RPSBLAST alignment of GI: 254780495 and protein with PDBid: 3h1s

>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structural genomics, national institute of allergy and infectious diseases; 1.90A {Francisella tularensis subsp} Length = 195
 Score =  157 bits (398), Expect = 1e-39
 Identities = 86/197 (43%), Positives = 114/197 (57%), Gaps = 7/197 (3%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LP LPY+ D L   +SKET+EYH+  HH+ Y  N   L    E    +LEEI+   
Sbjct: 4   MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIV--- 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
             SN G+FNNA+Q +NH  +W C+  N  K +    L  A+ + FGS E FK     AA 
Sbjct: 61  KTSNGGIFNNAAQVFNHTFYWNCLTPN--KTEASSQLKAALIETFGSVENFKEQFSKAAI 118

Query: 121 TQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIE 179
             FGSGW WL     GKLEI  T NA  PL     P+L  DVWEHAYY+D++  R  Y+E
Sbjct: 119 ATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVE 178

Query: 180 SFITNLVNWEYVCERYE 196
           +   ++VNW++V E++ 
Sbjct: 179 ALW-DIVNWQFVSEQFA 194