HHsearch alignment for GI: 254780502 and conserved domain: LOAD_ATP_cone

>LOAD_ATP_cone consensus.
Probab=98.44  E-value=2.2e-06  Score=66.29  Aligned_cols=83  Identities=18%  Similarity=0.369  Sum_probs=67.8

Q ss_pred             EEEEECCCCEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH----CCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             28980599760259899999999985166668999999989730----37898889999999999998744187714677
Q gi|254780502|r  145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKN----MYDGLSESDLETALIFSSRTLIEKEPNYAKVT  220 (954)
Q Consensus       145 l~V~krDG~~e~~d~~ki~~~i~~ac~gL~~v~~~~i~~~~~~~----lydgitt~el~~~li~aA~~Li~~ePdy~~vA  220 (954)
T Consensus         1 l~ViKRdG~~~~F~~~KI~~ai~~A~~~~~~~~~~~~~~~v~~~l~~~~~~~i~veeIqd~Ve~~L~~~-----~~~~vA   75 (89)
T LOAD_ATP_cone     1 LYVVKRDGRTEPFSRGKIARALTRACEGTPEDDAYAIAQEVEAELRKQGRRGITTEEIQELVEEALAKL-----DYEEVA   75 (89)
T ss_pred             CEEEECCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHC-----CCHHHH
T ss_conf             979957993731109999999999986599768999999999999985689988999999999999968-----949999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999986
Q gi|254780502|r  221 ARFLLEKLRREV  232 (954)
Q Consensus       221 aRlll~~l~kev  232 (954)
T Consensus        76 ~~yi~YR~~r~~   87 (89)
T LOAD_ATP_cone    76 ARYAVYRLFKDI   87 (89)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999987602