 YIDA-WWNVVNWEAVSENYAIALTQA 221


>gi|3108345|gb|AAC15806.1| superoxide dismutase [Raphanus sativus]
          Length = 231

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 63/202 (31%), Positives = 94/202 (46%), Gaps = 9/202 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F LP+LPY Y  L P +S E ++ HH  HH+ Y  N        +              
Sbjct: 30  TFTLPDLPYDYSALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKG--DASAVV 87

Query: 62  GSNAGLFNNASQYYNHNLFWACMKK--NDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              + +  N   + NH++FW  +      G      +L  AID +FGS E     +    
Sbjct: 88  KLQSAIKFNGGGHVNHSIFWKNLAPVKEGGGEPPKGSLGGAIDTSFGSLEGLVKKMSAEG 147

Query: 120 STQFGSGWGWLSVKN--GKLEISKTQNAENPLINGA--IPILGIDVWEHAYYLDFKYRRA 175
           +   GSGW WL +     KL +  T N +  +  G   +P++GIDVWEHAYYL +K  R 
Sbjct: 148 AAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRP 207

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+++ +  ++NW+Y  E YE 
Sbjct: 208 DYLKN-VWKVINWKYASEVYEK 228


>gi|332526256|ref|ZP_08402385.1| exodeoxyribonuclease VII, large subunit [Rubrivivax benzoatilyticus
           JA2]
 gi|332110090|gb|EGJ10718.1| exodeoxyribonuclease VII, large subunit [Rubrivivax benzoatilyticus
           JA2]
          Length = 641

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/198 (41%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P+ S+ETLEYHH  HH  Y  N   L    E   L LEE++ KS
Sbjct: 448 MERTLPPLPYALDALAPHYSRETLEYHHGKHHNAYVVNLNNLQKGTEFEGLELEEVVRKS 507

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G++NNA+Q +NH  FW CMK   G        + AI   +GS+  FK   + +A 
Sbjct: 508 SG---GIYNNAAQIWNHTFFWNCMKPEGGGEPAGAL-AAAIVAKWGSYAAFKEAFVKSAV 563

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G ++I     A  PL  G  P+L +DVWEHAYY+D++  R  ++E
Sbjct: 564 GNFGSGWTWLVKKADGSVDIVNMGAAGTPLTTGDTPLLTVDVWEHAYYIDYRNLRPKFVE 623

Query: 180 SFITNLVNWEYVCERYET 197
           +F+  LVNW +    Y  
Sbjct: 624 TFLDKLVNWSFAEANYAA 641


>gi|319405309|emb|CBI78923.1| Superoxide dismutase [Bartonella sp. AR 15-3]
          Length = 200

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 107/197 (54%), Positives = 138/197 (70%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M FKL  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  +   SL ++I +S
Sbjct: 1   MTFKLAELPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFIRDLGLEDKSLTDLIRES 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P  L+ AI+ + G ++KF++D + A  
Sbjct: 61  FGKNPGLFNNAAQYYNHNHFWNWMKKGGGGQKLPVKLAKAIESDLGGYDKFRADFMAAGG 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W+ +K+ KLEI KT N ENPLI+ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVVLKDDKLEIMKTPNGENPLIHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYET 197
           F+ +L+NW+YV E YE+
Sbjct: 181 FVDHLINWDYVLELYES 197


>gi|77165889|ref|YP_344414.1| superoxide dismutase [Nitrosococcus oceani ATCC 19707]
 gi|254433723|ref|ZP_05047231.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Nitrosococcus oceani AFC27]
 gi|76884203|gb|ABA58884.1| Superoxide dismutase [Nitrosococcus oceani ATCC 19707]
 gi|207090056|gb|EDZ67327.1| superoxide dismutase (Mn/Fe family), C-terminal domain protein
           [Nitrosococcus oceani AFC27]
          Length = 193

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 88/198 (44%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L P++S+ETLEYH+  HH+ Y D    L    E  + SLEEII K+
Sbjct: 1   MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    LFNN +Q +NH  +W C+    G G+   AL +AI+ NFGSF  FK     +A+
Sbjct: 61  SG---TLFNNGAQVWNHTFYWNCLTP-QGGGEPSGALLEAIEKNFGSFSDFKEKFSQSAT 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   +   L+I  T NA NPL  G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TLFGSGWAWLVKNSDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F   L NW++V +    
Sbjct: 177 AF-WKLANWDFVAKNLAN 193


>gi|153212558|ref|ZP_01948305.1| superoxide dismutase, Mn [Vibrio cholerae 1587]
 gi|153825554|ref|ZP_01978221.1| superoxide dismutase, Mn [Vibrio cholerae MZO-2]
 gi|254225420|ref|ZP_04919031.1| superoxide dismutase, Mn [Vibrio cholerae V51]
 gi|254285884|ref|ZP_04960846.1| superoxide dismutase, Mn [Vibrio cholerae AM-19226]
 gi|124116429|gb|EAY35249.1| superoxide dismutase, Mn [Vibrio cholerae 1587]
 gi|125622054|gb|EAZ50377.1| superoxide dismutase, Mn [Vibrio cholerae V51]
 gi|149740839|gb|EDM54930.1| superoxide dismutase, Mn [Vibrio cholerae MZO-2]
 gi|150424066|gb|EDN16005.1| superoxide dismutase, Mn [Vibrio cholerae AM-19226]
          Length = 222

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  L      E     L EI  + 
Sbjct: 18  MPHLFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARV 77

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + N+   YYNH ++W CMK N G       L+  I+  FGSF +FK     AA 
Sbjct: 78  STLPAAVRNHGGGYYNHIVYWNCMKPNGGGEP-QGELAAEIERQFGSFAQFKEAFSQAAV 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V+ G+L I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 137 NTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPE 196

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNWE V E Y  A+   
Sbjct: 197 YIDA-WWNVVNWEAVSENYAIALTQA 221


>gi|148227624|ref|NP_001085776.1| MGC80739 protein [Xenopus laevis]
 gi|49257404|gb|AAH73330.1| MGC80739 protein [Xenopus laevis]
          Length = 224

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 104/201 (51%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P++S E ++ HH  HH  Y +N     ++ +      +  +     
Sbjct: 28  HTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLN--ITEEKYAEALAKGDVTTQVS 85

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
             A L  N   + NH +FW  +  N G       L D I  +FGSF+KFK  L   +   
Sbjct: 86  LQAALKFNGGGHINHTIFWTNLSPNGGGEP-QGELLDTIKRDFGSFQKFKEKLTAVSVGV 144

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     + KL+++   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 145 QGSGWGWLGYNKDSNKLQLAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 204

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I +++NWE V ERY+ +  
Sbjct: 205 A-IWDVINWENVAERYQASKK 224


>gi|34709|emb|CAA42066.1| manganese superoxide dismutase (MnSOD) [Homo sapiens]
 gi|34795|emb|CAA33228.1| unnamed protein product [Homo sapiens]
          Length = 222

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVNEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|74136169|ref|NP_001027977.1| superoxide dismutase [Mn], mitochondrial [Macaca mulatta]
 gi|23503532|dbj|BAC20356.1| Mn-superoxide dismutase [Macaca fuscata]
 gi|23503534|dbj|BAC20357.1| Mn-superoxide dismutase [Macaca fascicularis]
 gi|23503536|dbj|BAC20358.1| Mn-superoxide dismutase [Macaca mulatta]
          Length = 199

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 101/203 (49%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +   
Sbjct: 1   MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQ 58

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 L  N   + NH++FW  +  N G       L +AI  +FGSFEKFK  L  A+ 
Sbjct: 59  IALQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFEKFKEKLTAASV 117

Query: 121 TQFGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHY 177
              GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y
Sbjct: 118 GVQGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDY 177

Query: 178 IESFITNLVNWEYVCERYETAML 200
           +++ I N++NWE V ERY     
Sbjct: 178 LKA-IWNVINWENVTERYMACKK 199


>gi|212709402|ref|ZP_03317530.1| hypothetical protein PROVALCAL_00441 [Providencia alcalifaciens DSM
           30120]
 gi|158853182|dbj|BAF91443.1| manganese superoxide dismutase [Providencia alcalifaciens]
 gi|212687917|gb|EEB47445.1| hypothetical protein PROVALCAL_00441 [Providencia alcalifaciens DSM
           30120]
          Length = 208

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P+  K+T+E HH  HH+ Y +N          L     +++I+ 
Sbjct: 1   MSYTLPALPYAYDALEPHFDKQTMEIHHTKHHQTYVNNTNTALEKLPELAGLDIDVLIQK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K      ++   L  AI+ +FGS + FK   
Sbjct: 61  LDQIPADQRTFVRNNAGGHSNHSLFWKGLK---LGTELNGELKVAIERDFGSVDAFKDLF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+++FGSGW WL +K+  KL +  T N +NPL+          PILG+DVWEHAYYL
Sbjct: 118 EKAAASRFGSGWAWLVLKDDGKLAVVSTANQDNPLMGEAISGASGYPILGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            ++ RR  YI++F  ++VNW+   +R+  
Sbjct: 178 KYQNRRPDYIKAF-WSVVNWDEAAKRFAE 205


>gi|294649919|ref|ZP_06727312.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
 gi|292824187|gb|EFF82997.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
          Length = 207

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 86/207 (41%), Positives = 118/207 (57%), Gaps = 7/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYSLPALPYAYDALEPNIDTKTMEIHHSKHHQTYINNINGAIEGTEWEKLPVEELVAKV 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NNA  + NH+LFW  M    G GK    ++DAID   G F+ FK    
Sbjct: 61  NEVPANLKNMVINNAGGHANHSLFWTVMSP-QGGGKPTGPVADAIDQQLGGFDAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAISRFGSGWAWLSVTPEHKLIVESSANQDSPLMYGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            YI +F  N+VNW+ V  RY  A+  +
Sbjct: 180 EYIAAFY-NVVNWDEVNRRYHDALQTK 205


>gi|145589566|ref|YP_001156163.1| superoxide dismutase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047972|gb|ABP34599.1| Superoxide dismutase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 192

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LPY+ D L+P++SKETLEYH+  HH+ Y  N   L    E   LSLE+II KS
Sbjct: 1   MEHTLPPLPYALDALAPHISKETLEYHYGKHHQAYVTNLNNLIKGTEFEALSLEDIIKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                G+FNNA+Q +NH  +W  +K N G       L+DAI+  +GSF+KFK +    A 
Sbjct: 61  AA---GVFNNAAQVWNHTFYWNSLKPNGGGAPTGP-LADAINAKWGSFDKFKEEFNKCAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L  DVWEHAYY+D +  R  Y+E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDTRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++    + 
Sbjct: 177 NF-WNVVNWDFASSNFA 192


>gi|3212626|pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli
 gi|3212627|pdb|1VEW|B Chain B, Manganese Superoxide Dismutase From Escherichia Coli
 gi|3212628|pdb|1VEW|C Chain C, Manganese Superoxide Dismutase From Escherichia Coli
 gi|3212629|pdb|1VEW|D Chain D, Manganese Superoxide Dismutase From Escherichia Coli
 gi|3660240|pdb|1MMM|A Chain A, Distinct Metal Environment In Iron-Substituted Manganese
           Superoxide Dismutase Provides A Structural Basis Of
           Metal Specificity
 gi|3660241|pdb|1MMM|B Chain B, Distinct Metal Environment In Iron-Substituted Manganese
           Superoxide Dismutase Provides A Structural Basis Of
           Metal Specificity
 gi|7245492|pdb|1D5N|A Chain A, Crystal Structure Of E. Coli Mnsod At 100k
 gi|7245493|pdb|1D5N|B Chain B, Crystal Structure Of E. Coli Mnsod At 100k
 gi|7245494|pdb|1D5N|C Chain C, Crystal Structure Of E. Coli Mnsod At 100k
 gi|7245495|pdb|1D5N|D Chain D, Crystal Structure Of E. Coli Mnsod At 100k
 gi|295982311|pdb|3K9S|A Chain A, Crystal Structure Of The Peroxide-Bound Manganese
           Superoxide Dismutase.
 gi|295982312|pdb|3K9S|B Chain B, Crystal Structure Of The Peroxide-Bound Manganese
           Superoxide Dismutase.
 gi|295982313|pdb|3K9S|C Chain C, Crystal Structure Of The Peroxide-Bound Manganese
           Superoxide Dismutase.
 gi|295982314|pdb|3K9S|D Chain D, Crystal Structure Of The Peroxide-Bound Manganese
           Superoxide Dismutase.
 gi|315364642|pdb|3OT7|A Chain A, Escherichia Coli Apo-Manganese Superoxide Dismutase
 gi|315364643|pdb|3OT7|B Chain B, Escherichia Coli Apo-Manganese Superoxide Dismutase
 gi|315364644|pdb|3OT7|C Chain C, Escherichia Coli Apo-Manganese Superoxide Dismutase
 gi|315364645|pdb|3OT7|D Chain D, Escherichia Coli Apo-Manganese Superoxide Dismutase
          Length = 205

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 118/207 (57%), Gaps = 15/207 (7%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK- 59
            + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K 
Sbjct: 1   SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL F
Sbjct: 118 KAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYET 197
           + RR  YI+ F  N+VNW+    R+  
Sbjct: 178 QNRRPDYIKEF-WNVVNWDEAAARFAA 203


>gi|300918025|ref|ZP_07134647.1| superoxide dismutase [Escherichia coli MS 115-1]
 gi|300414767|gb|EFJ98077.1| superoxide dismutase [Escherichia coli MS 115-1]
          Length = 193

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ET+EYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAGGEP-TGELADAITASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL   +  KL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|293607682|ref|ZP_06690013.1| superoxide dismutase [Achromobacter piechaudii ATCC 43553]
 gi|292813820|gb|EFF72970.1| superoxide dismutase [Achromobacter piechaudii ATCC 43553]
          Length = 224

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 111/205 (54%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E H+  HH+ Y  +       A +      E ++  
Sbjct: 21  MPYTLPTLPYAYDALEPHIDAMTMEIHYSKHHQTYVTSLNAALDGAGINTDEPVETLVAR 80

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH+LFW+ M   +G G+   AL+ AID + G    F+   
Sbjct: 81  LDQLPEAIRGAVRNHGGGHANHSLFWSVMSP-EGGGEPDGALAAAIDSDLGGLAAFRDAF 139

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FGSGW WLSV    KL I  + N ++PL++G  PILG+DVWEHAYYL ++ RR
Sbjct: 140 TKAALTRFGSGWAWLSVTPAGKLVIESSANQDSPLMHGNTPILGLDVWEHAYYLKYQNRR 199

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YI +F  N+V+W  V  RY  A 
Sbjct: 200 PEYIGAFY-NVVHWPEVARRYAAAK 223


>gi|311030755|ref|ZP_07708845.1| Superoxide dismutase [Bacillus sp. m3-13]
          Length = 296

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 75/202 (37%), Positives = 101/202 (50%), Gaps = 6/202 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP LPY Y+ L PY+S+E +E HH  HHK+Y D   K          + +  +IK   
Sbjct: 95  HTLPPLPYPYNALEPYISREIMELHHQKHHKSYVDGLNKAEMKMLEARETGDFDLIKHWE 154

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
                  + S +Y H +FW  M  N G     + L   I  +FGS+EKFK     AA   
Sbjct: 155 --REAAFHGSGHYLHTMFWDNMSPNGGGQPSGR-LMQQIVQDFGSYEKFKKHFSEAADKV 211

