RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >2pxg_A Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV} (A:) Length = 118 Score = 46.0 bits (109), Expect = 3e-06 Identities = 16/90 (17%), Positives = 28/90 (31%), Gaps = 9/90 (10%) Query: 41 GASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100 G + +A+ + G S+ V LG+PS + R + Y S ++ Sbjct: 15 GNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQR---WDYTSTQRV------DRLA 65 Query: 101 IMEYIVLKITFGEKGVVSSVSMERLPNRRF 130 E + F + VV Sbjct: 66 RTEIKNFTVFFENEQVVRWEGDYFPSQDEQ 95 >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation- regulated kinase 2; KI-(Y)-phosphorylation regulated kinase 2, PSK-H2; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* (A:299-375) Length = 77 Score = 28.2 bits (63), Expect = 0.57 Identities = 12/40 (30%), Positives = 19/40 (47%) Query: 61 VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100 +IE LG PS +L R+++F ++ V LS Sbjct: 13 MIELLGMPSQKLLDASKRAKNFVSXKGYPRYCTVTTLSDG 52 >2jmb_A AGR_L_42P, hypothetical protein ATU4866; structural genomics, ontario centre for structural proteomics, OCSP, unknown function; NMR {Agrobacterium tumefaciens str} (A:) Length = 79 Score = 26.3 bits (58), Expect = 2.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 143 TADGFLRRLLNPNGR 157 TADG +R+ L PNGR Sbjct: 11 TADGRIRQELLPNGR 25 >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis W83} (A:1-54,A:334-437) Length = 158 Score = 24.8 bits (54), Expect = 6.2 Identities = 9/34 (26%), Positives = 13/34 (38%), Gaps = 7/34 (20%) Query: 32 YHVSYGSISGASL-------DMSAISLVSQGSSR 58 + V Y + L AI+L + GS R Sbjct: 95 FTVGYKGXDSSKLIEKFVRYGXCAITLKTTGSKR 128 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.322 0.137 0.399 Gapped Lambda K H 0.267 0.0651 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,204,134 Number of extensions: 49486 Number of successful extensions: 95 Number of sequences better than 10.0: 1 Number of HSP's gapped: 94 Number of HSP's successfully gapped: 5 Length of query: 159 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 77 Effective length of database: 2,184,039 Effective search space: 168171003 Effective search space used: 168171003 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.6 bits)