RPSBLAST alignment of GI: 254780495 and protein with PDBid: 3lio

>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192
 Score =  188 bits (479), Expect = 7e-49
 Identities = 84/195 (43%), Positives = 118/195 (60%), Gaps = 7/195 (3%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F+LP+LPY+ D L P++SKETLE+HH  HH  Y      L    +  + SLEEI+     
Sbjct: 2   FELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIV---CS 58

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
           S+ G+FNNA+Q +NH  +W  +  N G G    A++DAI+  +GSF+ FK  L   A   
Sbjct: 59  SDGGVFNNAAQIWNHTFYWNSLSPN-GGGAPTGAVADAINAKWGSFDAFKEALNDKAVNN 117

Query: 123 FGSGWGWL-SVKNGKLEISKTQNAENPLI-NGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGS W WL  + +G L+I  T NA  PL  +G  PIL +D+WEHAYY+D++  R  Y++ 
Sbjct: 118 FGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWEHAYYIDYRNVRPDYLKG 177

Query: 181 FITNLVNWEYVCERY 195
           F  +LVNWE+    +
Sbjct: 178 FW-SLVNWEFANANF 191