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            G GW  L       +LEI +T+  +       IP+LG+DVWEHAYYL +K  R  YI+ 
Sbjct: 212 EGVGWALLVWSPRAHRLEILQTEKQQLFTQWDTIPLLGLDVWEHAYYLQYKNNRKDYIDK 271

Query: 181 FITNLVNWEYVCERYETAMLAQ 202
              NLVNW+ V +RY+ A   +
Sbjct: 272 -WWNLVNWKDVEKRYQEASRLK 292


>gi|163856979|ref|YP_001631277.1| hypothetical protein Bpet2667 [Bordetella petrii DSM 12804]
 gi|163260707|emb|CAP43009.1| sodB [Bordetella petrii]
          Length = 192

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P++SKETLE+H+  HH+ Y  N   L    E  + SLE+I+ KS
Sbjct: 1   MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENASLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  +  N G       L+DAI+  +GSF+ FK     +A+
Sbjct: 61  SG---GVFNNAAQIWNHTFYWNSLAPNAGGAP-SGKLADAINAKWGSFDAFKEAFNKSAA 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL     P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 GNFGSGWTWLVKKADGSLDIVNTSNAATPLTTADKPLLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F   LVNW++  + + 
Sbjct: 177 NF-WALVNWDFAAKNFA 192


>gi|134642|sp|P22302|SODF_NICPL RecName: Full=Superoxide dismutase [Fe], chloroplastic
 gi|170235|gb|AAA34074.1| Fe-superoxide dismutase [Nicotiana plumbaginifolia]
          Length = 202

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 92/200 (46%), Positives = 120/200 (60%), Gaps = 5/200 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P+MS  T E+H   HH+ Y DN  K     E+   +LE+II+ ++ 
Sbjct: 2   FELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN 61

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  MK N G       L + I+ +FGS++ F  +   AA+
Sbjct: 62  KGAPLPAFNNAAQAWNHQFFWESMKPNGGGEP-SGELLELINRDFGSYDAFVKEFKAAAA 120

Query: 121 TQFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           TQFGSGW WL+ K    KL + KT NAENPL+ G  P+L IDVWEHAYYLDF+ RR  YI
Sbjct: 121 TQFGSGWAWLAYKPEEKKLALVKTPNAENPLVLGYTPLLTIDVWEHAYYLDFQNRRPDYI 180

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+  LV+WE V  R + A
Sbjct: 181 SIFMEKLVSWEAVSSRLKAA 200


>gi|261856335|ref|YP_003263618.1| superoxide dismutase [Halothiobacillus neapolitanus c2]
 gi|261836804|gb|ACX96571.1| Superoxide dismutase [Halothiobacillus neapolitanus c2]
          Length = 202

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y Y  L   +  +T+E H+  HH  Y  N     +  E    S+EEI+   
Sbjct: 1   MAFQLPELSYDYGALDKSIDAQTMEIHYSKHHGAYVTNCNNAIAGTEWDDKSIEEIMANV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH LFW+ +  N G       L+D I+  FGSF   K  + TA +
Sbjct: 61  SKLPPAVRNNGGGHFNHALFWSILSPNGGDAP-SGDLADDINATFGSFSALKDQMSTAGA 119

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL +   GKL +  T N +NP ++       PILGIDVWEHAYYL ++ RR 
Sbjct: 120 TRFGSGWAWLILDAQGKLAVCSTPNQDNPTMDIAEIKGTPILGIDVWEHAYYLRYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            Y+++ I ++++W+ V +RY  A 
Sbjct: 180 DYLKA-IWDVISWDAVGDRYAAAK 202


>gi|323136201|ref|ZP_08071283.1| Manganese/iron superoxide dismutase-like [Methylocystis sp. ATCC
           49242]
 gi|322398275|gb|EFY00795.1| Manganese/iron superoxide dismutase-like [Methylocystis sp. ATCC
           49242]
          Length = 198

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 98/199 (49%), Positives = 134/199 (67%), Gaps = 1/199 (0%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F L +LPY+YD L PY+S+E+ EYHHD HH  Y  NA  L    E     +EE+I+ +
Sbjct: 1   MSFTLEDLPYAYDALQPYLSRESFEYHHDKHHATYVTNANNLVKGTEYEGKPIEEVIVTA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              N  +FNN +Q+YNH+ +W  MK N G G +P  +   I ++FGS +KFK D      
Sbjct: 61  FNRNTPIFNNVAQHYNHHHYWKWMKPN-GGGAIPGKIEKLIVESFGSVDKFKEDFQKEGL 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW WL +K+GKL I KT NAENPL++GA P+L  DVWEH+YY+D++ RRA Y+++
Sbjct: 120 AQFGSGWVWLEMKDGKLAIRKTPNAENPLVHGAAPLLVADVWEHSYYIDYRNRRADYLKA 179

Query: 181 FITNLVNWEYVCERYETAM 199
           F+ +LVNWE+V E Y+ A+
Sbjct: 180 FLDHLVNWEHVEEMYDAAV 198


>gi|254293775|ref|YP_003059798.1| superoxide dismutase [Hirschia baltica ATCC 49814]
 gi|254042306|gb|ACT59101.1| Superoxide dismutase [Hirschia baltica ATCC 49814]
          Length = 196

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/199 (48%), Positives = 124/199 (62%), Gaps = 5/199 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P+MS  T  +HH  HH  Y  N  K+    +    SLEEII  S
Sbjct: 1   MAFELPALPYATDALEPHMSANTFSFHHAKHHNAYVTNLNKMIEGTDFAGKSLEEIIKSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  MK   G G+   A++D I+ +FGS+  FK    TA +
Sbjct: 61  DG---GVFNNAAQVWNHTFFWHSMKP-QGGGEPTGAIADKINADFGSYAAFKEAFATAGA 116

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHYIE 179
           TQFGSGW WL + NGKLE+ KT NAE PL      P+L +DVWEHAYYLD++  R  YIE
Sbjct: 117 TQFGSGWAWLVLANGKLEVRKTPNAETPLTEDGVTPLLTMDVWEHAYYLDYQNARPVYIE 176

Query: 180 SFITNLVNWEYVCERYETA 198
           +F++ LVNW++V +    A
Sbjct: 177 TFLSELVNWDFVNQNLADA 195


>gi|251787707|ref|YP_003002428.1| Superoxide dismutase [Dickeya zeae Ech1591]
 gi|247536328|gb|ACT04949.1| Superoxide dismutase [Dickeya zeae Ech1591]
          Length = 208

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 82/212 (38%), Positives = 117/212 (55%), Gaps = 16/212 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+    T+E HH  HH+ Y +NA        E   LS EE+I K
Sbjct: 1   MSYSLPSLPYAYDALEPHFDARTMEIHHSKHHQAYVNNANAALESLPEFAGLSAEELITK 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      L NNA  + NH+LFW  +K       +   L  AI+ +FGS ++FK+  
Sbjct: 61  LDQLPADKKGPLRNNAGGHANHSLFWKGLK---LGTTLEGELKAAIERDFGSIDEFKTKF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+ +DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGASGYPIIALDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAML 200
            ++ RR  YI++F   +VNW+   +R+  A  
Sbjct: 178 QYQNRRPDYIKAFWF-VVNWDEAAKRFAEAKK 208


>gi|170698600|ref|ZP_02889668.1| Superoxide dismutase [Burkholderia ambifaria IOP40-10]
 gi|170136453|gb|EDT04713.1| Superoxide dismutase [Burkholderia ambifaria IOP40-10]
          Length = 192

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-SGALGDAINAKWGSYDAFKEAFSKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|297581529|ref|ZP_06943452.1| superoxide dismutase [Vibrio cholerae RC385]
 gi|297534367|gb|EFH73205.1| superoxide dismutase [Vibrio cholerae RC385]
          Length = 222

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  L      E     L EI  + 
Sbjct: 18  MPHLFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARV 77

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + N+   YYNH ++W CMK N G       L+  I+  FGSF +FK     AA 
Sbjct: 78  STLPAAVRNHGGGYYNHIVYWNCMKPNGGGEP-QGELAAEIERQFGSFAQFKEAFSQAAV 136

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V+ G+L I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 137 NTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPE 196

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNWE V E Y  A+   
Sbjct: 197 YIDA-WWNVVNWEAVSENYAIALTQA 221


>gi|114797796|ref|YP_759425.1| superoxide dismutase, Fe [Hyphomonas neptunium ATCC 15444]
 gi|114737970|gb|ABI76095.1| superoxide dismutase, Fe [Hyphomonas neptunium ATCC 15444]
          Length = 220

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 88/201 (43%), Positives = 126/201 (62%), Gaps = 4/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII-- 58
           M F LP LPY+ + L+P++S+ETL +H+  HH+ Y  N   L    ++   SLEEII   
Sbjct: 19  MAFTLPELPYARNALAPHISEETLNFHYGKHHQAYVTNLNGLVEGTDLAGKSLEEIIKIS 78

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            +  S AG+FNN++Q +NH  +W  MK   G     +A ++ I+ + G ++ F  +   A
Sbjct: 79  AADKSKAGIFNNSAQVWNHTFYWHSMKPGGGGKPHGKA-AELIERDLGGYDAFVKEFKQA 137

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGA-IPILGIDVWEHAYYLDFKYRRAHY 177
            +TQFGSGW WLS K GKL ISKT NAE PL      P++ +DVWEHAYYLD++ RR  Y
Sbjct: 138 GATQFGSGWAWLSYKGGKLVISKTPNAETPLTEEGTTPLMTMDVWEHAYYLDYQNRRPDY 197

Query: 178 IESFITNLVNWEYVCERYETA 198
           I++F+ +LVNW++V +    A
Sbjct: 198 IDTFLGSLVNWDFVNQNLADA 218


>gi|82701635|ref|YP_411201.1| superoxide dismutase [Nitrosospira multiformis ATCC 25196]
 gi|82409700|gb|ABB73809.1| Superoxide dismutase [Nitrosospira multiformis ATCC 25196]
          Length = 205

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 86/195 (44%), Positives = 120/195 (61%), Gaps = 3/195 (1%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            + LP LPY+ + L P +S  TL +H+  HHK Y DN  KL +  ++  +SLEEII  + 
Sbjct: 10  PYVLPPLPYADNALDPVISANTLGFHYGKHHKTYVDNLNKLVAGTDLADMSLEEIITSTA 69

Query: 62  G--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
           G    AG+FNNA+Q +NH  +W  +    G G+ P +L   I+  FGS E  K +L TAA
Sbjct: 70  GKADKAGIFNNAAQVWNHTFYWNSLSP-KGGGEPPASLKQKIETAFGSVEVCKKELATAA 128

Query: 120 STQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           +TQFGSGW WL     +L++ KT NA+ PL  G  P+L IDVWEHAYYLD++ RR  Y+ 
Sbjct: 129 TTQFGSGWAWLVNDGDRLQVIKTGNADLPLTKGMKPLLTIDVWEHAYYLDYQNRRPDYVN 188

Query: 180 SFITNLVNWEYVCER 194
           + +  L+NW +  + 
Sbjct: 189 AVLDKLINWGFAADN 203


>gi|167856422|ref|ZP_02479145.1| manganese superoxide dismutase [Haemophilus parasuis 29755]
 gi|219871023|ref|YP_002475398.1| manganese superoxide dismutase [Haemophilus parasuis SH0165]
 gi|167852463|gb|EDS23754.1| manganese superoxide dismutase [Haemophilus parasuis 29755]
 gi|219691227|gb|ACL32450.1| manganese superoxide dismutase [Haemophilus parasuis SH0165]
 gi|299773431|gb|ADJ38790.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773443|gb|ADJ38796.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773445|gb|ADJ38797.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773449|gb|ADJ38799.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773451|gb|ADJ38800.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773453|gb|ADJ38801.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773455|gb|ADJ38802.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773459|gb|ADJ38804.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773463|gb|ADJ38806.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773465|gb|ADJ38807.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773467|gb|ADJ38808.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773469|gb|ADJ38809.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773471|gb|ADJ38810.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773473|gb|ADJ38811.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773475|gb|ADJ38812.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773477|gb|ADJ38813.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
 gi|299773479|gb|ADJ38814.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALDPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  +FGS E F+   
Sbjct: 61  LEQVPVEKRVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDFGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|311108799|ref|YP_003981652.1| superoxide dismutase (Mn) [Achromobacter xylosoxidans A8]
 gi|310763488|gb|ADP18937.1| superoxide dismutase (Mn) [Achromobacter xylosoxidans A8]
          Length = 204

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 109/204 (53%), Gaps = 8/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E H+  HH+ Y ++       A +      E ++  
Sbjct: 1   MAYTLPPLPYTYDALEPHIDAMTMEIHYSKHHQTYVNSLNAALEGAGIATDEPVESLVAR 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + N+   + NH+LFWA M   +G G+   AL+  I+   G    F+   
Sbjct: 61  LEQLPEAVRGAVRNHGGGHANHSLFWAVMSP-EGGGEPDGALAAVIEAELGGLAAFRDAF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             AA T+FGSGW WLSV    KL +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR
Sbjct: 120 TKAALTRFGSGWAWLSVTPAGKLTVESSANQDSPLMQGNTPILGLDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETA 198
             YI +F  N+VNW  V  RY  A
Sbjct: 180 PEYIGAFY-NVVNWPEVARRYAAA 202


>gi|73621932|sp|Q5FB30|SODM_MACNE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
 gi|58865326|dbj|BAD89542.1| superoxide dismutase [Macaca nemestrina]
          Length = 222

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 100/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSFEK+K  L  A+   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFEKYKEKLTAASVGV 142

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKERGQLQIAACLNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYMACKK 222


>gi|126723239|ref|NP_001075986.1| superoxide dismutase [Mn], mitochondrial precursor [Equus caballus]
 gi|12230617|sp|Q9XS41|SODM_HORSE RecName: Full=Superoxide dismutase [Mn], mitochondrial; AltName:
           Full=Mn-SOD; Flags: Precursor
 gi|4589878|dbj|BAA76922.1| manganese superoxide dismutase [Equus caballus]
          Length = 222

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L PY++ + ++ HH  HH  Y +N        +         +     
Sbjct: 26  HSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L DAI  +FGSF+KFK  L   ++  
Sbjct: 84  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGKLLDAIKRDFGSFDKFKEKLTAVSAGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  +   G+L+I    N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVSERYMACKK 222


>gi|115352642|ref|YP_774481.1| superoxide dismutase [Burkholderia ambifaria AMMD]
 gi|172061503|ref|YP_001809155.1| superoxide dismutase [Burkholderia ambifaria MC40-6]
 gi|115282630|gb|ABI88147.1| Superoxide dismutase [Burkholderia ambifaria AMMD]
 gi|171994020|gb|ACB64939.1| Superoxide dismutase [Burkholderia ambifaria MC40-6]
          Length = 192

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-SGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|295395382|ref|ZP_06805581.1| superoxide dismutase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971704|gb|EFG47580.1| superoxide dismutase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 208

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 102/203 (50%), Gaps = 6/203 (2%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + LP+LPY Y  L P++S + +E HHD HH  Y   A              +   I    
Sbjct: 5   YTLPDLPYDYAALEPHISAKIMELHHDKHHATYVKGANTALEQMAEAREKGDFSTI--GK 62

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
            +  L  N   + NH++FW  M   DG  K    L+ AIDD FG F+KF+      A++ 
Sbjct: 63  LSKDLSFNLGGHVNHSIFWNNMSP-DGGDKPEGELAAAIDDQFGGFDKFQGQFTGVATSI 121

