RPSBLAST alignment for GI: 254780495 and conserved domain: PRK10543

>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional. Length = 193
 Score =  178 bits (453), Expect = 7e-46
 Identities = 90/194 (46%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L+P++S ETLEYH+  HH+ Y  N   L         SLEEI+  S
Sbjct: 1   MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
            G   G+FNNA+Q +NH  +W C+  N G G+    +++AI  +FGSF  FK+    AA 
Sbjct: 61  EG---GVFNNAAQVWNHTFYWNCLAPNAG-GEPTGKVAEAIAASFGSFADFKAQFTDAAI 116

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL    +GKL I  T NA  PL   A P+L +DVWEHAYY+D++  R  Y+E
Sbjct: 117 KNFGSGWTWLVKNADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLE 176

Query: 180 SFITNLVNWEYVCE 193
            F   LVNWE+V +
Sbjct: 177 HFWA-LVNWEFVAK 189