RPSBLAST alignment of GI: 254780495 and SCOP domain: d1mnga2

Alignment
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111
 Score =  108 bits (272), Expect = 2e-25
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 89  GKGKVPQ-ALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKN-GKLEISKTQNAE 146
           G  K P   L  AID+ FG F+  K  L  AA  +FGSGW WL     GKL +  T N +
Sbjct: 1   GGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQD 60

Query: 147 NPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETA 198
           NP++ G  PI+GIDVWEHAYYL ++ RRA Y+++   N++NW+   E ++ A
Sbjct: 61  NPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIW-NVLNWDVAEEFFKKA 111

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Mn superoxide dismutase (MnSOD)
species: Thermus thermophilus [TaxId: 274]