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            GSGW  L       +L I +  + +  +  G +P+L +D+WEHA+YLD++  +  Y+++
Sbjct: 122 QGSGWAILGWDMLGQRLTIEQLYDQQGNVQVGYVPLLQLDMWEHAFYLDYQNVKPDYVKA 181

Query: 181 FITNLVNWEYVCERYETAMLAQK 203
              N+VNWE V  R++ A    K
Sbjct: 182 -WWNVVNWEDVAARFDRARNQTK 203


>gi|299773435|gb|ADJ38792.1| manganese-dependent superoxide dismutase [Haemophilus parasuis]
          Length = 206

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 112/208 (53%), Gaps = 15/208 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP L Y+YD L PY    T+E HH  HH+ Y +NA   L +  ++L     ++I  
Sbjct: 1   MAYTLPELDYTYDALEPYFDARTMEIHHSKHHQTYINNANIALEAYPDLLGQCPGKLISN 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH LFW  +K       +   L + I  + GS E F+   
Sbjct: 61  LEQVPVEKQVAVRNNVGGHVNHTLFWKGLKT---GTTLQGKLKETIIRDLGSVETFQEQF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +++GKL +  T N ++PL+          PILG+DVWEHAYYL 
Sbjct: 118 ELAATTRFGSGWAWLVLEDGKLSVVSTANQDSPLMGKDVAGVSGYPILGLDVWEHAYYLS 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYET 197
           ++ RR  YI++F  N+VNW+    R+E+
Sbjct: 178 YQNRRPDYIKAF-WNVVNWDEAARRFES 204


>gi|88853816|ref|NP_963285.2| superoxide dismutase [Mn], mitochondrial precursor [Bos taurus]
 gi|1174380|sp|P41976|SODM_BOVIN RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
 gi|86827690|gb|AAI05379.1| Superoxide dismutase 2, mitochondrial [Bos taurus]
          Length = 222

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYREALEKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF KFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-QGELLEAIKRDFGSFAKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY     
Sbjct: 203 A-IWNVINWENVTARYTACSK 222


>gi|253989408|ref|YP_003040764.1| superoxide dismutase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253780858|emb|CAQ84020.1| superoxide dismutase [fe] [Photorhabdus asymbiotica]
          Length = 192

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 115/197 (58%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L P++S ETLEYH+  HH  Y  N   L  D E    SLEEII  S
Sbjct: 1   MSFELPTLPYAKDALEPHISAETLEYHYGKHHNAYVVNLNNLIKDTEFAEKSLEEIIRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       +++AI  +FGSF +FK     AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWHCLSPNGGGEP-TGKIAEAISKSFGSFTEFKQQFTDAAV 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K    L I  T NA  PL +   PIL +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKKTDGSLAIVNTSNAAPPLASSDKPILTVDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYE 196
           SF   LVNW++V E   
Sbjct: 177 SF-WALVNWKFVEENLA 192


>gi|259047161|ref|ZP_05737562.1| Mn superoxide dismutase [Granulicatella adiacens ATCC 49175]
 gi|259036211|gb|EEW37466.1| Mn superoxide dismutase [Granulicatella adiacens ATCC 49175]
          Length = 202

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++LP L Y++D L P+    T+E HHD HH  Y  N          L     E ++  
Sbjct: 1   MTYELPKLEYAFDVLEPHFDARTMEIHHDKHHNAYVTNLNAAVEKHPELFEKTVEELVSD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NN   + NH+LFW  +  +  K     AL  AI++ FGSF++FK+  
Sbjct: 61  LNAVPEDIRVAVRNNGGGHANHSLFWTQLSLDGAKAP-EGALLAAINEAFGSFDEFKAAF 119

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
             AA+T+FGSGW WL + NGKLE+  T N +NPL  G  P+LG+DVWEHAYYL+++ RR 
Sbjct: 120 AQAAATRFGSGWAWLVLSNGKLEVVSTPNQDNPLSEGKTPLLGLDVWEHAYYLNYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  N+VNW+ V  R+E A 
Sbjct: 180 DYISAF-WNVVNWDEVARRFEAAK 202


>gi|206561094|ref|YP_002231859.1| superoxide dismutase SodB [Burkholderia cenocepacia J2315]
 gi|198037136|emb|CAR53057.1| superoxide dismutase SodB [Burkholderia cenocepacia J2315]
          Length = 192

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP LPY+ D L+P +SKET+EYH+  HH+ Y  N   L    E  +L LEEI+ KS
Sbjct: 1   MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  FW  +  N G      AL DAI+  +GS++ FK     AA 
Sbjct: 61  SG---GIFNNAAQIWNHTFFWNSLSPNGGGAP-TGALGDAINAKWGSYDAFKEAFTKAAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L+I  T NA  PL      +L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  N+VNW++  + + 
Sbjct: 177 AF-WNIVNWDFAAKNFA 192


>gi|14719528|pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146l Mutant
 gi|14719529|pdb|1EN6|B Chain B, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146l Mutant
 gi|14719530|pdb|1EN6|C Chain C, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146l Mutant
 gi|14719531|pdb|1EN6|D Chain D, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146l Mutant
          Length = 205

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 118/207 (57%), Gaps = 15/207 (7%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK- 59
            + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K 
Sbjct: 1   SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL F
Sbjct: 118 KAAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASGFPIMGLDVWEHAYYLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYET 197
           + RR  YI+ F  N+VNW+    R+  
Sbjct: 178 QNRRPDYIKEF-WNVVNWDEAAARFAA 203


>gi|260774702|ref|ZP_05883606.1| manganese superoxide dismutase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609358|gb|EEX35509.1| manganese superoxide dismutase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 205

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 84/206 (40%), Positives = 114/206 (55%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P LPY+YD L PY+  +T+E H+  HH+ Y D  +      E+   SL +I    
Sbjct: 1   MSHTFPELPYAYDSLEPYIDAKTMEVHYSKHHRTYFDKFVAAVKGTELEDASLSDIFANI 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
              +  + NN   YYNH L+W CM      G+    L+  ID  FG FE+FKS    AA 
Sbjct: 61  SQHSPAVRNNGGGYYNHILYWNCMAP-GAGGEPEGELAKEIDATFGGFEQFKSLFAEAAI 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL VK+GKL I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFAWLVVKDGKLHIASTSNQDNPLMDVASVQGEPILALDVWEHAYYISYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNW+ V E Y  A+   
Sbjct: 180 YIDA-WWNVVNWDVVSENYAVALAQN 204


>gi|193216075|ref|YP_001997274.1| superoxide dismutase [Chloroherpeton thalassium ATCC 35110]
 gi|193089552|gb|ACF14827.1| Superoxide dismutase [Chloroherpeton thalassium ATCC 35110]
          Length = 200

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 85/201 (42%), Positives = 124/201 (61%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LPY  + L P++S  TLE+H+  HH  Y         D     + LE++I  +
Sbjct: 1   MAYEQPKLPYELNALEPHISANTLEFHYGKHHAAYVTKYNGFVKDTPYDKMPLEDVIKAT 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNN +Q +NH+ +W C+  N G       ++D I+++ GS+E F +    A
Sbjct: 61  AGDASKAGIFNNGAQAWNHSFYWNCLSPNGGGAP-TGKIADKINEDCGSYENFVAAFKDA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +  GKL+I+KT NA NP+  G   +L +DVWEHAYYLD++ RR  YI
Sbjct: 120 AATQFGSGWAWLVLDGGKLKITKTLNAANPMTEGQTTLLTLDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
           ++F+  LVNW++V +  E AM
Sbjct: 180 QTFLEKLVNWDFVNQNLEAAM 200


>gi|145630179|ref|ZP_01785961.1| superoxide dismutase (Mn) [Haemophilus influenzae R3021]
 gi|144984460|gb|EDJ91883.1| superoxide dismutase (Mn) [Haemophilus influenzae R3021]
          Length = 211

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 115/210 (54%), Gaps = 17/210 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+Y+ L P+   +T+E HH  HH+ Y +NA           + +       
Sbjct: 1   MSYTLPELGYAYNALEPHFDAQTMEIHHSKHHQAYVNNANAALEGLPAELVEMYPGHLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
            +          L NNA  + NH+LFW  +KK      +  AL DAI+ +FGS + FK++
Sbjct: 61  NLDKIPAEKRGALRNNAGGHTNHSLFWKSLKK---GTTLQGALKDAIERDFGSVDAFKAE 117

Query: 115 LITAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYY 167
              AA+T+FGSGW WL     GKL +  T N +NPL+          P+LG+DVWEHAYY
Sbjct: 118 FEKAAATRFGSGWAWLVLTAEGKLAVVSTANQDNPLMGKEVAGCEGFPLLGLDVWEHAYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYET 197
           L F+ RR  YI+ F  N+VNW++V ER+E 
Sbjct: 178 LKFQNRRPDYIKEF-WNVVNWDFVAERFEQ 206


>gi|15778185|gb|AAL07333.1| superoxide dismutase [Raphanus sativus]
          Length = 231

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 63/202 (31%), Positives = 94/202 (46%), Gaps = 9/202 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F LP+LPY Y  L P +S E ++ HH  HH+ Y  N        +              
Sbjct: 30  TFTLPDLPYDYSALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKG--DASAVV 87

Query: 62  GSNAGLFNNASQYYNHNLFWACMKK--NDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              + +  N   + NH++FW  +      G      +L  AID +FGS E     +    
Sbjct: 88  KLQSAIKFNGGGHVNHSIFWKNLAPVKEGGGEPPKGSLGGAIDTSFGSLEGLVKKMSAEG 147

Query: 120 STQFGSGWGWLSVKN--GKLEISKTQNAENPLINGA--IPILGIDVWEHAYYLDFKYRRA 175
           +   GSGW WL +     KL +  T N +  +  G   +P++GIDVWEHAYYL +K  R 
Sbjct: 148 AAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRP 207

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+++ +  ++NW+Y  E YE 
Sbjct: 208 DYLKN-VWKVINWKYASEVYEK 228


>gi|145627947|ref|ZP_01783748.1| superoxide dismutase (Mn) [Haemophilus influenzae 22.1-21]
 gi|145632453|ref|ZP_01788188.1| superoxide dismutase (Mn) [Haemophilus influenzae 3655]
 gi|145638098|ref|ZP_01793708.1| superoxide dismutase (Mn) [Haemophilus influenzae PittII]
 gi|145640773|ref|ZP_01796356.1| superoxide dismutase (Mn) [Haemophilus influenzae R3021]
 gi|229843873|ref|ZP_04464014.1| superoxide dismutase (Mn) [Haemophilus influenzae 6P18H1]
 gi|229846120|ref|ZP_04466232.1| superoxide dismutase (Mn) [Haemophilus influenzae 7P49H1]
 gi|260581859|ref|ZP_05849655.1| superoxide dismutase [Haemophilus influenzae NT127]
 gi|435653|emb|CAA52054.1| manganese superoxide dismutase [Haemophilus influenzae]
 gi|144979722|gb|EDJ89381.1| superoxide dismutase (Mn) [Haemophilus influenzae 22.1-21]
 gi|144987360|gb|EDJ93890.1| superoxide dismutase (Mn) [Haemophilus influenzae 3655]
 gi|145272427|gb|EDK12334.1| superoxide dismutase (Mn) [Haemophilus influenzae PittII]
 gi|145274699|gb|EDK14562.1| superoxide dismutase (Mn) [Haemophilus influenzae 22.4-21]
 gi|229811124|gb|EEP46841.1| superoxide dismutase (Mn) [Haemophilus influenzae 7P49H1]
 gi|229812867|gb|EEP48555.1| superoxide dismutase (Mn) [Haemophilus influenzae 6P18H1]
 gi|260095052|gb|EEW78944.1| superoxide dismutase [Haemophilus influenzae NT127]
 gi|301169829|emb|CBW29433.1| superoxide dismutase, Mn [Haemophilus influenzae 10810]
 gi|309751264|gb|ADO81248.1| Superoxide dismutase [Haemophilus influenzae R2866]
          Length = 211

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 115/210 (54%), Gaps = 17/210 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+Y+ L P+   +T+E HH  HH+ Y +NA           + +       
Sbjct: 1   MSYTLPELGYAYNALEPHFDAQTMEIHHSKHHQAYVNNANAALEGLPAELVEMYPGHLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
            +          L NNA  + NH+LFW  +KK      +  AL DAI+ +FGS + FK++
Sbjct: 61  NLDKIPAEKRGALRNNAGGHTNHSLFWKSLKK---GTTLQGALKDAIERDFGSVDAFKAE 117

Query: 115 LITAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYY 167
              AA+T+FGSGW WL     GKL +  T N +NPL+          P+LG+DVWEHAYY
Sbjct: 118 FEKAAATRFGSGWAWLVLTAEGKLAVVSTANQDNPLMGKEVAGCEGFPLLGLDVWEHAYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYET 197
           L F+ RR  YI+ F  N+VNW++V ER+E 
Sbjct: 178 LKFQNRRPDYIKEF-WNVVNWDFVAERFEQ 206


>gi|312838461|gb|ADR01298.1| iron-superoxide dismutase [Ceratopteris thalictroides]
          Length = 266

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/212 (45%), Positives = 123/212 (58%), Gaps = 12/212 (5%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+F L  LP+  D L PYMSK+TLE+H   HH+ Y DN  K     E+  + L+E++   
Sbjct: 40  MEFHLRPLPFEMDALEPYMSKQTLEFHWGKHHRTYVDNLNKQIKGTELEGMQLDELLKHG 99

Query: 61  H--GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
           +  G+    FNNA Q +NH+ FW  +K   GK    + L   I+ +FGSFE F  +   A
Sbjct: 100 YNNGNPTAYFNNAGQAWNHDFFWESIKPGGGKKPTGEVL-HLIERDFGSFEAFVDEFKQA 158

Query: 119 ASTQFGSGWGWL---------SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLD 169
           A+TQFGSGW WL           K GKL I KT NA NPLI G +P+L IDVWEHAYYLD
Sbjct: 159 AATQFGSGWAWLVGMPTDPLVENKFGKLAIEKTPNALNPLILGHVPLLTIDVWEHAYYLD 218

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           ++ RR  YI + I  L++WE V  R E A   
Sbjct: 219 YQNRRPDYISTVINELISWEAVTARLERAKAT 250


>gi|283480390|emb|CAY76306.1| superoxide dismutase, manganese [Erwinia pyrifoliae DSM 12163]
          Length = 208

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 80/199 (40%), Positives = 115/199 (57%), Gaps = 14/199 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA       E  +L +EE+I K 
Sbjct: 4   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+ FW  +K     G     L  AI+ +FGS + FK++  
Sbjct: 64  DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGG---DLKAAIEKDFGSVDAFKAEFE 120

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+T+FGSGW WL  K  KL +  T N ++PL+          PI+G+DVWEHAYYL +
Sbjct: 121 KAATTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIVGLDVWEHAYYLKY 180

Query: 171 KYRRAHYIESFITNLVNWE 189
           + +R  YI++F  ++VNW+
Sbjct: 181 QNKRPDYIKAF-WDVVNWD 198


>gi|78188935|ref|YP_379273.1| superoxide dismutase [Chlorobium chlorochromatii CaD3]
 gi|78171134|gb|ABB28230.1| superoxide dismutase [Chlorobium chlorochromatii CaD3]
          Length = 198

