RPSBLAST alignment of GI: 254780495 and SCOP domain: d1coja1

Alignment
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 89
 Score = 67.0 bits (163), Expect = 1e-12
 Identities = 12/87 (13%), Positives = 27/87 (31%), Gaps = 4/87 (4%)

Query: 3  FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           KL    +        +S E +E H + H+K Y     ++       + +      +++ 
Sbjct: 2  HKLEPKDHLKPQNLEGISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFADRSKANQNYS 61

Query: 63 S----NAGLFNNASQYYNHNLFWACMK 85
                     N      H L++  + 
Sbjct: 62 EYRELKVEETFNYMGVVLHELYFGMLT 88

SCOP domain information

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Fe,Mn superoxide dismutase (SOD), N-terminal domain
family: Fe,Mn superoxide dismutase (SOD), N-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Aquifex pyrophilus [TaxId: 2714]