RPSBLAST alignment for GI: 254780495 and conserved domain: PRK10925

>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional. Length = 206
 Score =  169 bits (430), Expect = 4e-43
 Identities = 91/209 (43%), Positives = 124/209 (59%), Gaps = 15/209 (7%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNA-LKLASDAEMLHLSLEEIIIK 59
           M + LP+LPY+YD L P+  K+T+E HH  HH+ Y +NA   L S  E  +L +EE+I K
Sbjct: 1   MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK 60

Query: 60  SHGSNAG----LFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDL 115
                A     L NNA  + NH+LFW  +KK      +   L  AI+ +FGS + FK++ 
Sbjct: 61  LDQLPADKKTVLRNNAGGHANHSLFWKGLKK---GTTLQGDLKAAIERDFGSVDNFKAEF 117

Query: 116 ITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAI------PILGIDVWEHAYYLD 169
             AA+T+FGSGW WL +K  KL +  T N ++PL+  AI      PILG+DVWEHAYYL 
Sbjct: 118 EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLK 177

Query: 170 FKYRRAHYIESFITNLVNWEYVCERYETA 198
           F+ RR  YI+ F  N+VNW+    R+   
Sbjct: 178 FQNRRPDYIKEF-WNVVNWDEAAARFAAK 205