HHsearch alignment for GI: 254780502 and conserved domain: COG1328

>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism].
Probab=96.65  E-value=0.068  Score=32.90  Aligned_cols=243  Identities=16%  Similarity=0.121  Sum_probs=135.2

Q ss_pred             HCCCEEEEECHHHCCC--CCCCCCEEEECCCCCCCCCCCCCCCCCCCCHH--HHHHHHHCCCCCCC----HHHHHHHHHH
Q ss_conf             2881278331120222--12466703404675200136654433211125--54068625434479----8885589999
Q gi|254780502|r  556 TGHPWITFKDPCNIRS--PQQHVGVVHSSNLCTEITLNSSSEETAVCNLG--SINLLAHFANNQFD----YDKLASTIRT  627 (954)
Q Consensus       556 tG~P~i~f~D~~N~~~--p~~~~g~I~~sNlC~Ei~l~~~~~e~~vCnL~--SiNL~~~v~~~~~D----~~~l~~~v~~  627 (954)
T Consensus       357 ~~~~~~~n~l~~D~~~~~g~~~~~MgCR~~l~~~~~~~~~~~~~~~gn~~vvTlNLPRiA~~a~gD~~kf~e~l~~~lei  436 (700)
T COG1328         357 FGKRYFPNMLNYDWVVLTGTFKNAMGCRTFLSGNETGDGEGDTLGTGNLGVVTLNLPRIALEAKGDDDKFFEILHERLEI  436 (700)
T ss_pred             CCCCCCCCHHHHHHHHCCCCCCEECCHHHCCCCCCCCCCCCCCCCCCCEEEEEEECCHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             07765411102323202788503122000125333577564566536524699846378888467766689999999999


Q ss_pred             HHHHHHHHCC-------CC--CHHHH-----H-----HHHHHHHHHHCCCCHHHHHHHHHHCCC--CCCCHHHHHHHHHH
Q ss_conf             9999765311-------21--00018-----8-----888644331000211118899997296--32337889999999
Q gi|254780502|r  628 AVRVLDNVID-------IN--CHTIE-----K-----AKKSNHTHRAIGLGLMGFQSALHLLHI--PYASPEAVEIADES  686 (954)
Q Consensus       628 avr~LDnVId-------~n--~yp~~-----~-----~~~~~~~~R~iGlGv~Glad~L~~~gi--~Y~S~ea~~~~~~i  686 (954)
T Consensus       437 ~keaL~~r~~r~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~t~s~g~igl~E~l~~~~g~~~~~~~ea~~~~~~i  516 (700)
T COG1328         437 AKEALLIRRERLKELIAKNALYMVGALGGRLNQEFDGSTIFRNGRATISLGFIGLNEMLKYLTGEHLHESEEAKKFGIKI  516 (700)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCCCCHHHHHCCCCCEEEEEECCHHHHHHHHCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999998753345201245423345564342651136605887534649999985487744689999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCHHHHHCCHHHCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99985779997898753117788766781213876244663005522533454021027289999999841204430110
Q gi|254780502|r  687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAI  766 (954)
Q Consensus       687 ~e~i~~~a~~aS~~LAkErG~~~~f~gS~~~~G~~~~d~~~~~~~~~~~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~ai  766 (954)
T Consensus       517 v~~~~~~~~~~~~----e~g-------~~~sv~~tPaEs~a------------------~RFar~D~~~fge~~------  561 (700)
T COG1328         517 VEYIREYADKWKK----ETG-------LRWSVYQTPAESLA------------------DRFARLDIFEFGEYK------  561 (700)
T ss_pred             HHHHHHHHHHHHH----HCC-------CCEEEEECCCCHHH------------------HHHHHHHHHHCCCCC------
T ss_conf             9999999998777----319-------62146525551477------------------999999899768531------


Q ss_pred             CCCHHHHHHHCCCCCCCCCCHHEEEEECCCCCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCC
Q ss_conf             77436877838898847560120345326761366465899989985898689999998519962776448867886505
Q gi|254780502|r  767 APTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHA  846 (954)
Q Consensus       767 APT~t~S~i~g~s~gIEP~~a~~y~r~~~~G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~  846 (954)
T Consensus       562 -------~i~~~~d--k~yYtNS~h~pv~---------------------------------------------------  581 (700)
T COG1328         562 -------VVRGDTD--KPYYTNSFHVPVD---------------------------------------------------  581 (700)
T ss_pred             -------CCCCCCC--CCEECCCEEEECC---------------------------------------------------
T ss_conf             -------0278888--8854487763057---------------------------------------------------


Q ss_pred             CHHCCCHHHHHHHHHHHCCHHCCCEEEEEECCCC--CHHHHHHHHHHHHHC
Q ss_conf             2220688999999985206300523204754899--989999999999972
Q gi|254780502|r  847 TAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEP--SGKKLDFIYRQAWLM  895 (954)
Q Consensus       847 ta~ei~~~~~i~~~a~~Q~~IDqsiS~tl~~~~~--t~~~i~~~y~~Aw~~  895 (954)
T Consensus       582 --~~~~~~eki~iE~~~~~~~~GG~I~~~~l~e~~~~~eal~~l~k~~~~~  630 (700)
T COG1328         582 --ADVTLGEKIRIEEKYHPLCNGGHIMHIELGESQADPEALMDLTKYIYKT  630 (700)
T ss_pred             --CCCCHHHHEEHHCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHC
T ss_conf             --8898667002010267556687799986477679989999999999725