RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] (167 letters) >gnl|CDD|145656 pfam02620, DUF177, Uncharacterized ACR, COG1399. Length = 118 Score = 40.0 bits (94), Expect = 3e-04 Identities = 18/90 (20%), Positives = 35/90 (38%), Gaps = 11/90 (12%) Query: 63 MSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREPDI 122 + G + AT+ C LEP+ ++ +FVP + + + +I Sbjct: 1 LDGEVEATVTLPCDRCLEPVEYPLDVDFEELFVPEEEEAEDEELEDD---------DEEI 51 Query: 123 LPFSEDGVIDIGAVIADFTAIAINPYPKKE 152 L E ID+G ++ + +A+ P Sbjct: 52 LV--EGDEIDLGELVEEELLLALPMKPLCS 79 >gnl|CDD|33335 COG3533, COG3533, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 589 Score = 27.2 bits (60), Expect = 2.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 44 VESWCADVKLSVWKKVGVRMSGNLYATIIQS 74 + +WCA L V K ++ G YA I + Sbjct: 433 LPAWCAAPTLRVNGKEVIQTRGKGYARISRE 463 >gnl|CDD|34096 COG4389, COG4389, Site-specific recombinase [DNA replication, recombination, and repair]. Length = 677 Score = 26.9 bits (59), Expect = 2.8 Identities = 18/93 (19%), Positives = 39/93 (41%), Gaps = 10/93 (10%) Query: 5 SNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQL---GVMSVESWCADVKLSVWKKVGV 61 + ++Y + + + K ++ AEQ+ +V++ A + + V + V Sbjct: 387 AGFNYGIGFMIIHMLHCTVATKQPAMTAASFAEQVDLNEGKAVDNKLAKLLIDVCRSQSV 446 Query: 62 RMSGNLYATIIQSCVITL-------EPLLSEVE 87 + GN+ I+ +C+I+ PLLS Sbjct: 447 AVFGNVSIAILVACLISFGYAHLFHAPLLSPAT 479 >gnl|CDD|39791 KOG4591, KOG4591, KOG4591, Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only]. Length = 280 Score = 26.3 bits (57), Expect = 4.9 Identities = 20/90 (22%), Positives = 33/90 (36%), Gaps = 16/90 (17%) Query: 34 KLAEQLGVMSVESWCADVKLSVWKKVG----VRMSGNLYATIIQSCVITLEPLLSEV--- 86 + AE+L + + A++ W +G +MS L +I T PL + Sbjct: 176 EFAEELNARQLMNVAAEIIAGAWDDLGKADFAQMSAALLYKLIDGK--TENPLHKAIKIE 233 Query: 87 -EDTLGCIFVPSSSKF------LYPNGDTS 109 ED L F+ +K NG + Sbjct: 234 REDVLFLYFIEMDAKIPGILNDADHNGALA 263 >gnl|CDD|32099 COG1915, COG1915, Uncharacterized conserved protein [Function unknown]. Length = 415 Score = 26.0 bits (57), Expect = 5.8 Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 107 DTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKK----EGITFSNIYDT 162 D S + +V + + L +ID+GAVI + + + P P+ + + + T Sbjct: 45 DPSYAEILVSAPDHEHLEEILSELIDLGAVIPEIEEVELEPAPQDGVLPDDFYVTTNHPT 104 >gnl|CDD|176958 CHL00015, ndhE, NADH dehydrogenase subunit 4L. Length = 101 Score = 25.3 bits (56), Expect = 7.4 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 6/27 (22%) Query: 140 FTAIAINPYPKKEGITFSNIYDTDQLK 166 A+ IN +TFS+ +D+ QLK Sbjct: 38 LNAVNINF------VTFSDFFDSRQLK 58 >gnl|CDD|48515 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.. Length = 116 Score = 25.2 bits (55), Expect = 9.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Query: 125 FSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQ 164 + +DGV +G + D A+ + KK GITF + D D Sbjct: 48 YKDDGVEVVGVNVDDDDPAAVKAFLKKYGITFPVLLDPDG 87 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.134 0.393 Gapped Lambda K H 0.267 0.0763 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,967,949 Number of extensions: 96199 Number of successful extensions: 201 Number of sequences better than 10.0: 1 Number of HSP's gapped: 200 Number of HSP's successfully gapped: 10 Length of query: 167 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 80 Effective length of database: 4,383,754 Effective search space: 350700320 Effective search space used: 350700320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.5 bits)