RPSBLAST alignment of GI: 254780495 and protein with PDBid: 3cei

>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213
 Score =  226 bits (577), Expect = 4e-60
 Identities = 77/199 (38%), Positives = 112/199 (56%), Gaps = 8/199 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F L  LP++ D +  ++S    ++HH  HH+ Y +N   L    +    SL  I+ KS G
Sbjct: 2   FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q YNH+ +W C+               A++ +FGS EKFK D I +A+T 
Sbjct: 62  ---GVFNNAAQIYNHDFYWDCLSPKATALSDELK--GALEKDFGSLEKFKEDFIKSATTL 116

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW W +      K+EI +T NA+ P+ +  +P+L +DVWEHAYY+D K  R  Y+E 
Sbjct: 117 FGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEK 176

Query: 181 FITNLVNWEYVCERYETAM 199
           F    +NW +V + YE A 
Sbjct: 177 FY-GHINWHFVSQCYEWAK 194