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 88/199 (44%), Positives = 124/199 (62%), Gaps = 3/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M ++ P LPY+   L P++S  TL +H+  HH  Y  N   L +      +SLEE+I++ 
Sbjct: 1   MAYQQPPLPYADTALEPHISANTLSFHYGKHHVTYITNYNNLVAGTPFESMSLEEVIMQT 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            +  +   +FNNA+Q +NH  +W C+  N G GK   AL+D I+ +FGSF+KFK +L  A
Sbjct: 61  ANDAAKVAIFNNAAQAWNHTFYWNCLSPN-GGGKPTGALADKIEADFGSFDKFKEELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A TQFGSGW WL ++   L+I KT NA+ PL +   P+L IDVWEHAYYLDF+ RR  Y+
Sbjct: 120 AVTQFGSGWAWLVLEGETLKIVKTGNAQTPLTSAQKPLLTIDVWEHAYYLDFQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYET 197
            + I NL+NWE+    +  
Sbjct: 180 SAVIENLLNWEFAAANFAQ 198


>gi|17390379|gb|AAH18173.1| Sod2 protein [Mus musculus]
          Length = 218

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 101/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 22  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKG--DVTTQVA 79

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +    G G+    L +AI  +FGSFEKFK  L   +   
Sbjct: 80  LQPALKFNGGGHINHTIFWTNLSP-KGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGV 138

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 139 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 198

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 199 A-IWNVINWENVTERYTACKK 218


>gi|54298972|ref|YP_125341.1| superoxide dismutase, iron [Legionella pneumophila str. Paris]
 gi|148361308|ref|YP_001252515.1| superoxide dismutase [Legionella pneumophila str. Corby]
 gi|296108648|ref|YP_003620349.1| Superoxide dismutase [Legionella pneumophila 2300/99 Alcoy]
 gi|53752757|emb|CAH14192.1| superoxide dismutase, iron [Legionella pneumophila str. Paris]
 gi|148283081|gb|ABQ57169.1| superoxide dismutase [Legionella pneumophila str. Corby]
 gi|295650550|gb|ADG26397.1| Superoxide dismutase [Legionella pneumophila 2300/99 Alcoy]
          Length = 192

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G     + L++AI+ +FGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGGGEPKGR-LAEAINKSFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL       L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++     +
Sbjct: 177 AF-WSLVNWDFASSNLK 192


>gi|218439198|ref|YP_002377527.1| superoxide dismutase [Cyanothece sp. PCC 7424]
 gi|218171926|gb|ACK70659.1| Superoxide dismutase [Cyanothece sp. PCC 7424]
          Length = 241

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 78/200 (39%), Positives = 109/200 (54%), Gaps = 8/200 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            FKLP LPYSY+ L PY+ +ET+ +HHD HH  Y        S    L +   E ++   
Sbjct: 39  PFKLPPLPYSYNALEPYIDEETMRFHHDKHHAGYTKKFNAAISKYPDLKIQSAEELLSNI 98

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     +  N   Y NH +FW  M  N G       +++AI+  FGSFE FK+   
Sbjct: 99  DKLPKNIQTTVRQNGGGYLNHAIFWEIMSPNGGGQP-TGEIAEAINQEFGSFEAFKNAFN 157

Query: 117 TAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A +++FGSGW WL   K GKL++  T N ++PL+ G  PI+G DVWEHAYYL ++  R 
Sbjct: 158 EAGNSRFGSGWAWLVLDKKGKLQVVSTPNQDSPLMEGMYPIMGNDVWEHAYYLKYRNDRG 217

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y++    N+VNW  V +R+
Sbjct: 218 QYLQQ-WWNVVNWNEVNKRF 236


>gi|31980762|ref|NP_038699.2| superoxide dismutase [Mn], mitochondrial precursor [Mus musculus]
 gi|3041732|sp|P09671|SODM_MOUSE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags:
           Precursor
 gi|288505|emb|CAA79308.1| manganese superoxide dismutase [Mus musculus]
 gi|1037120|gb|AAB34899.1| manganese superoxide dismutase [Mus sp.]
 gi|12832407|dbj|BAB22095.1| unnamed protein product [Mus musculus]
 gi|12832587|dbj|BAB22170.1| unnamed protein product [Mus musculus]
 gi|12849042|dbj|BAB28183.1| unnamed protein product [Mus musculus]
 gi|14714799|gb|AAH10548.1| Superoxide dismutase 2, mitochondrial [Mus musculus]
 gi|71059875|emb|CAJ18481.1| Sod2 [Mus musculus]
 gi|74183164|dbj|BAE22531.1| unnamed protein product [Mus musculus]
 gi|74207618|dbj|BAE40055.1| unnamed protein product [Mus musculus]
 gi|74219733|dbj|BAE40460.1| unnamed protein product [Mus musculus]
 gi|148670071|gb|EDL02018.1| superoxide dismutase 2, mitochondrial, isoform CRA_a [Mus musculus]
          Length = 222

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 101/201 (50%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKG--DVTTQVA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +    G G+    L +AI  +FGSFEKFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHTIFWTNLSP-KGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ERY     
Sbjct: 203 A-IWNVINWENVTERYTACKK 222


>gi|186475308|ref|YP_001856778.1| superoxide dismutase [Burkholderia phymatum STM815]
 gi|184191767|gb|ACC69732.1| Superoxide dismutase [Burkholderia phymatum STM815]
          Length = 192

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 85/197 (43%), Positives = 121/197 (61%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M+  LP LP++ + L+P+MS+ETLE+H+  HH+ Y  N   L    E   LSLEEI+ KS
Sbjct: 1   MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFESLSLEEIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNN++Q +NH  FW  +    G      AL+DAI+  +GSF+KFK +    A 
Sbjct: 61  SG---GVFNNSAQVWNHTFFWNSLSPQGGGAP-KGALADAINAKWGSFDKFKEEFTKTAV 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL  K +G L++  T NA  PL   A P+L IDVWEHAYY+D++  R  ++E
Sbjct: 117 GTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVE 176

Query: 180 SFITNLVNWEYVCERYE 196
           ++  N+VNW +  + + 
Sbjct: 177 AY-WNIVNWAFAEKNFA 192


>gi|300113411|ref|YP_003759986.1| superoxide dismutase [Nitrosococcus watsonii C-113]
 gi|299539348|gb|ADJ27665.1| Superoxide dismutase [Nitrosococcus watsonii C-113]
          Length = 193

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 87/198 (43%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M  +LP LPY+ + L P++S+ETLEYH+  HH+ Y D    L    E  + SLEEII K+
Sbjct: 1   MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G    LFNN +Q +NH  +W C+    G G+    L +AI+ NFGSF  FK     +A+
Sbjct: 61  SG---TLFNNGAQVWNHTFYWNCLAP-QGGGEPSGTLLEAIEKNFGSFSDFKEKFSQSAT 116

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL   +   L+I  T NA NPL  G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 117 TLFGSGWAWLVKNSDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
           +F   L NW++V +    
Sbjct: 177 AF-WKLANWDFVAKNLAN 193


>gi|75907667|ref|YP_321963.1| manganese and iron superoxide dismutase [Anabaena variabilis ATCC
           29413]
 gi|75701392|gb|ABA21068.1| Manganese and iron superoxide dismutase [Anabaena variabilis ATCC
           29413]
          Length = 270

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 70/206 (33%), Positives = 104/206 (50%), Gaps = 8/206 (3%)

Query: 4   KLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK---- 59
           +LP LPY YD L   +  ET++ HHD HH  Y +N          L  S  E +++    
Sbjct: 67  ELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNS 126

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   + NN   + NH +FW  M  N G       ++  I+  FG+FE+FK     A
Sbjct: 127 VPEDIRNTVRNNGGGHLNHTIFWQIMSPNGGGQP-TGDIAQEINQTFGNFEEFKKQFNKA 185

Query: 119 ASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
              +FGSGW WL      +L+I  T N ++P+  G+ PI+G DVWEHAYYL ++ RR  Y
Sbjct: 186 GGDRFGSGWVWLVRNPQGQLQIVSTPNQDSPIAEGSYPIMGNDVWEHAYYLRYQNRRPEY 245

Query: 178 IESFITNLVNWEYVCERYETAMLAQK 203
           + +   N+VNW  + +R + +  +  
Sbjct: 246 LNN-WWNVVNWSEINKRAQASRQSNS 270


>gi|197128247|gb|ACH44745.1| putative mitochondrial superoxide dismutase 2 variant 1
           [Taeniopygia guttata]
          Length = 226

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HTLPDLPYDYGALEPHINAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKG--DVTTQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF  FK  L   +   
Sbjct: 88  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 146

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY T   
Sbjct: 207 A-IWNVINWENVSSRYATCKK 226


>gi|300122458|emb|CBK23029.2| unnamed protein product [Blastocystis hominis]
          Length = 608

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 9/198 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + LP LPY+ D L P +S ET++YH+  HH+ Y +N   L         +  E +IK+  
Sbjct: 408 YVLPELPYARDALEPSISAETIDYHYGKHHQTYVNNLNNLLP----EGGAPLEELIKTAE 463

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               +FNNA+Q +NH  +W C+  + G      AL  AI+  +GS++ F  +L     + 
Sbjct: 464 GG--VFNNAAQIWNHTFYWNCLC-HGGCPLEDGALKTAIEAKWGSYDAFIKELSAKTVSF 520

Query: 123 FGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESF 181
           FGSGW WL  K +G L+I  T NA NPL +G  P+L  DVWEHAYY+D++  RA+Y   +
Sbjct: 521 FGSGWSWLVQKADGSLDIVCTANAGNPLRDGMKPLLCCDVWEHAYYIDYRNARANYFNKW 580

Query: 182 ITNLVNWEYVCERYETAM 199
           +  +VNW++V + +   +
Sbjct: 581 L-EVVNWKFVAQNFAWCV 597


>gi|291296012|ref|YP_003507410.1| Superoxide dismutase [Meiothermus ruber DSM 1279]
 gi|290470971|gb|ADD28390.1| Superoxide dismutase [Meiothermus ruber DSM 1279]
          Length = 201

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 79/200 (39%), Positives = 112/200 (56%), Gaps = 8/200 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK-- 59
            FKLP L Y  D L P++  +T+E HH  HH  Y +N          LH    E ++   
Sbjct: 4   PFKLPELAYPKDALEPHIDAQTMEIHHGKHHAAYVNNLNAALEKHPELHSWSLEDLLTKI 63

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   ++NH LFW  +     K      L++AI+  FGSFE+ K+ L 
Sbjct: 64  NQVPEDIRTAVRNNGGGHHNHTLFWDILTPGGSKEP-TGKLAEAINATFGSFEELKAKLT 122

Query: 117 TAASTQFGSGWGWL-SVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A +T+FGSGW WL   K+GKL++  T N ++PL+ G  P+LGIDVWEHAYYL ++ RR 
Sbjct: 123 QAGATRFGSGWAWLVKDKDGKLQVYSTANQDSPLMEGHTPLLGIDVWEHAYYLKYQNRRP 182

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+ + I N++NW+ V ER+
Sbjct: 183 DYLAA-IWNVINWDKVAERF 201


>gi|126662278|ref|ZP_01733277.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
 gi|126625657|gb|EAZ96346.1| superoxide dismutase, manganese [Flavobacteria bacterium BAL38]
          Length = 332

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F    LPY Y DL P++  +T+E H+  HH  Y  N  K         LSL EI+ K   
Sbjct: 21  FSQKALPYGYSDLEPFVDAQTMEIHYSKHHAGYVKNLNKALEGTADEKLSLTEILAKVSI 80

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
            +  + NNA  +YNH LFW  +   +   K+   L  A+ + FGSFE  K  L  A +T+
Sbjct: 81  LSTAIRNNAGGHYNHELFW-SVLTPEKNTKMSAELEKAVIETFGSFEVLKEKLNAAGATR 139

Query: 123 FGSGWGWLSV-KNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V K GKL IS T N +NPL++       PI GIDVWEHAYYL ++ +RA Y
Sbjct: 140 FGSGWAWLVVTKEGKLVISSTANQDNPLMDNAEVKGTPIFGIDVWEHAYYLKYQNKRADY 199

Query: 178 IESFITNLVNWEYVCERYETAM 199
           + + + N+VNW  V +RY+ AM
Sbjct: 200 LSA-LWNVVNWTEVSKRYKAAM 220


>gi|163867903|ref|YP_001609107.1| hypothetical protein Btr_0682 [Bartonella tribocorum CIP 105476]
 gi|161017554|emb|CAK01112.1| Superoxide dismutase [Bartonella tribocorum CIP 105476]
          Length = 200

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 112/196 (57%), Positives = 144/196 (73%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YD LSPYMS+ETLEYHHD HH  Y  N   L  DA + + SLEEI+  S
Sbjct: 1   MAFELAALPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNLIKDAGLENESLEEIVKTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK+ G  K+P+ L+ AI+ + G ++KF++D I A  
Sbjct: 61  FGKNIGLFNNAAQYYNHNHFWNWMKKDGGGQKLPEKLAKAIESDLGGYDKFRADFIAAGG 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VKNGKLEI KT N ENPL++ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWVAVKNGKLEIMKTLNGENPLVHDAQPILGVDVWEHSYYIDYRNARPKYLEA 180

Query: 181 FITNLVNWEYVCERYE 196
           F+ +L+NW+YV + YE
Sbjct: 181 FVDHLINWDYVLKLYE 196


>gi|56964938|ref|YP_176669.1| manganese superoxide dismutase [Bacillus clausii KSM-K16]
 gi|56911181|dbj|BAD65708.1| manganese superoxide dismutase [Bacillus clausii KSM-K16]
          Length = 206

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 80/204 (39%), Positives = 116/204 (56%), Gaps = 7/204 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
              LP L +++D L P + ++T+E HH  HH+ Y  N      +   L     E ++ + 
Sbjct: 3   THSLPELGFAFDALEPTIDRKTMEIHHGKHHQTYVTNLNAALENEPSLQSQSLEQLLANI 62

Query: 62  GS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
            S        + NN   + NH+LFW  +    G  ++  AL +AID  FGSFE FK    
Sbjct: 63  ESLPASIQTPVRNNGGGHLNHSLFWQVIAPLKGANEMSAALKEAIDQAFGSFEGFKETFT 122

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA+T+FGSGW WL V   K LE+  T N +NP+++G   ILG+DVWEHAYYL+++ +R 
Sbjct: 123 KAATTRFGSGWAWLVVNESKELEVYSTANQDNPIMDGKQAILGLDVWEHAYYLNYQNKRP 182

Query: 176 HYIESFITNLVNWEYVCERYETAM 199
            YI +F  +++NWE V E YE A+
Sbjct: 183 EYIANFF-SIINWEAVSEAYEKAI 205


>gi|238763386|ref|ZP_04624349.1| Superoxide dismutase [Mn] [Yersinia kristensenii ATCC 33638]
 gi|238763467|ref|ZP_04624429.1| Superoxide dismutase [Mn] [Yersinia kristensenii ATCC 33638]
 gi|238698249|gb|EEP91004.1| Superoxide dismutase [Mn] [Yersinia kristensenii ATCC 33638]
 gi|238698330|gb|EEP91084.1| Superoxide dismutase [Mn] [Yersinia kristensenii ATCC 33638]
          Length = 244

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA  +      L     E +IK 
Sbjct: 38  MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD 97

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH+LFW  +K       +   L  AI+ +FGS + FK   
Sbjct: 98  LDKVPAEKRTFMRNNAGGHANHSLFWKGLK---LGTTLTGDLKAAIERDFGSVDSFKEKF 154

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 155 EQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYL 214

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAM 199
            F+ RR  YI++F  N+VNW+    R+  A 
Sbjct: 215 KFQNRRPDYIKAF-WNVVNWDEAAARFAQAK 244


