HHsearch alignment for GI: 254780502 and conserved domain: PRK06539

>PRK06539 ribonucleotide-diphosphate reductase subunit alpha; Validated.
Probab=100.00  E-value=0  Score=1891.14  Aligned_cols=803  Identities=40%  Similarity=0.685  Sum_probs=759.8

Q ss_pred             CEEEEECCCCEECCCHHHHHHHHHHHHCCCCC--CCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             22898059976025989999999998516666--8999999989730378988899999999999987441877146779
Q gi|254780502|r  144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQD--VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTA  221 (954)
Q Consensus       144 ~l~V~krDG~~e~~d~~ki~~~i~~ac~gL~~--v~~~~i~~~~~~~lydgitt~el~~~li~aA~~Li~~ePdy~~vAa  221 (954)
T Consensus         2 ~m~ViKRDG~~E~~d~~KI~~~I~~a~~gl~~~~~~~~~i~~~v~~~lyDgItT~eIde~li~~aa~li~~~PdY~~lAa   81 (822)
T PRK06539          2 SITVVKRDGSKEPYDANKVNAAIEDAASGLDDAITWVTQLASELEITLFDGITTQQLDEAVIQVALQNVKDDPAFDTVAA   81 (822)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             65999589987010789999999999715874578899999999973579985999999999999984735825999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             99999999986210033310110446777547888998665576778777751-77399999764121011289899999
Q gi|254780502|r  222 RFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMM-DFDLVYLANDLKYERDFAFEYLGLQI  300 (954)
Q Consensus       222 Rlll~~l~kev~~~~~~~~~~~~~~~~~~~y~~~f~~~i~~G~~~~~i~~~l~-~~dl~~L~~~Id~~RD~~F~Y~Gl~t  300 (954)
T Consensus        82 Rill~~l~K~t~g~~~~~------~~l~~l~~~~f~~~i~~~v~~~l~d~~l~~~~dle~L~~~Id~~RD~~f~YfGlkt  155 (822)
T PRK06539         82 RLLLKSIYKRVLGDYKSP------EELRDLHAKHFRRFIEKGVEEGLLDSRLDGLFDLERLARALDPQRDELLKYIGVVT  155 (822)
T ss_pred             HHHHHHHHHHCCCCCCCH------HHHHHHHHHHHHHHHHHCCHHCCCCHHHHHHCCHHHHHHHHCHHHHCCCCCHHHHH
T ss_conf             999999998620556762------88999989999999983010021148877241599998454843431675059999


Q ss_pred             HHHHHHHCC-CCCEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             999762114-8927538899999999654164545368999999999743303586112221002222321102547664
Q gi|254780502|r  301 LYDRYFLHI-NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD  379 (954)
Q Consensus       301 L~~rYllk~-~~~~~E~pQ~~~mrVA~~la~~e~~~~~~~~~~Y~~ls~~~~~~atPtl~Nagt~~~qlsSCfl~~v~Ds  379 (954)
T Consensus       156 L~~~Yllk~~~~~~~E~PQ~m~mrvAm~l~~~e~~~~~~~~~~Y~~~S~~~~~~~tPtl~nagt~~~qlsSCfl~~v~Ds  235 (822)
T PRK06539        156 LNNRYGIRARNGDALEVPQYFWMRIAMGLSLNEKDPTSSALAFYEKMSKLEYLAAGSTLVNAGTCYPQLSNCFVMEMQDD  235 (822)
T ss_pred             HHHHHCCCCCCCCEEECHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCCCCCEEEEECCCC
T ss_conf             99763502789986347089999999998752247389999999999707734699534238887888752698314887


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCH
Q ss_conf             13589999899999851054441012443111200012787642889999998999997404666772478983567889
Q gi|254780502|r  380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDV  459 (954)
Q Consensus       380 l~~I~~~~~~~a~isk~ggGiG~~~s~iR~~Gs~I~g~~G~ssG~v~flk~~n~~~~~v~QgG~RrGA~~~~l~~wH~Di  459 (954)
T Consensus       236 l~~I~~~~~~~a~isk~gGGiG~~~s~iR~~Gs~I~~~~g~ssG~vpfmk~~d~~~~~v~QGG~RrGA~a~yL~~wH~DI  315 (822)
T PRK06539        236 IEHIAKTTRDVMWLTKGTGGIGLSVSKLRAQGSPIRSNNTTSTGPIPFMHTIDSVLRAVSRGGKKFGALCFYMENWHMDF  315 (822)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCH
T ss_conf             89999999999997415775110112216679630688860688435999999999998708976533578417887479


Q ss_pred             HHHHHHCCCCCCHHHHHHCCCHHHCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             99973025787302332023202034879999852128747871011444100134437899877875210488605778
Q gi|254780502|r  460 EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRK  539 (954)
Q Consensus       460 ~eFl~~k~n~G~~~~r~~~~~~av~i~D~Fm~~v~~~~~w~Lf~P~~~~~L~d~~g~~fe~~Y~~~e~~~~~~~~~~~k~  539 (954)
T Consensus       316 ~eFl~~K~~~Gd~~~r~~~l~~~v~i~D~FM~rv~~~~~w~Lf~P~~~~~l~~~~g~~f~~~y~~~~~~~~~~~~~~~k~  395 (822)
T PRK06539        316 PEFLDLRQNSGDPYRRTRTANTAVWISDEFMKRVQNDEDWYLFDPLETPDLNELYGKAFSKRYAYYVNQAEAGRIRMFKR  395 (822)
T ss_pred             HHHHHHCCCCCCHHHHHHCCCEEECCCHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99986222468687775407600021799999997299789868865761877651589999999997522365302148


