HHsearch alignment for GI: 254780502 and conserved domain: COG1328

>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism].
Probab=99.45  E-value=6.2e-13  Score=114.78  Aligned_cols=93  Identities=33%  Similarity=0.335  Sum_probs=79.1

Q ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             46980289732248679999999999870487764321079999999999999998506678985211454899999986
Q gi|254780502|r   29 VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQ  108 (954)
Q Consensus        29 m~ViKRnG~vv~Fd~~KI~~AI~KAFlav~~~~~~~s~~~~~~v~~lt~~Vv~~i~~~~~~~~~~~VE~IQD~VE~~LM~  108 (954)
T Consensus         3 ~~vikrDg~~~~fd~~~i~~ai~~a~~~~~~~d-------~~~~~~~~~~i~~~i~~-~~--~~~~i~~iq~~ve~~l~~   72 (700)
T COG1328           3 PVVIKRDGRVAEFDRNKIINAVRKAAKEIESFD-------IAKALIRATGVDEEVAR-IA--REVEIEEIQLLVEYLLMP   72 (700)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC-------HHHHHHHHHHHHHHHHH-HH--HHHHHHHHHHHHHHHHHH
T ss_conf             615722164256608999999998887642212-------88999999999987766-76--555499998899999975


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12089999988909999999987
Q gi|254780502|r  109 SGHHKITREYVLYREERSDVRAA  131 (954)
Q Consensus       109 ~g~~~VAkaYILYRe~Ra~~R~~  131 (954)
T Consensus        73 ~~~~~ia~~yieyr~~~d~~r~~   95 (700)
T COG1328          73 MINKILARAYIEYRFERDRVRET   95 (700)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             04577765416787778899887