RPSBLAST alignment of GI: 254780495 and SCOP domain: d1bsma2

Alignment
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115
 Score =  109 bits (273), Expect = 2e-25
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 3/108 (2%)

Query: 96  ALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSV--KNGKLEISKTQNAENPLINGA 153
            L  AID+ FGSF+  K+    AA+   GSGW  L       ++   +  + +N L  G+
Sbjct: 9   ELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVWDPLGKRINTLQFYDHQNNLPAGS 68

Query: 154 IPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA 201
           IP+L +D+WEHA+YL +K  +  Y++S+  N+VNW+ V  R+  A +A
Sbjct: 69  IPLLQLDMWEHAFYLQYKNVKGDYVKSWW-NVVNWDDVALRFSEARVA 115

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Cambialistic superoxide dismutase
species: Propionibacterium shermanii [TaxId: 1752]