Q ss_pred             EEHHHHHHHHHHHHHHHCCCEEEEECHHHCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHH
Q ss_conf             66889999999999882881278331120222124667034046752001366544332111255406862543447988
Q gi|254780502|r  540 ISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYD  619 (954)
Q Consensus       540 i~A~~l~~~i~~~~~etG~P~i~f~D~~N~~~p~~~~g~I~~sNlC~Ei~l~~~~~e~~vCnL~SiNL~~~v~~~~~D~~  619 (954)
T Consensus       396 i~Arel~~~Il~~~~etG~Pyi~f~D~~N~~~~~~~~g~I~~SNLC~EI~lp~~~~~~~vCnL~SiNL~~~v~d~~~D~~  475 (822)
T PRK06539        396 IGAREQFRAILMSLQTTSHPWLTWKDTINNRALNNNTGTIHLSNLCTEICLPQDRDNVSVCNLASINLSRHLADGEIDWA  475 (822)
T ss_pred             ECHHHHHHHHHHHHHHHCCCEEEECHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHHHHCCCCCCCHH
T ss_conf             63999999999999985896475221210135777678846565877877778888745897001068766356423167


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             85589999999976531121000188888644331000211118899997296323378899999999998577999789
Q gi|254780502|r  620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASV  699 (954)
Q Consensus       620 ~l~~~v~~avr~LDnVId~n~yp~~~~~~~~~~~R~iGlGv~Glad~L~~~gi~Y~S~ea~~~~~~i~e~i~~~a~~aS~  699 (954)
T Consensus       476 ~l~~~v~~avr~LDnvID~~~yp~~~a~~~n~~~R~IGLGvmGlad~L~~~gi~y~S~eA~~l~~~i~e~i~~~a~~aS~  555 (822)
T PRK06539        476 LLEESTRLAVRQLDNLIDITCSSVKEADFSNQQNRAIGLGVMGFTDLVERLGYSYESEEAYDLIDRIMEHISYAAIDESA  555 (822)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78888999999888877413352999999988348710463089999998599868999999999999999999999999


Q ss_pred             HHHHHCCCCCCCCCCHHHCCCCCHHHHHCCHHHCC-CCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCC
Q ss_conf             87531177887667812138762446630055225-33454021027289999999841204430110774368778388
Q gi|254780502|r  700 ELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV  778 (954)
Q Consensus       700 ~LAkErG~~~~f~gS~~~~G~~~~d~~~~~~~~~~-~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~aiAPT~t~S~i~g~  778 (954)
T Consensus       556 eLAkErG~~p~f~gS~~~~G~l~~d~~~~~~~~~g~~~~~~~~~~~dW~~Lr~~i-k~G~RNs~l~AiAPT~S~S~I~g~  634 (822)
T PRK06539        556 DLAEERGAYPNFEGSRWSKGMVPIDSIALVEADRGVPVSVNRTTRLDWDALRAKV-RGGMRNATLMAIAPTASIGLVAGT  634 (822)
T ss_pred             HHHHHHCCCCCCCCCHHHCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH-HCCCCCCCEECCCCCHHHHHHCCC
T ss_conf             9999759998888882112776333565544431674225853120499999875-507325140535883888886388


Q ss_pred             CCCCCCCCHHEEEEECCCCCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHH
Q ss_conf             98847560120345326761366465899989985898689999998519962776448867886505222068899999
Q gi|254780502|r  779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE  858 (954)
Q Consensus       779 s~gIEP~~a~~y~r~~~~G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~  858 (954)
T Consensus       635 s~gIEP~~sn~y~r~~~~G~f~~vN~~l~~~L~~~g~w-~~~~~~i~~~~Gsvq~i~~lp~~~k~~ykTa~eI~~~~~I~  713 (822)
T PRK06539        635 TPGLDPQFSQIFSRSTSSGKFLEVNRNLVLDLKELGLW-ETVREDILRSQGDIQQIAAIPDEIKANYRTSFQLSPYAFLE  713 (822)
T ss_pred             CCCCCCCCCCEEEEECCCCEEEEECHHHHHHHHHCCCC-HHHHHHHHHHCCCCCCCCCCCHHHHHHCCCHHHCCHHHHHH
T ss_conf             87637571212578505643689777789999984873-99999999708986685668988997535096589999999


Q ss_pred             HHHHHCCHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCC---------CCCCCC
Q ss_conf             99852063005232047548999899999999999729867979658841111210124444321---------112345
Q gi|254780502|r  859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL---------NAVPVT  929 (954)
Q Consensus       859 ~~a~~Q~~IDqsiS~tl~~~~~t~~~i~~~y~~Aw~~GlKt~yy~R~~s~~~~ek~t~~~~~~~~---------~~~~~~  929 (954)
T Consensus       714 ~aA~rQ~~IDQsqS~nl~~~~~~~~~l~~~y~~AWk~GlKT~YYlrt~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~  793 (822)
T PRK06539        714 VAARAQKWVDQAISRNMYLESRDIGDMMDIYTAAWEMGVKTTYYLHMKPRHTAEQSTVKVNKSTEADGGNRRGFAGFGAG  793 (822)
T ss_pred             HHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCEECCCCCCCCCCHHEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99986676520023502308999999999999999818441102478633340320213451000236876676676788


Q ss_pred             CCCCCCCCCCCCCCCCCCC----CCCCCC
Q ss_conf             5555543234542236888----500069
Q gi|254780502|r  930 DPNSSTHSLGIPSSCTSDT----ECEVCQ  954 (954)
Q Consensus       930 ~~~~~~~~~~~~~~~~~~p----~CeaCq  954 (954)
T Consensus       794 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  822 (822)
T PRK06539        794 VPPAVPASAAPASTATAEAPAPQSAPAPR  822 (822)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99888876577667667899987889998