RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >gnl|CDD|151839 pfam11399, DUF3192, Protein of unknown function (DUF3192). Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Length = 102 Score = 31.4 bits (72), Expect = 0.10 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 49 ISLVSQGSSRSHVIESLGSPSFS--ILHNGNRSQSFYYVSQKKK 90 I+ +S G S+ V+ LG+ FS + + Q +Y +Q K Sbjct: 28 IAKLSLGQSKDQVLTLLGTADFSEAKTKDDKQYQVLFYRTQHVK 71 >gnl|CDD|151949 pfam11512, Atu4866, Agrobacterium tumefaciens protein Atu4866. Atu4866 is a protein with unknown function from Agrobacterium tumefaciens however the structure has been determined. Atu4866 adopts a streptavidin-like fold and has a beta-barrel/sandwich which is formed by eight antiparallel beta-strands. Atu4866 has a potential ligand-binding site where is has a stretch of conserved residues on the surface. Length = 78 Score = 28.1 bits (63), Expect = 0.93 Identities = 10/15 (66%), Positives = 11/15 (73%) Query: 143 TADGFLRRLLNPNGR 157 TADG +R L PNGR Sbjct: 12 TADGRIRHELLPNGR 26 >gnl|CDD|184916 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional. Length = 584 Score = 26.8 bits (59), Expect = 2.9 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 8/40 (20%) Query: 78 RSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVV 117 RS++ +Y P + L P+ M ++ +I E VV Sbjct: 166 RSRTHHY--------PFRLLPPRTMRALIARICEQEGVVV 197 >gnl|CDD|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional. Length = 614 Score = 26.7 bits (59), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 56 SSRSHVIESLGSPSFSILH 74 S R HV+E + S S+LH Sbjct: 230 SDRDHVMELMSVASISMLH 248 >gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases. This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. Length = 442 Score = 26.5 bits (58), Expect = 3.6 Identities = 16/49 (32%), Positives = 26/49 (53%) Query: 14 KLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVI 62 K +F +AL I+ +DY + + SGA +AI L + R++VI Sbjct: 84 KDAFIEALLNIIPKRKMDYKLQFPGPSGADAVEAAIKLAKTYTGRTNVI 132 >gnl|CDD|102219 PRK06163, PRK06163, hypothetical protein; Provisional. Length = 202 Score = 25.9 bits (57), Expect = 5.1 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 51 LVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPV 94 LV++ VI +G+ +F + G R Q+FY + FP+ Sbjct: 22 LVAKLKDEEAVIGGIGNTNFDLWAAGQRPQNFYMLGSMGLAFPI 65 >gnl|CDD|130429 TIGR01362, KDO8P_synth, 3-deoxy-8-phosphooctulonate synthase. In Gram-negative bacteria, this is the first step in the biosynthesis of 3-deoxy-D-manno-octulosonate, part of the oligosaccharide core of lipopolysaccharide. Length = 258 Score = 25.4 bits (56), Expect = 6.3 Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 95 KFLSPKIMEYIVLKITF-GEKGVV 117 +FLSP M+ +V K+ G K ++ Sbjct: 125 QFLSPWDMKNVVEKVLSTGNKNIL 148 >gnl|CDD|178080 PLN02461, PLN02461, Probable pyruvate kinase. Length = 511 Score = 25.3 bits (56), Expect = 7.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Query: 45 DMSAISLVSQGSSRSHVIESLGSPSFSIL 73 D A+S V +GS V + LG + SIL Sbjct: 209 DFIALSFVRKGSDLVEVRKVLGEHAKSIL 237 >gnl|CDD|130740 TIGR01679, bact_FAD_ox, FAD-linked oxidoreductase. This model represents a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Length = 419 Score = 24.8 bits (54), Expect = 9.2 Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 104 YIVLKITFGEKGVVSSVSMERLPNRR 129 Y+ +++ G GV+S V+++ + R Sbjct: 152 YLAARVSLGALGVISQVTLQTVALFR 177 >gnl|CDD|179883 PRK04833, PRK04833, argininosuccinate lyase; Provisional. Length = 455 Score = 24.9 bits (55), Expect = 9.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 56 SSRSHVIESLGSPSFSILH 74 S R HV+E L S S++H Sbjct: 230 SDRDHVLELLSDASISMVH 248 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.399 Gapped Lambda K H 0.267 0.0605 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,619,891 Number of extensions: 153432 Number of successful extensions: 323 Number of sequences better than 10.0: 1 Number of HSP's gapped: 323 Number of HSP's successfully gapped: 18 Length of query: 159 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 73 Effective length of database: 4,136,185 Effective search space: 301941505 Effective search space used: 301941505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.5 bits)