>gi|94983871|gb|ABF50548.1| mitochondrial mangenese superoxide dismutase [Anguilla anguilla]
          Length = 221

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 98/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P++S E  + HH  HH  Y +N        +         +     
Sbjct: 25  HTLPDLTYDYGALEPHISAEITQLHHSKHHATYVNNLNVTEEKYKEALAKG--DVTAQVA 82

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSFEK +  +  A+   
Sbjct: 83  LQPALKFNGGGHVNHTIFWTNLSPNGGGEP-QGELMEAIKRDFGSFEKLREKMSMASVAV 141

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL       +L ++   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 142 QGSGWGWLGYDKESGRLRVAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 201

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+VNWE + ER+++A  
Sbjct: 202 A-IWNVVNWENITERFQSAKK 221


>gi|115522220|ref|YP_779131.1| superoxide dismutase [Rhodopseudomonas palustris BisA53]
 gi|115516167|gb|ABJ04151.1| Superoxide dismutase [Rhodopseudomonas palustris BisA53]
          Length = 245

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 111/207 (53%), Gaps = 9/207 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F LP LPY    L P++  +T+E HH  HH+ Y  N    A D   L       ++ + 
Sbjct: 39  PFTLPPLPYPVAALEPHIDAKTMEIHHGKHHQAYVSNLNNFAKDNPKLAQLPVPEVLGNL 98

Query: 62  GS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           G        G+ NN   + NH +FW  M  N   GK    +  AID + G  EKF++D  
Sbjct: 99  GDVPESIRTGVRNNLGGHANHTMFWEIMGPN--GGKPSGDVLAAIDRDLGGMEKFQTDFN 156

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A   QFGSGW +++V K+GKL I    N +NP+++G   +LG DVWEHAYYL+++ RRA
Sbjct: 157 AAGGRQFGSGWVFVTVSKDGKLAIETRPNQDNPMMDGKRVLLGNDVWEHAYYLNYQNRRA 216

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            Y+++   N VNW  + ERY  A   +
Sbjct: 217 DYLKA-WWNTVNWSKIGERYAAAKAGK 242


>gi|59858341|gb|AAX09005.1| superoxide dismutase 2, mitochondrial [Bos taurus]
          Length = 222

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYREALEKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF KFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-QGELLEAIKRDFGSFAKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY     
Sbjct: 203 A-IWNVINWENVTARYTACSK 222


>gi|256665379|gb|ACV04835.1| mitochondrial superoxide dismutase 2 [Ovis aries]
          Length = 222

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N                  +     
Sbjct: 26  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYREALEKG--DVTAQIA 83

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF KFK  L   +   
Sbjct: 84  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFAKFKEKLTAVSVGV 142

Query: 123 FGSGWGWL--SVKNGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  + + G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 143 QGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 202

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY     
Sbjct: 203 A-IWNVINWENVTARYTACSK 222


>gi|44662786|gb|AAS47494.1| iron superoxide dismutase [Pinus pinaster]
          Length = 249

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 3/200 (1%)

Query: 5   LPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH--G 62
           L   PY +D L P+MSK+TL +H   HH+ Y DN      D E+   +LE+II K++  G
Sbjct: 50  LNPPPYDFDALEPHMSKQTLSFHWGKHHRAYVDNCNNQIKDTELEECTLEDIIKKTYNNG 109

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               +FNNA+Q +NH  FW CMK   GK      + + I  +FG++++F  +   A++TQ
Sbjct: 110 DPRPVFNNAAQAWNHEFFWECMKPGGGKEP-KGEILELIKRDFGAYDEFLKEFKQASATQ 168

Query: 123 FGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFI 182
           FGSGW WL +K+ KL I KT NA NPLI G  P+L IDVWEHAYYLD++ RR  YI +F+
Sbjct: 169 FGSGWAWLVLKDNKLVIEKTPNALNPLIWGHKPLLTIDVWEHAYYLDYQNRRPDYISTFM 228

Query: 183 TNLVNWEYVCERYETAMLAQ 202
             LV+W+ V  R + A  + 
Sbjct: 229 NELVSWDAVNARLDRAKASA 248


>gi|308445782|ref|XP_003087017.1| CRE-SOD-3 protein [Caenorhabditis remanei]
 gi|308268898|gb|EFP12851.1| CRE-SOD-3 protein [Caenorhabditis remanei]
          Length = 203

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/205 (41%), Positives = 119/205 (58%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N            LS+EE++ K 
Sbjct: 1   MAYSLPQLPYAYDALEPNIDTKTMEIHHTKHHQTYINNINATVEGTAWEKLSIEELVSKV 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +         + NN   + NH+LFW  M    G   + Q +++AID + G FEKFK    
Sbjct: 61  NEVPADLKNSVINNGGGHANHSLFWTVMSPQGGGEPIKQ-IAEAIDRDIGGFEKFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV    K+ +  + N ++PL+NG IP+L +DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPEKKVIVESSANQDSPLMNGNIPVLALDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+VNWE V  RY  A+ 
Sbjct: 180 EYIAAFY-NVVNWEEVNRRYLEAIQ 203


>gi|209964366|ref|YP_002297281.1| superoxide dismutase (Mn) [Rhodospirillum centenum SW]
 gi|209957832|gb|ACI98468.1| superoxide dismutase (Mn) [Rhodospirillum centenum SW]
          Length = 208

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 111/210 (52%), Gaps = 8/210 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALK-LASDAEMLHLSLEEIIIK 59
           M F LP+L Y    L P++  +T+  HH  HH+ Y  N    LA  +++  LSL +++ +
Sbjct: 1   MAFTLPDLTYDVTALEPHIDAQTMGLHHGKHHQAYVTNLNNALAEHSQLHGLSLTDLLKR 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                 G    + NN   + NH++FW  M  N G      A+ +AI  +FG+FE FK   
Sbjct: 61  LGELPEGIRTAVRNNGGGHANHSMFWTIMGPNGGGEP-TGAVGEAIARDFGAFEDFKKKF 119

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
             A + QFGSGW +++V    KLEI    N + PL++G   ++G DVWEHAYYL ++ RR
Sbjct: 120 NEAGTKQFGSGWVFVTVDPAGKLEIVARPNQDTPLMDGKPVLMGNDVWEHAYYLKYQNRR 179

Query: 175 AHYIESFITNLVNWEYVCERYETAMLAQKV 204
           A Y+ +   N VNW  V ER         +
Sbjct: 180 ADYLAA-WWNTVNWTAVNERLSAIRNGGVL 208


>gi|282922265|gb|ABC71306.2| manganese superoxide dismutase [Rachycentron canadum]
          Length = 225

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 96/201 (47%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 29  HTLPDLTYDYGALEPHINAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVA 86

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF+K K  +  A    
Sbjct: 87  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-QGELMEAIKRDFGSFQKMKEKMSAATVAV 145

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL        L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 146 QGSGWGWLGYDKESGTLRIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 205

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N+++WE V ER +TA  
Sbjct: 206 A-IWNVISWENVAERLQTAKK 225


>gi|315023989|gb|EFT36991.1| Manganese superoxide dismutase [Riemerella anatipestifer RA-YM]
          Length = 198

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 113/202 (55%), Gaps = 9/202 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++  +T+E HH  HH+ Y DN  K  +  E+   S  E + + 
Sbjct: 1   MSFELPKLGYAYDALEPHIDAKTMEIHHTKHHQAYIDNLNKAIAGTELEGKS-IEEVCQL 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH LFW  +     K      + + I+   G F+KFK+D   AA 
Sbjct: 60  GSDKPAVRNNGGGHFNHTLFWEVLTPGGSKEP-VGKVKEEIEK-MGGFDKFKTDFSEAAK 117

Query: 121 TQFGSGWGWLS-VKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL  + +G LE+  + N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 118 TRFGSGWAWLCKMPDGSLEVCSSANQDNPLMPNVGCGGTPILGLDVWEHAYYLNYQNRRP 177

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F   ++NW+ V E Y  
Sbjct: 178 DYVTAFF-EVINWDKVEENYNK 198


>gi|312219461|emb|CBX99405.1| hypothetical protein [Leptosphaeria maculans]
          Length = 392

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 66/200 (33%), Positives = 97/200 (48%), Gaps = 10/200 (5%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           + LP LPY+YD L P++SK+ +E HH  HH+ Y  N             +    I     
Sbjct: 181 YSLPPLPYAYDALEPHISKQIMELHHGKHHQTYITNLNAALKTQAEAVQTS--DITSQVS 238

Query: 63  SNAGLFNNASQYYNHNLFWACMKK---NDGKGKVPQALSDAIDDNFGSFEKFKSDLITAA 119
              G+  NA  + NH+LFW  +      + K      L   I   +G   KFK     A 
Sbjct: 239 LQQGIKFNAGGHINHSLFWQNLAPASSPEAKSSAAPELVKQIKATWGDEAKFKEAFNAAL 298

Query: 120 STQFGSGWGWLSV----KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
               GSGWGWL      K  +L I  T++ +  +  G +PI G+D+WEHAYYL +   +A
Sbjct: 299 LGIQGSGWGWLIKVETGKEQRLAIVTTKDQDPVVGKGEVPIFGVDMWEHAYYLQYLNGKA 358

Query: 176 HYIESFITNLVNWEYVCERY 195
            Y+++ I N++NW+   ER+
Sbjct: 359 AYVQN-IWNVINWKTAEERF 377


>gi|294650082|ref|ZP_06727466.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
 gi|292824033|gb|EFF82852.1| superoxide dismutase [Acinetobacter haemolyticus ATCC 19194]
          Length = 227

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 81/201 (40%), Positives = 115/201 (57%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKSH 61
           F    LPY  D L P + ++T+E H+  HHK Y DN         E+  L++E+I  +  
Sbjct: 25  FTQAPLPYKSDALEPAIDQQTMEIHYGKHHKAYVDNLNAQIKTYPELDKLNIEQIQQQIS 84

Query: 62  GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
             NA + NN   ++NH  FW  +   D  GKV   L   I+ +FGSF+ F+     AA++
Sbjct: 85  KYNAAVRNNGGGHFNHAFFWESLAPTDKTGKVSPKLLKQINQDFGSFKAFQEQFNQAATS 144

Query: 122 QFGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
           +FGSGW WL V    KLEI+ T N +NPL++       P+LG+DVWEHAYYL ++ RRA 
Sbjct: 145 RFGSGWAWLIVNPQGKLEITSTPNQDNPLMDIAEKKGQPLLGLDVWEHAYYLKYQNRRAD 204

Query: 177 YIESFITNLVNWEYVCERYET 197
           Y  +F  ++VNW  V +RY+ 
Sbjct: 205 YTNAF-WSVVNWNKVNDRYQK 224


>gi|300774839|ref|ZP_07084702.1| superoxide dismutase [Chryseobacterium gleum ATCC 35910]
 gi|300506654|gb|EFK37789.1| superoxide dismutase [Chryseobacterium gleum ATCC 35910]
          Length = 198

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 78/202 (38%), Positives = 113/202 (55%), Gaps = 9/202 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P +   T+E HH  HH+ Y DN  K     E+   ++ E I ++
Sbjct: 1   MSFELPKLGYAYDALEPTIDARTMEIHHTKHHQAYIDNLNKAIEGTELAGKTI-EEICQT 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH+LFW  +     K  V      A  +N+G F+KFK+D   AA 
Sbjct: 60  GTDKPAVRNNGGGHFNHSLFWEILIPGGSKEPVGN--VKAAIENYGGFDKFKTDFSEAAK 117

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL    +G + +S T N +NPL+        P+LG+DVWEHAYYL+++ RR 
Sbjct: 118 TRFGSGWAWLVKNADGSVSVSSTPNQDNPLMPVADVKGTPVLGLDVWEHAYYLNYQNRRP 177

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F   +VNW+ V E +  
Sbjct: 178 DYVSAFFD-VVNWDKVEELFNK 198


>gi|13399622|pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide
           Dismutase Mutant Y174f At 1.35 Angstroms Resolution.
 gi|13399623|pdb|1I0H|B Chain B, Crystal Structure Of The E. Coli Manganese Superoxide
           Dismutase Mutant Y174f At 1.35 Angstroms Resolution.
 gi|27573647|pdb|1IX9|A Chain A, Crystal Structure Of The E. Coli Manganase(Iii) Superoxide
           Dismutase Mutant Y174f At 0.90 Angstroms Resolution.
 gi|27573648|pdb|1IX9|B Chain B, Crystal Structure Of The E. Coli Manganase(Iii) Superoxide
           Dismutase Mutant Y174f At 0.90 Angstroms Resolution.
 gi|27573649|pdb|1IXB|A Chain A, Crystal Structure Of The E. Coli Manganese(Ii) Superoxide
           Dismutase Mutant Y174f At 0.90 Angstroms Resolution.
 gi|27573650|pdb|1IXB|B Chain B, Crystal Structure Of The E. Coli Manganese(Ii) Superoxide
           Dismutase Mutant Y174f At 0.90 Angstroms Resolution.
 gi|99031702|pdb|1ZLZ|A Chain A, Re-Evaluation Of The Low-Temperature Azide In Mn-Dependent
           Superoxide Dismutase
 gi|99031703|pdb|1ZLZ|B Chain B, Re-Evaluation Of The Low-Temperature Azide In Mn-Dependent
           Superoxide Dismutase
          Length = 205

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 82/207 (39%), Positives = 118/207 (57%), Gaps = 15/207 (7%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK- 59
            + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K 
Sbjct: 1   SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAY+L F
Sbjct: 118 KAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYET 197
           + RR  YI+ F  N+VNW+    R+  
Sbjct: 178 QNRRPDYIKEF-WNVVNWDEAAARFAA 203


>gi|52843161|ref|YP_096960.1| superoxide dismutase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52630272|gb|AAU29013.1| superoxide dismutase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 196

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 5   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 64

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G     + L++AI+ +FGSF  FK      A+
Sbjct: 65  KG---GIFNNAAQVWNHTFYWHSMSPNGGGEPKGR-LAEAINKSFGSFAAFKEQFSQTAA 120

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL       L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 121 TTFGSGWAWLVQDQSGALKIINTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 180

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++     +
Sbjct: 181 AF-WSLVNWDFASSNLK 196


>gi|238897298|ref|YP_002922975.1| superoxide dismutase, manganese [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229465053|gb|ACQ66827.1| superoxide dismutase, manganese [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 209

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 80/213 (37%), Positives = 115/213 (53%), Gaps = 16/213 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP+LPY+YD L P+   +T+E HH  HH+ Y  NA  + S    L     E +I+ 
Sbjct: 1   MSYSLPSLPYAYDALEPHFDAKTMEIHHTKHHQAYVTNANSVLSSYPELTKLSVESLIQD 60

Query: 60  ----SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                      + NNA  + NH  FW  +K       +   L  AI+ +FGS + FK+  
Sbjct: 61  LNCVPSEKRVFMRNNAGGHANHGFFWTGLK---IGTVLQGKLKIAIEKDFGSVDAFKTQF 117

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+T+FGSGW WL +KN  KL +  T N +NPL+         +PI+G+DVWEHAYYL
Sbjct: 118 EQAAATRFGSGWAWLVLKNTGKLAVVSTANQDNPLMGDAVCGASGVPIMGLDVWEHAYYL 177

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
            ++ RR  YI++F   +VNW+   +R+     A
Sbjct: 178 KYQNRRPDYIKAF-WQVVNWDEAEKRFMKVSKA 209


>gi|237731381|ref|ZP_04561862.1| superoxide dismutase [Citrobacter sp. 30_2]
 gi|226906920|gb|EEH92838.1| superoxide dismutase [Citrobacter sp. 30_2]
          Length = 193

