BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 319 bits (817), Expect = 2e-89, Method: Compositional matrix adjust. Identities = 159/159 (100%), Positives = 159/159 (100%) Query: 1 MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSH 60 MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSH Sbjct: 1 MKKILFLNNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSH 60 Query: 61 VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSV 120 VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSV Sbjct: 61 VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVSSV 120 Query: 121 SMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA 159 SMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA Sbjct: 121 SMERLPNRRFNPNPHTIPAPIQTADGFLRRLLNPNGRSA 159 >gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 27.3 bits (59), Expect = 0.12, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 15/85 (17%) Query: 46 MSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYI 105 + +ISL+ QG S P+ I NG YV Q +KWF +F E Sbjct: 61 IKSISLLGQGDSYIQ----YDFPAHCIQENG-------YVGQMQKWFAFRF-QGLTSEIC 108 Query: 106 VLKITFG---EKGVVSSVSMERLPN 127 V + +G E + VS+ PN Sbjct: 109 VDRTAYGYESEFDAWTWVSLWDTPN 133 >gi|254780328|ref|YP_003064741.1| UDP-glucose 4-epimerase [Candidatus Liberibacter asiaticus str. psy62] Length = 333 Score = 24.6 bits (52), Expect = 0.90, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 117 VSSVSMERLPNRRFNPNPHTIPAPIQTADGF 147 + +++ + NP H IP I+TA G+ Sbjct: 173 AAGATLDSIIGEWHNPETHVIPLAIKTAMGY 203 >gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 22.3 bits (46), Expect = 4.0, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 88 KKKWFPVKFLSPKIMEYIVLKI 109 K K+FP+K K E+ ++KI Sbjct: 369 KTKFFPMKCFLSKRFEHTIMKI 390 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 21.9 bits (45), Expect = 5.4, Method: Compositional matrix adjust. Identities = 12/45 (26%), Positives = 19/45 (42%) Query: 15 LSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRS 59 + N A +I ++DYH +L S I++ SQ S Sbjct: 63 CTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQES 107 >gi|254780943|ref|YP_003065356.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 608 Score = 21.2 bits (43), Expect = 8.7, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 25/52 (48%) Query: 37 GSISGASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQK 88 G+I A + L ++ +S H IE + I+ N +R + ++ SQ+ Sbjct: 65 GNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQ 116 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.137 0.399 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,613 Number of Sequences: 1233 Number of extensions: 4309 Number of successful extensions: 11 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 9 length of query: 159 length of database: 328,796 effective HSP length: 67 effective length of query: 92 effective length of database: 246,185 effective search space: 22649020 effective search space used: 22649020 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)