HHsearch alignment for GI: 254780502 and conserved domain: COG1327

>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription].
Probab=96.60  E-value=0.021  Score=36.66  Aligned_cols=73  Identities=21%  Similarity=0.299  Sum_probs=42.9

Q ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             46980289732248679999999999870487764321079999999999999998506678985211454899999986
Q gi|254780502|r   29 VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQ  108 (954)
Q Consensus        29 m~ViKRnG~vv~Fd~~KI~~AI~KAFlav~~~~~~~s~~~~~~v~~lt~~Vv~~i~~~~~~~~~~~VE~IQD~VE~~LM~  108 (954)
T Consensus        49 ~~VvKkdg~Re~F~r~Kl~~gl~~A~~K---RpV--s---~e~ie~~v~~ie~~Lr~~g~--~EV~S~~IG~~VM~~Lk~  118 (156)
T COG1327          49 LIVVKKDGRREPFDREKLRRGLIRACEK---RPV--S---SEQIEEAVSHIERQLRSSGE--REVPSKEIGELVMEELKK  118 (156)
T ss_pred             CEEECCCCCCCCCCHHHHHHHHHHHHHC---CCC--C---HHHHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHHHHH
T ss_conf             0588758970878889999899999815---999--9---99999999999999986688--767889999999999971


Q ss_pred             CCC
Q ss_conf             120
Q gi|254780502|r  109 SGH  111 (954)
Q Consensus       109 ~g~  111 (954)
T Consensus       119 lD~  121 (156)
T COG1327         119 LDE  121 (156)
T ss_pred             CCH
T ss_conf             050