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAGGEP-TGKLADAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V + +  
Sbjct: 177 HF-WALVNWEFVAKNFAA 193


>gi|224048092|ref|XP_002189358.1| PREDICTED: putative mitochondrial superoxide dismutase 2 variant 1
           isoform 2 [Taeniopygia guttata]
          Length = 226

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 30  HTLPDLPYDYGALEPHINAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKG--DVTTQVS 87

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGSF  FK  L   +   
Sbjct: 88  LQPALKFNGGGHINHTIFWTNLSPNGGGEP-KGELMEAIKRDFGSFANFKEKLTAVSVGV 146

Query: 123 FGSGWGWLSVK--NGKLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL      G+L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 147 QGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 206

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V  RY T   
Sbjct: 207 A-IWNVINWENVSSRYATCKK 226


>gi|30841309|gb|AAP34410.1| manganese-containing superoxide dismutase [Homo sapiens]
          Length = 213

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/196 (36%), Positives = 100/196 (51%), Gaps = 7/196 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +     
Sbjct: 22  HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQIA 79

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+   
Sbjct: 80  LQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASVGV 138

Query: 123 FGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 139 QGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLK 198

Query: 180 SFITNLVNWEYVCERY 195
           + I N++NWE V ERY
Sbjct: 199 A-IWNVINWENVTERY 213


>gi|325104212|ref|YP_004273866.1| Superoxide dismutase [Pedobacter saltans DSM 12145]
 gi|324973060|gb|ADY52044.1| Superoxide dismutase [Pedobacter saltans DSM 12145]
          Length = 222

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 108/203 (53%), Gaps = 7/203 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F    LPY+Y+ L PY+  +T+E H+  HH  Y  N             ++EE++     
Sbjct: 22  FTQKPLPYAYNALEPYIDAQTMEIHYSKHHAAYVKNLNDAVKGTPAEKQNIEEVLKSLDK 81

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
            N  + NN   +YNH LFW+ +   +        L+ AI+  F S +  KS L  AA  +
Sbjct: 82  ENTAVRNNGGGHYNHELFWSILTP-EKNTAPSAQLAQAINTKFKSLDALKSKLNDAAVKR 140

Query: 123 FGSGWGWLSVKNG-KLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAHY 177
           FGSGW WL V     L+I+ T N +NPL+       IPILGIDVWEHAYYL ++ +RA Y
Sbjct: 141 FGSGWAWLIVDESGDLQITSTPNQDNPLMTFAPKQGIPILGIDVWEHAYYLKYQNKRADY 200

Query: 178 IESFITNLVNWEYVCERYETAML 200
           + + I N++NW+ V  RY  A  
Sbjct: 201 LTN-IWNVINWKEVSRRYAEAKK 222


>gi|49475260|ref|YP_033301.1| superoxide dismutase [Bartonella henselae str. Houston-1]
 gi|49238065|emb|CAF27272.1| Superoxide dismutase [Bartonella henselae str. Houston-1]
          Length = 200

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 109/196 (55%), Positives = 141/196 (71%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+L  LPY YD LSPYMS+ETLEYHHD HH  Y  N      D  + + SLE I+ KS
Sbjct: 1   MAFELAPLPYDYDSLSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLENIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G N GLFNNA+QYYNHN FW  MKK  G  K+P+ L+ AI+ + G ++KF++D I  A 
Sbjct: 61  FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYDKFRADFIATAI 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            QFGSGW W++VK+GKLEI KT N ENPL++ A PILG+DVWEH+YY+D++  R  Y+E+
Sbjct: 121 AQFGSGWAWIAVKDGKLEIMKTPNGENPLVHNAQPILGVDVWEHSYYIDYRNVRPKYLEA 180

Query: 181 FITNLVNWEYVCERYE 196
           F+ +L+NW+YV + YE
Sbjct: 181 FVDHLINWDYVLKLYE 196


>gi|325273334|ref|ZP_08139604.1| superoxide dismutase [Pseudomonas sp. TJI-51]
 gi|324101537|gb|EGB99113.1| superoxide dismutase [Pseudomonas sp. TJI-51]
          Length = 203

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 108/205 (52%), Gaps = 7/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY+YD L P++  +T+E HH  HH+ Y +         E     +E+++   
Sbjct: 1   MPHALPALPYAYDALEPHIDAQTMEIHHTRHHQTYVNGLNAAVEGTEWAEWPVEKLVAAV 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + N+   + NH+LFW  M    G       L+ AI    G F+ FK    
Sbjct: 61  GDLPEQLRGAVTNHGGGHANHSLFWTVMSPQGGVEP-TGELAQAITTQLGGFDAFKEAFT 119

Query: 117 TAASTQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA T+FGSGW WLSV   K L +  + N ++PL++G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMHGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI +F  N+++W  V  RY  A+ 
Sbjct: 180 EYIGAFY-NVIDWAQVQHRYLEALK 203


>gi|254431403|ref|ZP_05045106.1| superoxide dismutase [Mn] [Cyanobium sp. PCC 7001]
 gi|197625856|gb|EDY38415.1| superoxide dismutase [Mn] [Cyanobium sp. PCC 7001]
          Length = 247

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 105/210 (50%), Gaps = 8/210 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLAS-DAEMLHLSLEEIIIKS 60
            + LP LPY  + L P +   T+  HHD HH  Y          +  +  LSLE +  + 
Sbjct: 39  TYTLPPLPYPAEALEPVIDAPTMTIHHDRHHGGYVAKLNAQIEANPALEGLSLEALQGQI 98

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH+ FWA M      G+    L  AID +FGS          A +
Sbjct: 99  SRFPEAVRNNGGGHWNHSQFWAVMAPEGQGGEPSAELLTAIDASFGSLGAMHEQFNQAGA 158

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLIN-----GAIPILGIDVWEHAYYLDFKYRR 174
            +FGSGW WL  +   +L ++ T N +NPL++        P+LG+DVWEHAYYL+++ RR
Sbjct: 159 GRFGSGWAWLIRRPDGRLAVTSTPNQDNPLMDLPGIERGTPLLGLDVWEHAYYLNYQNRR 218

Query: 175 AHYIESFITNLVNWEYVCERYETAMLAQKV 204
             YI++   + VNW+ V  RY  A  +  +
Sbjct: 219 PDYIQA-WWSRVNWKEVNRRYGEAGSSSVI 247


>gi|198242517|ref|YP_002215703.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197937033|gb|ACH74366.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326623450|gb|EGE29795.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 193

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L++AI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGKLAEAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|401109|sp|P31108|SODF_LEGPH RecName: Full=Superoxide dismutase [Fe]
 gi|216769|dbj|BAA02306.1| iron superoxide dismutase (Fe-SOD) [Legionella pneumophila]
 gi|19880970|gb|AAM00603.1| superoxide dismutase [Legionella pneumophila]
 gi|744306|prf||2014300A Fe superoxide dismutase
          Length = 192

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G     + L++AI+ +FGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGGGEPKGR-LAEAINKSFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL       L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIINTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++     +
Sbjct: 177 AF-WSLVNWDFASSNLK 192


>gi|325335650|gb|ADZ11924.1| Superoxide dismutase [Riemerella anatipestifer RA-GD]
          Length = 213

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 112/202 (55%), Gaps = 9/202 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E HH  HH+ Y DN  K  +  E+   S  E + + 
Sbjct: 16  MSFELPKLGYAYDALEPHIDARTMEIHHTKHHQAYIDNLNKAIAGTELEGKS-IEEVCQQ 74

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH LFW  +     K      + + I+   G F+KFK+D   AA 
Sbjct: 75  GSDKPAVRNNGGGHFNHTLFWQVLTPGGSKEP-VGKVKEEIEK-MGGFDKFKTDFSEAAK 132

Query: 121 TQFGSGWGWLS-VKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL  + +G LE+  + N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 133 TRFGSGWAWLCKMPDGSLEVCSSANQDNPLMPNVGCGGTPILGLDVWEHAYYLNYQNRRP 192

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F   ++NW+ V E Y  
Sbjct: 193 DYVTAFF-EVINWDKVEENYNK 213


>gi|268679019|ref|YP_003303450.1| superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
 gi|268617050|gb|ACZ11415.1| Superoxide dismutase [Sulfurospirillum deleyianum DSM 6946]
          Length = 198

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 88/199 (44%), Positives = 121/199 (60%), Gaps = 3/199 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEII--I 58
           M   LP LPY    L PY+S  TL YHH  HH+ Y +N   L     +   +LE II   
Sbjct: 1   MAITLPPLPYEASALEPYISANTLGYHHGKHHQTYVNNLNNLIQSTPLADEALEAIIFAS 60

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            +     G+FNNA+Q +NH  +W+CMKK  G G    A++  I ++FGSFE F      A
Sbjct: 61  ANVPEKVGIFNNAAQVWNHTFYWSCMKK-GGGGVPSGAVAAKIIEDFGSFEAFIEAFKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + NGKL+I+KT NA+ P+++    +L +DVWEHAYYLD++ +RA YI
Sbjct: 120 GLTQFGSGWAWLVLDNGKLKITKTSNADTPMVHQQKALLTVDVWEHAYYLDYQNKRADYI 179

Query: 179 ESFITNLVNWEYVCERYET 197
           + F+ +LVNW++V    + 
Sbjct: 180 DIFLKHLVNWDFVNANLKA 198


>gi|168819180|ref|ZP_02831180.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205343852|gb|EDZ30616.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086092|emb|CBY95866.1| Superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G     + L++AI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAGGEPTGR-LAEAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|313206913|ref|YP_004046090.1| manganese/iron superoxide dismutase [Riemerella anatipestifer DSM
           15868]
 gi|312446229|gb|ADQ82584.1| Manganese/iron superoxide dismutase [Riemerella anatipestifer DSM
           15868]
          Length = 198

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 112/202 (55%), Gaps = 9/202 (4%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP L Y+YD L P++   T+E HH  HH+ Y DN  K  +  E+   S  E + + 
Sbjct: 1   MSFELPKLGYAYDALEPHIDARTMEIHHTKHHQAYIDNLNKAIAGTELEGKS-IEEVCQQ 59

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 + NN   ++NH LFW  +     K      + + I+   G F+KFK+D   AA 
Sbjct: 60  GSDKPAVRNNGGGHFNHTLFWQVLTPGGSKEP-VGKVKEEIEK-MGGFDKFKTDFSEAAK 117

Query: 121 TQFGSGWGWLS-VKNGKLEISKTQNAENPLING----AIPILGIDVWEHAYYLDFKYRRA 175
           T+FGSGW WL  + +G LE+  + N +NPL+        PILG+DVWEHAYYL+++ RR 
Sbjct: 118 TRFGSGWAWLCKMPDGSLEVCSSANQDNPLMPNVGCGGTPILGLDVWEHAYYLNYQNRRP 177

Query: 176 HYIESFITNLVNWEYVCERYET 197
            Y+ +F   ++NW+ V E Y  
Sbjct: 178 DYVTAFF-EVINWDKVEENYNK 198


>gi|161527902|ref|YP_001581728.1| superoxide dismutase [Nitrosopumilus maritimus SCM1]
 gi|160339203|gb|ABX12290.1| Superoxide dismutase [Nitrosopumilus maritimus SCM1]
          Length = 206

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 73/205 (35%), Positives = 102/205 (49%), Gaps = 10/205 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------EI 56
           + LP +PY+YD L P++   T+E HH  HH+ Y D                +      +I
Sbjct: 4   YTLPEMPYAYDALEPHIDARTMEIHHTKHHQTYTDKLNAALETCPAEIQDKDILDILSDI 63

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     +  N   Y NH LFW  MK N G      +++DAI+D+FGSF  FK    
Sbjct: 64  NSVPEDKRGAINFNGGGYDNHRLFWNNMKPNGGGEP-GGSIADAINDSFGSFSDFKEKFS 122

Query: 117 TAASTQFGSGWGWLSVKNG--KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRR 174
           +  +   GSGWGWL       K+E     N  +P   G +P+LG DVWEHAYYL+++ +R
Sbjct: 123 STTAVIQGSGWGWLVYNPSSGKVEYKSMPNQTSPRTEGLVPLLGCDVWEHAYYLNYQNKR 182

Query: 175 AHYIESFITNLVNWEYVCERYETAM 199
             YIE+   N+VNW+ V  R+  A 
Sbjct: 183 PAYIEA-WWNVVNWDEVENRFSKAK 206


>gi|51244168|ref|YP_064052.1| superoxide dismutase [Fe] [Desulfotalea psychrophila LSv54]
 gi|50875205|emb|CAG35045.1| probable superoxide dismutase [Fe] [Desulfotalea psychrophila
           LSv54]
          Length = 197

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 126/198 (63%), Gaps = 3/198 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M   LP LPY  + L+PY+S ETL++HH  HH  Y  N  KL +  E+ + +LEEII K 
Sbjct: 1   MSITLPELPYLKNALAPYISSETLDFHHGKHHSTYVTNLNKLIAGTELENATLEEIIKKT 60

Query: 60  -SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            +  S +G+FNNA+Q +NH  +W  MK  +G G    A+++ ID +FGS++ F   L  A
Sbjct: 61  VNDASKSGVFNNAAQIWNHTFYWQSMKA-EGGGMPRGAIAEKIDADFGSYDNFVEQLKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             TQFGSGW WL + N KLEI KT NA+ P+ +G   +L +DVWEHAYYLD++  R  Y+
Sbjct: 120 GLTQFGSGWAWLVLNNNKLEIMKTANADTPIAHGLQALLTVDVWEHAYYLDYQNGRGTYL 179

Query: 179 ESFITNLVNWEYVCERYE 196
           ++F  NL+NW++V     
Sbjct: 180 DAFFNNLINWDFVNANLA 197


>gi|226952608|ref|ZP_03823072.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
 gi|226836688|gb|EEH69071.1| superoxide dismutase [Acinetobacter sp. ATCC 27244]
          Length = 207

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 86/207 (41%), Positives = 117/207 (56%), Gaps = 7/207 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY+YD L P +  +T+E HH  HH+ Y +N        E   L +EE++ K 
Sbjct: 1   MAYSLPALPYAYDALEPNIDTKTMEIHHSKHHQTYINNINGAIEGTEWEKLPVEELVAKV 60

Query: 61  HG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           +           NNA  + NH+LFW  M    G GK    ++DAID   G F+ FK    
Sbjct: 61  NEFPANLKNMAINNAGGHANHSLFWTVMSP-QGGGKPTGPVADAIDQQLGGFDAFKDAFT 119

Query: 117 TAASTQFGSGWGWLSVKN-GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA ++FGSGW WLSV    KL +  + N ++PL+ G  PILG+DVWEHAYYL ++ RR 
Sbjct: 120 KAAISRFGSGWAWLSVTPEHKLIVESSANQDSPLMYGNTPILGLDVWEHAYYLKYQNRRP 179

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            YI +F  N+VNW+ V  RY  A+  +
Sbjct: 180 EYIAAFY-NVVNWDEVNRRYHDALQTK 205


