RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] (167 letters) >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Length = 395 Score = 26.5 bits (58), Expect = 1.3 Identities = 11/43 (25%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Query: 119 EPDILPFSEDGV-IDIGAVIADFTAIAINPYPKKEGITFSNIY 160 +L FS+ +D GA I + A I K F ++ Sbjct: 204 RSGLLRFSDSEKMVDCGASIGESLAGLIGVTKGK----FERVW 242 >d1vpsa_ b.121.6.1 (A:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]} Length = 285 Score = 24.1 bits (52), Expect = 6.6 Identities = 11/47 (23%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 6 NYSYPVSVQAVFSTPMNLKLKADSLDCKKLA--EQLGVMSVESWCAD 50 Y V T ++ K L+ A ++ G+ VE W D Sbjct: 153 KYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPD 199 >d1sva1_ b.121.6.1 (1:) Polyomavirus coat proteins {Simian virus 40, Sv40 [TaxId: 10633]} Length = 348 Score = 23.7 bits (51), Expect = 8.3 Identities = 10/45 (22%), Positives = 16/45 (35%) Query: 6 NYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCAD 50 NY Q V + + + D K + ++ VE W D Sbjct: 154 NYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPD 198 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.134 0.393 Gapped Lambda K H 0.267 0.0559 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 612,673 Number of extensions: 26626 Number of successful extensions: 58 Number of sequences better than 10.0: 1 Number of HSP's gapped: 58 Number of HSP's successfully gapped: 5 Length of query: 167 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 88 Effective length of database: 1,322,926 Effective search space: 116417488 Effective search space used: 116417488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.0 bits)