BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780495|ref|YP_003064908.1| superoxide dismutase
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780495|ref|YP_003064908.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 205

 Score =  428 bits (1100), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS
Sbjct: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS
Sbjct: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES
Sbjct: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180

Query: 181 FITNLVNWEYVCERYETAMLAQKVT 205
           FITNLVNWEYVCERYETAMLAQKVT
Sbjct: 181 FITNLVNWEYVCERYETAMLAQKVT 205


>gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 424

 Score = 23.9 bits (50), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 2   DFKLPNLPYSY--DDLSPYMSKETLE-----YHHDVHHKNYADNAL 40
           DF L N+  S   D +S  + +E  E     Y    HH+N++DN +
Sbjct: 251 DFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296


>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62]
          Length = 458

 Score = 23.9 bits (50), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 5/50 (10%)

Query: 159 IDVWEHAYYLDFKYRRAHYIESFITNLVNWEYV-----CERYETAMLAQK 203
           ID+W   ++LD   R     +SF+    N   +       RY     AQK
Sbjct: 167 IDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQK 216


>gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 157

 Score = 23.5 bits (49), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 21  KETLEYHHDVHHKNYADNALKLASDAEMLHLSLE 54
           KET+EY H    K   +   +LA   E++  SLE
Sbjct: 81  KETVEYLHRGIAKRAFERRFQLADFVEVMSASLE 114


>gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 328

 Score = 21.9 bits (45), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 10/41 (24%)

Query: 3  FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLA 43
          F++ N+P+  +DL        L + H VH KN+  N ++L+
Sbjct: 25 FQIYNMPF--NDL--------LFWSHTVHRKNFEPNHIQLS 55


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.317    0.133    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 140,914
Number of Sequences: 1233
Number of extensions: 5746
Number of successful extensions: 13
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 8
length of query: 205
length of database: 328,796
effective HSP length: 70
effective length of query: 135
effective length of database: 242,486
effective search space: 32735610
effective search space used: 32735610
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 36 (18.5 bits)