>gi|149928089|ref|ZP_01916336.1| superoxide dismutase [Limnobacter sp. MED105]
 gi|149823175|gb|EDM82412.1| superoxide dismutase [Limnobacter sp. MED105]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY+ D L+P++SKETLEYH+  HH  Y  N   L    E    SLE+I+ KS
Sbjct: 1   MQHTLPDLPYAMDALAPHISKETLEYHYGKHHAAYVTNLNNLVKGTEFESSSLEDIVKKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L++AI+  FGS++ FK     +A 
Sbjct: 61  TG---GVFNNAAQIWNHTFYWHCLSPNGGGAP-SGKLAEAINAKFGSYDAFKEAFTKSAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGS W WL  K +G ++I  T NA  PL     P+L  D+WEHAYY+D++  R  YIE
Sbjct: 117 GNFGSSWTWLVKKADGSVDIVNTSNAATPLTTQDKPLLTCDLWEHAYYIDYRNARPKYIE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  NLVNWE+  + +E
Sbjct: 177 TF-WNLVNWEFASKNFE 192


>gi|304406381|ref|ZP_07388037.1| Manganese/iron superoxide dismutase-like protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304344439|gb|EFM10277.1| Manganese/iron superoxide dismutase-like protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 402

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 100/200 (50%), Gaps = 6/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
            +LP LPY Y+ L PY+ ++T+  HHD HH++Y D   K   + E    S    ++K   
Sbjct: 201 HRLPPLPYPYNALEPYIDEKTMRIHHDKHHQSYVDGLNKAERELEEARRSGNFDLVKHWE 260

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N + +Y H LFW  M  +   G     L   I  +FGSFE FK     AA+  
Sbjct: 261 --RELAFNGAGHYLHTLFWNVMAPH-AGGPAIGPLGAQIKHDFGSFEAFKKQFSEAAAKV 317

Query: 123 FGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
            GSGW  L       +LEI   +  +N      +PIL +DVWEHAYYL  +  RA YI+ 
Sbjct: 318 EGSGWAILVWSPRSRRLEILTAEKHQNLSQWDVVPILLLDVWEHAYYLKHQNNRADYIKD 377

Query: 181 FITNLVNWEYVCERYETAML 200
              N+VNW Y  ER+E A  
Sbjct: 378 -WWNVVNWPYANERFEKASK 396


>gi|157145917|ref|YP_001453236.1| superoxide dismutase [Citrobacter koseri ATCC BAA-895]
 gi|157083122|gb|ABV12800.1| hypothetical protein CKO_01668 [Citrobacter koseri ATCC BAA-895]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 87/198 (43%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  +
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTPFEGKSLEEIVRSA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+   D  G+    L+DAI  +FGS   FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAP-DAGGEPTGKLADAIVASFGSVADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNW++V + +  
Sbjct: 177 HF-WALVNWDFVAKNFAA 193


>gi|320546392|ref|ZP_08040707.1| superoxide dismutase [Streptococcus equinus ATCC 9812]
 gi|320448777|gb|EFW89505.1| superoxide dismutase [Streptococcus equinus ATCC 9812]
          Length = 211

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE----EI 56
           M   LP LPY+YD L PY+  ET+  HHD HH  Y  NA         L   LE    ++
Sbjct: 9   MAIILPELPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPELGDDLEVILADV 68

Query: 57  IIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN     NH+LFW  +     K +    +  AI+  FGSF+ FK++  
Sbjct: 69  DKIPADIRQAVINNGGGALNHSLFWEFLSP--EKQEPTADVLAAIEATFGSFDNFKAEFT 126

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            AA+T+FGSGW WL V K GKLE++ T N +NP+  G  PIL +DVWEHAYYL ++  R 
Sbjct: 127 KAATTRFGSGWAWLVVNKEGKLEVTSTANQDNPISEGKKPILALDVWEHAYYLKYRNVRP 186

Query: 176 HYIESFITNLVNWEYVCERYETAML 200
            YI++F   ++NW  V E Y+ A+ 
Sbjct: 187 DYIKAFFD-IINWAKVAELYQAAVA 210


>gi|159026977|emb|CAO86696.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 199

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 3/200 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M + LP LPY Y  L P ++K TLE+HHD HH  Y +N   L  D E+  LSLEE+I+K 
Sbjct: 1   MAYTLPPLPYDYTALEPCITKSTLEFHHDKHHAAYVNNYNGLVKDTELDALSLEEVIVKV 60

Query: 61  HG--SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
            G  S AG+FNNA+Q +NH+ +W CMK   G        +  I+ +FGSFEKF     TA
Sbjct: 61  AGDASKAGVFNNAAQAWNHSFYWDCMKPGGGGAPTGAL-AAKINADFGSFEKFVEAFKTA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
            +TQFGSGW WL + NG L+++KT NA+NPL  G +P+L +DVWEHAYYLD++ RR  YI
Sbjct: 120 GATQFGSGWAWLVLDNGTLKVTKTGNADNPLTVGQVPLLTMDVWEHAYYLDYQNRRPDYI 179

Query: 179 ESFITNLVNWEYVCERYETA 198
             F+T LVNW++V      A
Sbjct: 180 SDFLTKLVNWDFVAANLAAA 199


>gi|229368084|gb|ACQ59022.1| Superoxide dismutase, mitochondrial precursor [Anoplopoma fimbria]
          Length = 227

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 97/201 (48%), Gaps = 7/201 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+L Y Y  L P+++ E ++ HH  HH  Y +N        +         +     
Sbjct: 31  HTLPDLTYDYGALEPHINAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKG--DVTAQVA 88

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
               L  N   + NH +FW  +  N G       L +AI  +FGS +K K  +  A    
Sbjct: 89  LQPALKFNGGGHINHTIFWTNLTPNGGDEP-QGELMEAIKRDFGSLQKMKEKMSAATVAV 147

Query: 123 FGSGWGWLSVKNG--KLEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
            GSGWGWL  +    +L I+   N +      G IP+LGIDVWEHAYYL +K  R  Y++
Sbjct: 148 QGSGWGWLGYEKESGRLRIAACPNQDPLHGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVK 207

Query: 180 SFITNLVNWEYVCERYETAML 200
           + I N++NWE V ER +TA  
Sbjct: 208 A-IWNVINWENVSERLQTAKK 227


>gi|225718514|gb|ACO15103.1| Superoxide dismutase 1, mitochondrial precursor [Caligus clemensi]
          Length = 222

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 94/202 (46%), Gaps = 7/202 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
             LP+LPY+Y  L P +S E +E HH  HH+ Y +N        ++     +  +     
Sbjct: 24  HTLPDLPYAYGALEPVISGEIMEIHHSKHHQTYVNNLNGAEE--KLADAVAKNDVSTIIS 81

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGK-GKVPQALSDAIDDNFGSFEKFKSDLITAAST 121
               L  N   + NH++FW  +       G+    L   I  +FGS E  K  L  +   
Sbjct: 82  LQGALKFNGGGHLNHSIFWTNLAPAGSCSGEPSGELLKLIQRDFGSLEAMKEKLSGSTVA 141

Query: 122 QFGSGWGWLSVKN--GKLEISKTQNAEN-PLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
             GSGWGWL       KL+I+   N +      G +P+ GIDVWEHAYYL +K  R  Y+
Sbjct: 142 VQGSGWGWLGYCKAEKKLKIATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYV 201

Query: 179 ESFITNLVNWEYVCERYETAML 200
           ++   N+ NW+ + ER   A  
Sbjct: 202 KAIF-NVANWDNIAERLSAASK 222


>gi|16329169|gb|AAG44813.2|AF273269_1 superoxide dismutase [Staphylococcus aureus]
          Length = 199

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M FKLPNLPY+YD L PY+ + T+E+HHD HH  Y           E+ H SL ++I   
Sbjct: 1   MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     + NN   ++NH+LFW  +  N    +    + D I   +G+ ++FK++  
Sbjct: 61  GKVPEAMRMSVRNNGGGHFNHSLFWEILSPNS---EEKGGVIDDIKAQWGTLDEFKNEFA 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
             A+T FGSGW WL V +GKLEI  T N +NPL  G  PIL  DVWEHAYYL ++ +R  
Sbjct: 118 NKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPD 177

Query: 177 YIESFITNLVNWEYVCERYETAM 199
           Y+ +F  N+VNW+ V E Y+ A 
Sbjct: 178 YMTAF-WNIVNWKKVDELYQAAK 199


>gi|54295807|ref|YP_128222.1| superoxide dismutase, iron [Legionella pneumophila str. Lens]
 gi|53755639|emb|CAH17141.1| superoxide dismutase, iron [Legionella pneumophila str. Lens]
          Length = 192

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F LP LPY+ D L+P++SKETLEYH+  HH  Y  N  KL    E   ++LEEII+K+
Sbjct: 1   MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W  M  N G     + L++AI+ NFGSF  FK      A+
Sbjct: 61  KG---GIFNNAAQVWNHTFYWHSMSPNGGGEPKGR-LAEAINKNFGSFAAFKEQFSQTAA 116

Query: 121 TQFGSGWGWLSVKNGK-LEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
           T FGSGW WL       L+I  T NA  P+  G   +L  DVWEHAYY+D++ RR  YIE
Sbjct: 117 TTFGSGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIE 176

Query: 180 SFITNLVNWEYVCERYE 196
           +F  +LVNW++     +
Sbjct: 177 AF-WSLVNWDFASSNLK 192


>gi|319776659|ref|YP_004139147.1| Manganese superoxide dismutase [Haemophilus influenzae F3047]
 gi|329124176|ref|ZP_08252723.1| superoxide dismutase [Haemophilus aegyptius ATCC 11116]
 gi|317451250|emb|CBY87484.1| Manganese superoxide dismutase [Haemophilus influenzae F3047]
 gi|327467601|gb|EGF13099.1| superoxide dismutase [Haemophilus aegyptius ATCC 11116]
          Length = 215

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 115/210 (54%), Gaps = 17/210 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+Y+ L P+   +T+E HH  HH+ Y +NA           + +       
Sbjct: 1   MSYTLPELGYAYNALEPHFDTQTMEIHHSKHHQAYVNNANAALEGLPAELVEMCPGHLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
            +          L NNA  + NH+LFW  +KK      +  AL DAI+ +FGS + FK++
Sbjct: 61  NLDKIPAEKRGALRNNAGGHTNHSLFWKSLKK---GTTLQGALKDAIERDFGSVDAFKAE 117

Query: 115 LITAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYY 167
              AA+T+FGSGW WL     GKL +  T N +NPL+          P+LG+DVWEHAYY
Sbjct: 118 FEKAAATRFGSGWAWLVLTAEGKLAVVSTANQDNPLMGKEVAGCEGFPLLGLDVWEHAYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYET 197
           L F+ RR  YI+ F  N+VNW++V ER+E 
Sbjct: 178 LKFQNRRPDYIKEF-WNVVNWDFVAERFEQ 206


>gi|90422009|ref|YP_530379.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
 gi|90104023|gb|ABD86060.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
          Length = 244

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 9/207 (4%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61
            F LP LPY    L P++  +T+E HH  HH+ Y  N    A D   L       ++ + 
Sbjct: 38  PFTLPPLPYPVAALEPHIDAKTMEIHHGKHHQAYVSNLNNFAKDNPKLASMPVPEVLGNL 97

Query: 62  GS-----NAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
           G        G+ NN   + NH +FW  M  N   GK    +  AID + G  EKF++D  
Sbjct: 98  GDVPEAIRTGVRNNLGGHANHTMFWQIMGPN--GGKPAGDVLAAIDRDLGGMEKFQADFN 155

Query: 117 TAASTQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRA 175
            A   QFGSGW +++V K+GKL I    N +NP+++G   +LG DVWEHAYYL ++ RRA
Sbjct: 156 AAGGRQFGSGWVFVTVSKDGKLAIETRPNQDNPMMDGKRALLGNDVWEHAYYLSYQNRRA 215

Query: 176 HYIESFITNLVNWEYVCERYETAMLAQ 202
            Y+++   N VNW  V ERY  A   Q
Sbjct: 216 DYLKA-WWNTVNWNKVSERYAAAKAGQ 241


>gi|260905174|ref|ZP_05913496.1| superoxide dismutase [Brevibacterium linens BL2]
          Length = 208

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/207 (34%), Positives = 103/207 (49%), Gaps = 8/207 (3%)

Query: 1   MD--FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIII 58
           M   + LP LPY Y  L P++S   +E HHD HH  Y   A            S    + 
Sbjct: 1   MAEQYVLPELPYDYSALEPHISARIMELHHDKHHATYVKGANTAVEQLAEARESGN--LA 58

Query: 59  KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                   L  N   + NH++FW  M   DG  K    L+ AIDD FGSF+KF+    TA
Sbjct: 59  NVPKLTRDLAFNLGGHVNHSIFWNNMSP-DGGDKPTGELAAAIDDQFGSFDKFREHFTTA 117

Query: 119 ASTQFGSGWGWLSVKN--GKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAH 176
           A+T  GSGW  L      G L I + ++ ++ +  G  P+L +D+WEHA+YLD++  +  
Sbjct: 118 ATTIQGSGWAVLVYDQLGGNLFIEQLKDQQSDIQLGGTPVLQLDMWEHAFYLDYQNVKPD 177

Query: 177 YIESFITNLVNWEYVCERYETAMLAQK 203
           Y+++   N+VNW     R++ A+   K
Sbjct: 178 YVKA-WWNIVNWADAGARFDRAVTQTK 203


>gi|14719520|pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146h Mutant
 gi|14719521|pdb|1EN4|B Chain B, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146h Mutant
 gi|14719522|pdb|1EN4|C Chain C, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146h Mutant
 gi|14719523|pdb|1EN4|D Chain D, Crystal Structure Analysis Of The E. Coli Manganese
           Superoxide Dismutase Q146h Mutant
          Length = 205

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 118/207 (57%), Gaps = 15/207 (7%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASD-AEMLHLSLEEIIIK- 59
            + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA        E  +L +EE+I K 
Sbjct: 1   SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLI 116
                     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++  
Sbjct: 61  DQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEFE 117

Query: 117 TAASTQFGSGWGWLSVKNGKLEISKTQNAENPLI------NGAIPILGIDVWEHAYYLDF 170
            AA+++FGSGW WL +K  KL +  T N ++PL+          PI+G+DVWEHAYYL F
Sbjct: 118 KAAASRFGSGWAWLVLKGDKLAVVSTANHDSPLMGEAISGASGFPIMGLDVWEHAYYLKF 177

Query: 171 KYRRAHYIESFITNLVNWEYVCERYET 197
           + RR  YI+ F  N+VNW+    R+  
Sbjct: 178 QNRRPDYIKEF-WNVVNWDEAAARFAA 203


>gi|57113925|ref|NP_001009022.1| superoxide dismutase [Mn], mitochondrial [Pan troglodytes]
 gi|24987870|pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide
           Dismutase Reveals A Novel Tetrameric Interface Of Two 4-
           Helix Bundles
 gi|24987871|pdb|1N0J|B Chain B, The Structure Of Human Mitochondrial Mn3+ Superoxide
           Dismutase Reveals A Novel Tetrameric Interface Of Two 4-
           Helix Bundles
 gi|23503526|dbj|BAC20353.1| Mn-superoxide dismutase [Pan troglodytes]
 gi|23503528|dbj|BAC20354.1| Mn-superoxide dismutase [Pongo pygmaeus]
          Length = 199

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 101/203 (49%), Gaps = 7/203 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M   LP+LPY Y  L P+++ + ++ HH  HH  Y +N        +         +   
Sbjct: 1   MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG--DVTAQ 58

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 L  N   + NH++FW  +  N G       L +AI  +FGSF+KFK  L  A+ 
Sbjct: 59  IALQPALKFNGGGHINHSIFWTNLSPNGGGEP-KGELLEAIKRDFGSFDKFKEKLTAASV 117

