HHsearch alignment for GI: 254780502 and conserved domain: PRK07111

>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional.
Probab=100.00  E-value=2.7e-29  Score=236.20  Aligned_cols=96  Identities=34%  Similarity=0.543  Sum_probs=84.3

Q ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             46980289732248679999999999870487764321079999999999999998506678985211454899999986
Q gi|254780502|r   29 VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQ  108 (954)
Q Consensus        29 m~ViKRnG~vv~Fd~~KI~~AI~KAFlav~~~~~~~s~~~~~~v~~lt~~Vv~~i~~~~~~~~~~~VE~IQD~VE~~LM~  108 (954)
T Consensus         3 ~~V~KRDG~~v~Fd~~KI~~AI~KA~~~~g~~-------~~~~~~~~~~~v~~~i~~~--~~~~~sVe~IQd~VE~~L~e   73 (703)
T PRK07111          3 LYVVKRDGREVEFNEEKITNAIKKAAEAIGIE-------DESEALELTQKVIKYIEDS--NKEEITVEEIQDLVEKVLME   73 (703)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCC-------CHHHHHHHHHHHHHHHHHH--CCCCCCHHHHHHHHHHHHHH
T ss_conf             28991689878878799999999999860887-------7899999999999999982--79999799999999999997


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1208999998890999999998764
Q gi|254780502|r  109 SGHHKITREYVLYREERSDVRAAQS  133 (954)
Q Consensus       109 ~g~~~VAkaYILYRe~Ra~~R~~~~  133 (954)
T Consensus        74 ~g~~~vAkaYi~YR~~r~~~R~~~~   98 (703)
T PRK07111         74 NGHKEIAKAYIIYREERTKIREIKS   98 (703)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8859999999999999999887676