Query: 121 TQFGSGWGWLSVKNGK--LEISKTQNAENPL-INGAIPILGIDVWEHAYYLDFKYRRAHY 177
              GSGWGWL     +  L+I+   N +      G IP+LGIDVWEHAYYL +K  R  Y
Sbjct: 118 GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDY 177

Query: 178 IESFITNLVNWEYVCERYETAML 200
           +++ I N++NWE V ERY     
Sbjct: 178 LKA-IWNVINWENVTERYMACKK 199


>gi|229009281|ref|ZP_04166569.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
 gi|228751994|gb|EEM01733.1| Superoxide dismutase [Bacillus mycoides Rock1-4]
          Length = 204

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 76/200 (38%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK--- 59
           ++LP L Y++D L P+  ++T+  HHD HH  Y +N        + L     E +I+   
Sbjct: 4   YELPALSYAFDALEPHFDEQTMMIHHDRHHATYVNNLNAALEGHDDLSTKSVEELIEKLD 63

Query: 60  --SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLIT 117
                    + NN   + NH+LFW+ +  N G       +++AI+  FGS+++FK     
Sbjct: 64  SVPENIRTAVRNNGGGHANHSLFWSILSPNGGCTPTGV-VAEAINKAFGSYDQFKDQFTK 122

Query: 118 AASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177
           AA+ +FGSGW WL V NG+L I+ T N ++PL+ G  PILG+DVWEHAYYL+++ +R  Y
Sbjct: 123 AATGRFGSGWAWLVVDNGQLAITSTPNQDSPLMEGKKPILGLDVWEHAYYLNYQNKRPDY 182

Query: 178 IESFITNLVNWEYVCERYET 197
           I +F  NL+NW+ V + Y+ 
Sbjct: 183 ISAFF-NLINWDEVNKLYQA 201


>gi|283833272|ref|ZP_06353013.1| superoxide dismutase [Citrobacter youngae ATCC 29220]
 gi|291070909|gb|EFE09018.1| superoxide dismutase [Citrobacter youngae ATCC 29220]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 90/198 (45%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAGGEP-TGKLADAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P++ +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKGADGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V + +  
Sbjct: 177 HF-WALVNWEFVAKNFAA 193


>gi|289208132|ref|YP_003460198.1| superoxide dismutase [Thioalkalivibrio sp. K90mix]
 gi|288943763|gb|ADC71462.1| Superoxide dismutase [Thioalkalivibrio sp. K90mix]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 84/194 (43%), Positives = 119/194 (61%), Gaps = 5/194 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++LP+LPY+ + L P++S ETLEYHHD HH  Y      L   +E  + SLE+II K+
Sbjct: 1   MAYELPDLPYAKNALEPHISAETLEYHHDKHHATYVTKLNGLLPGSEFENASLEDIIKKA 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
                 +FNN +Q +NH  ++ CM   D  G+    ++DAI+  FGSF+ FK     AA 
Sbjct: 61  PAGG--IFNNGAQVWNHTFYFNCMGP-DAGGEPSGKVADAINSAFGSFDGFKEKFNEAAV 117

Query: 121 TQFGSGWGWLSVKNG-KLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL   +   +EI  T NA NP+ +G  P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 118 GNFGSGWTWLVQNSDGSVEIVNTSNAANPMRDGKTPLLTCDVWEHAYYIDYRNARPKYLE 177

Query: 180 SFITNLVNWEYVCE 193
           +F  N+VNW++V +
Sbjct: 178 NF-WNVVNWDFVAQ 190


>gi|148828250|ref|YP_001293003.1| superoxide dismutase (Mn) [Haemophilus influenzae PittGG]
 gi|148719492|gb|ABR00620.1| superoxide dismutase (Mn) [Haemophilus influenzae PittGG]
          Length = 211

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 114/210 (54%), Gaps = 17/210 (8%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLE------ 54
           M + LP L Y+Y+ L P+   +T+E HH  HH+ Y +NA           + +       
Sbjct: 1   MSYTLPELGYAYNALEPHFDAQTMEIHHSKHHQAYVNNANAALEGLPAELVEMYPGHLIS 60

Query: 55  EIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSD 114
            +          L NNA  + NH+LFW  +KK      +  AL DAI+ +FGS + FK++
Sbjct: 61  NLDKIPAEKRGALRNNAGGHTNHSLFWKSLKK---GTTLQGALKDAIERDFGSVDAFKAE 117

Query: 115 LITAASTQFGSGWGWLS-VKNGKLEISKTQNAENPLIN------GAIPILGIDVWEHAYY 167
              AA+ +FGSGW WL     GKL +  T N +NPL+          P+LG+DVWEHAYY
Sbjct: 118 FEKAAAIRFGSGWAWLVLTAEGKLAVVSTANQDNPLMGKEVAGCEGFPLLGLDVWEHAYY 177

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYET 197
           L F+ RR  YI+ F  N+VNW++V ER+E 
Sbjct: 178 LKFQNRRPDYIKEF-WNVVNWDFVAERFEQ 206


>gi|229513614|ref|ZP_04403078.1| manganese superoxide dismutase [Vibrio cholerae TMA 21]
 gi|229524672|ref|ZP_04414077.1| manganese superoxide dismutase [Vibrio cholerae bv. albensis VL426]
 gi|229527381|ref|ZP_04416773.1| manganese superoxide dismutase [Vibrio cholerae 12129(1)]
 gi|262190922|ref|ZP_06049137.1| manganese superoxide dismutase [Vibrio cholerae CT 5369-93]
 gi|14039296|gb|AAK53163.1| manganese superoxide dismutase [Vibrio cholerae]
 gi|229335013|gb|EEO00498.1| manganese superoxide dismutase [Vibrio cholerae 12129(1)]
 gi|229338253|gb|EEO03270.1| manganese superoxide dismutase [Vibrio cholerae bv. albensis VL426]
 gi|229349491|gb|EEO14447.1| manganese superoxide dismutase [Vibrio cholerae TMA 21]
 gi|262033189|gb|EEY51712.1| manganese superoxide dismutase [Vibrio cholerae CT 5369-93]
 gi|327485166|gb|AEA79573.1| Manganese superoxide dismutase [Vibrio cholerae LMA3894-4]
          Length = 205

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 83/206 (40%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M    P+LPY+YD L PY+  +T+E H+  HH+ Y D  L      E     L EI  + 
Sbjct: 1   MPHLFPDLPYAYDALEPYIDAKTMEVHYSKHHRTYYDKFLSAIKGTEHEDRPLSEIFARV 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
               A + N+   YYNH ++W CMK N G       L+  I+  FGSF +FK     AA 
Sbjct: 61  STLPAAVRNHGGGYYNHIVYWNCMKPNGGGEP-QGELAAEIERQFGSFAQFKEAFSQAAV 119

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLIN----GAIPILGIDVWEHAYYLDFKYRRAH 176
             FGSG+ WL V+ G+L I+ T N +NPL++       PIL +DVWEHAYY+ ++ RR  
Sbjct: 120 NTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALDVWEHAYYIRYQNRRPE 179

Query: 177 YIESFITNLVNWEYVCERYETAMLAQ 202
           YI++   N+VNWE V E Y  A+   
Sbjct: 180 YIDA-WWNVVNWEAVSENYAIALTQA 204


>gi|161503477|ref|YP_001570589.1| superoxide dismutase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864824|gb|ABX21447.1| hypothetical protein SARI_01551 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 193

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 92/198 (46%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEII  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRAS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWHCLAPNAGGEP-TGKLADAIAASFGSFTEFKTQFTDAAI 116

Query: 121 TQFGSGWGWLSV-KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKGADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|16760482|ref|NP_456099.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16764779|ref|NP_460394.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29141758|ref|NP_805100.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161614151|ref|YP_001588116.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|168229804|ref|ZP_02654862.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168240945|ref|ZP_02665877.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168264724|ref|ZP_02686697.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463158|ref|ZP_02697089.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194451443|ref|YP_002045469.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194468757|ref|ZP_03074741.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197262201|ref|ZP_03162275.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205352855|ref|YP_002226656.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207857065|ref|YP_002243716.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213162001|ref|ZP_03347711.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213426007|ref|ZP_03358757.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213584895|ref|ZP_03366721.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213649695|ref|ZP_03379748.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213855192|ref|ZP_03383432.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289824916|ref|ZP_06544337.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|61246038|sp|P0A2F4|SODF_SALTY RecName: Full=Superoxide dismutase [Fe]
 gi|61246042|sp|P0A2F5|SODF_SALTI RecName: Full=Superoxide dismutase [Fe]
 gi|25285815|pir||AG0695 superoxide dismutase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16419951|gb|AAL20353.1| iron superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502778|emb|CAD01936.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137386|gb|AAO68949.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161363515|gb|ABX67283.1| hypothetical protein SPAB_01891 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409747|gb|ACF69966.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455121|gb|EDX43960.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|195634334|gb|EDX52686.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197240456|gb|EDY23076.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205272636|emb|CAR37546.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205335495|gb|EDZ22259.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205339356|gb|EDZ26120.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205346863|gb|EDZ33494.1| superoxide dismutase (Fe) [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206708868|emb|CAR33198.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|312912414|dbj|BAJ36388.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224049|gb|EFX49112.1| Fe-superoxide dismutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|326627927|gb|EGE34270.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 193

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 91/198 (45%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|226327378|ref|ZP_03802896.1| hypothetical protein PROPEN_01248 [Proteus penneri ATCC 35198]
 gi|225203904|gb|EEG86258.1| hypothetical protein PROPEN_01248 [Proteus penneri ATCC 35198]
          Length = 218

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 16/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK 59
           M + LP LPY+YD L P+  + T+E HH  HH+ Y +N    L    E+  L ++E++  
Sbjct: 12  MSYTLPALPYAYDALEPHFDERTMEIHHTKHHQTYVNNTNTALEKLPELAGLEIDELVKN 71

Query: 60  SHG----SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
            H         L NNA  + NH+LFW  +K      ++  +L +AI+ +FGS E FK   
Sbjct: 72  LHKVSADQRTFLRNNAGGHSNHSLFWKGLK---LGTQLQGSLKEAIERDFGSVEAFKELF 128

Query: 116 ITAASTQFGSGWGWLSVKNG-KLEISKTQNAENPLI------NGAIPILGIDVWEHAYYL 168
             AA+++FGSGW WL +K+  KL +  T N ++PL+          PI+G+DVWEHAYYL
Sbjct: 129 EKAAASRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEELAGASGYPIIGLDVWEHAYYL 188

Query: 169 DFKYRRAHYIESFITNLVNWEYVCERYET 197
            ++ RR  YI++F  ++VNW+   +R+++
Sbjct: 189 KYQNRRPDYIKAF-WSVVNWDEAQKRFQS 216


>gi|110597404|ref|ZP_01385691.1| Superoxide dismutase [Chlorobium ferrooxidans DSM 13031]
 gi|110340948|gb|EAT59419.1| Superoxide dismutase [Chlorobium ferrooxidans DSM 13031]
          Length = 200

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 87/201 (43%), Positives = 122/201 (60%), Gaps = 3/201 (1%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M ++ P LP++ + L PY+S +TL +H+  HH  Y  N   L +++ +  LSLEE I  +
Sbjct: 1   MAYQQPPLPFAENALEPYISAKTLGFHYGKHHAAYITNYNNLVANSNLDALSLEEAIAIA 60

Query: 61  HGSNAGL--FNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118
                 +  FNN +Q +NH  +W  +  N G       L+  I ++FGSF+KFK +L  A
Sbjct: 61  AADPQKIGIFNNGAQAWNHTFYWNSLTPNGGGLP-TGELAAKITEDFGSFDKFKDELKNA 119

Query: 119 ASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYI 178
           A+TQFGSGW WL +    L++ KT NA+ PL +G  PIL IDVWEHAYYLDF+ RR  Y+
Sbjct: 120 AATQFGSGWAWLVLDGSTLKVVKTGNAQTPLTSGQKPILTIDVWEHAYYLDFQNRRPDYV 179

Query: 179 ESFITNLVNWEYVCERYETAM 199
            S I NL+NWE+    Y+ A 
Sbjct: 180 ASVIDNLLNWEFAAANYKAAK 200


>gi|15241373|ref|NP_199923.1| FSD2 (FE SUPEROXIDE DISMUTASE 2); superoxide dismutase [Arabidopsis
           thaliana]
 gi|8843846|dbj|BAA97372.1| unnamed protein product [Arabidopsis thaliana]
 gi|21537292|gb|AAM61633.1| Fe-superoxide dismutase precursor [Arabidopsis thaliana]
 gi|28393352|gb|AAO42100.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 gi|28827610|gb|AAO50649.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 gi|110737010|dbj|BAF00460.1| hypothetical protein [Arabidopsis thaliana]
 gi|332008651|gb|AED96034.1| Fe superoxide dismutase 2 [Arabidopsis thaliana]
          Length = 305

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 94/217 (43%), Positives = 126/217 (58%), Gaps = 20/217 (9%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61
           F+L   PY  D L P+MS+ETL+YH   HHK Y +N  K     ++  LSLEE+++ S+ 
Sbjct: 53  FELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVVLLSYN 112

Query: 62  -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G+    FNNA+Q +NH  FW  ++   G GK    L   I+ +FGSFE+F     +AA+
Sbjct: 113 KGNMLPAFNNAAQAWNHEFFWESIQP-GGGGKPTGELLRLIERDFGSFEEFLERFKSAAA 171

Query: 121 TQFGSGWGWLSVK-----------------NGKLEISKTQNAENPLINGAIPILGIDVWE 163
           + FGSGW WL+ K                 + KL I KT NA NPL+    P+L ID WE
Sbjct: 172 SNFGSGWTWLAYKANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWE 231

Query: 164 HAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAML 200
           HAYYLDF+ RRA YI +F+  LV+WE V  R E+A+ 
Sbjct: 232 HAYYLDFENRRAEYINTFMEKLVSWETVSTRLESAIA 268


>gi|56413600|ref|YP_150675.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362524|ref|YP_002142161.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127857|gb|AAV77363.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094001|emb|CAR59497.1| superoxide dismutase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 193

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 91/198 (45%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G       L+DAI  +FGSF +FK+    AA 
Sbjct: 61  EG---GIFNNAAQVWNHTFYWNCLAPNAGGEP-TGKLADAIAASFGSFAEFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A+P+L +DVWEHAYY+D++  R +Y+E
Sbjct: 117 KNFGSGWTWLVKSADGKLAIVSTSNAGTPLTTDAMPLLTVDVWEHAYYIDYRNARPNYLE 176

Query: 180 SFITNLVNWEYVCERYET 197
            F   LVNWE+V +    
Sbjct: 177 HF-WALVNWEFVAKNLAA 193


>gi|218246844|ref|YP_002372215.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|257059886|ref|YP_003137774.1| superoxide dismutase [Cyanothece sp. PCC 8802]
 gi|218167322|gb|ACK66059.1| Superoxide dismutase [Cyanothece sp. PCC 8801]
 gi|256590052|gb|ACV00939.1| Superoxide dismutase [Cyanothece sp. PCC 8802]
          Length = 262

 Score =  198 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 118/205 (57%), Gaps = 8/205 (3%)

Query: 2   DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNAL-KLASDAEMLHLSLEEIIIK- 59
           +F  P LPYSY  L PY+  +T+E H+  HH+ Y +N    +A   E+   SLEE+I   
Sbjct: 58  EFIQPPLPYSYQALEPYIDAQTMEIHYTKHHRGYVNNLNVAIAKHPELKGQSLEELIENF 117

Query: 60  ---SHGSNAGLFNNASQY