HHsearch alignment for GI: 254780502 and conserved domain: PRK07111

>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional.
Probab=96.40  E-value=0.015  Score=37.77  Aligned_cols=317  Identities=17%  Similarity=0.200  Sum_probs=167.3

Q ss_pred             HHCCCCCCCCEEEEEECCCCCHHHHHHHCCCCCCHHHHHHCCCHHHCCCHHHHHHHHCC---CCEEEEECCCCCCCCCCC
Q ss_conf             74046667724789835678899997302578730233202320203487999985212---874787101144410013
Q gi|254780502|r  438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN---AGWTLFSPDEVSDLHDLY  514 (954)
Q Consensus       438 v~QgG~RrGA~~~~l~~wH~Di~eFl~~k~n~G~~~~r~~~~~~av~i~D~Fm~~v~~~---~~w~Lf~P~~~~~L~d~~  514 (954)
T Consensus       278 lNt~~sr~G~QtPFt~i~~-------------g~d~~~-----e~~~i~~a~l~v~~eG~~~g~-~~~FP~~i~~i~~~~  338 (703)
T PRK07111        278 LNTMHSRAGSQVPFSSINY-------------GTDTSK-----EGRLVIENLLKATEKGLGKGE-TPIFPIQIFKVKEGV  338 (703)
T ss_pred             HCCCCCCCCCCCCCEEEEC-------------CCCCCH-----HHHHHHHHHHHHHHHHCCCCC-CCCCCEEEEEECCCC
T ss_conf             2135577888477157642-------------876788-----999999999999984156999-887870147724898


Q ss_pred             CCCHHHHHHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHHHHCCCEEEEECHH-HCC-CCCCCCCEEEECCCCCCCCC--
Q ss_conf             44378998778752104886057786688999999999988288127833112-022-21246670340467520013--
Q gi|254780502|r  515 GKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC-NIR-SPQQHVGVVHSSNLCTEITL--  590 (954)
Q Consensus       515 g~~fe~~Y~~~e~~~~~~~~~~~k~i~A~~l~~~i~~~~~etG~P~i~f~D~~-N~~-~p~~~~g~I~~sNlC~Ei~l--  590 (954)
T Consensus       339 n~~~--------------------~dpn~dl~~la~~~taK~~~P~f~~~d~~~~~~~~~~~~~~~~~~~M-gCR~rl~~  397 (703)
T PRK07111        339 NYEE--------------------GDPNYDLFKLACRVAAKRLFPNFMFLDAPFNKEYYDKGRPETEVATM-GCRTRVMS  397 (703)
T ss_pred             CCCC--------------------CCCCHHHHHHHHHHHHHHCCCCEEECCCCCCHHHCCCCCCCCCCCCC-CHHHHHCC
T ss_conf             6899--------------------99627999999999887568867805764113303567788777778-40302113


Q ss_pred             CCCC--CCCCCCCHH--HHHHHHHCC--CCCCC--HHHHHHHHHHHHHHHH-------HHCCCCCHHHH-----------
Q ss_conf             6654--433211125--540686254--34479--8885589999999976-------53112100018-----------
Q gi|254780502|r  591 NSSS--EETAVCNLG--SINLLAHFA--NNQFD--YDKLASTIRTAVRVLD-------NVIDINCHTIE-----------  644 (954)
Q Consensus       591 ~~~~--~e~~vCnL~--SiNL~~~v~--~~~~D--~~~l~~~v~~avr~LD-------nVId~n~yp~~-----------  644 (954)
T Consensus       398 ~~~g~~~~~GrgnigVVTiNLPRia~~a~gd~~~F~~~Ld~~l~l~~~~L~~r~~~~~~~~-~~~~P~l~~~g~~~~~~~  476 (703)
T PRK07111        398 NVNGEEGSIGRGNLSFTTINLPRLAILAKGDIEKFFELLDERLDLAIEQLLHRYEVQKTLK-VKDFPFLMGQGLWKGSEN  476 (703)
T ss_pred             CCCCCCCCCCCCEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCHHHHCCCCCCCCC
T ss_conf             5578816766540346870468999996799999999999999999999999999998510-033847776676557543


Q ss_pred             -----HHHHHHHHHHHCCCCHHHHHHHHHHC-CCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCHH
Q ss_conf             -----88886443310002111188999972-9632-337889999999999857799978987531177-887667812
Q gi|254780502|r  645 -----KAKKSNHTHRAIGLGLMGFQSALHLL-HIPY-ASPEAVEIADESMEFISFHAISASVELAQERGA-YSSFKGSLW  716 (954)
Q Consensus       645 -----~~~~~~~~~R~iGlGv~Glad~L~~~-gi~Y-~S~ea~~~~~~i~e~i~~~a~~aS~~LAkErG~-~~~f~gS~~  716 (954)
T Consensus       477 l~~~d~i~~-~~~~~t~tIG~iGl~E~~~~~~G~~~~e~~e~~~fal~il~~mr~~~~~~~----~etg~~~~le-aT--  548 (703)
T PRK07111        477 LGPEDSIEP-VLKQGTLGIGFIGLAETLVALTGKHHGESEEAQELGLKIVSHMRDRCDEAT----EEYKLNFSLL-AT--  548 (703)
T ss_pred             CCCCCCHHH-HHHCCEEEEECCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH----HHHCCCEEEE-EC--
T ss_conf             688751778-871774763220588999996499988998899999999999999999999----9979972689-88--


Q ss_pred             HCCCCCHHHHHCCHHHCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCHHEEEEECCC
Q ss_conf             13876244663005522533454021027289999999841204430110774368778388988475601203453267
Q gi|254780502|r  717 DQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS  796 (954)
Q Consensus       717 ~~G~~~~d~~~~~~~~~~~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~aiAPT~t~S~i~g~s~gIEP~~a~~y~r~~~~  796 (954)
T Consensus       549 -----PAEs------------------~~~Rfak~D~~~fg~----------------I~g~td--~~YYTNS~h-----  582 (703)
T PRK07111        549 -----PAEG------------------LSGKFIKKDRKEFGE----------------IKGVTD--KDYYTNSFH-----  582 (703)
T ss_pred             -----CCCH------------------HHHHHHHHHHHHCCC----------------CCCCCC--CCCCCCCCC-----
T ss_conf             -----3022------------------779999999997497----------------789888--982048754-----


Q ss_pred             CCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHHHHHHHCCHHCCCEEEEEE
Q ss_conf             61366465899989985898689999998519962776448867886505222068899999998520630052320475
Q gi|254780502|r  797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLY  876 (954)
Q Consensus       797 G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~~~a~~Q~~IDqsiS~tl~  876 (954)
T Consensus       583 -------------------------------------~-----------pv~~~~~~fekl~~E~~~~~~~tGG~I~hv~  614 (703)
T PRK07111        583 -------------------------------------V-----------PVYYPISIKEKIDIEAPYHKLCNGGHISYIE  614 (703)
T ss_pred             -------------------------------------C-----------CCCCCCCHHHHHHHHCCCCCCCCCEEEEEEE
T ss_conf             -------------------------------------6-----------8999999899997433223523763899997


Q ss_pred             CC-CC--CHHHHHHHHHHHHHCCC
Q ss_conf             48-99--98999999999997298
Q gi|254780502|r  877 LD-EP--SGKKLDFIYRQAWLMGL  897 (954)
Q Consensus       877 ~~-~~--t~~~i~~~y~~Aw~~Gl  897 (954)
T Consensus       615 l~~~~~~n~~a~~~v~~~~~~~~i  638 (703)
T PRK07111        615 LDGDPSKNVEAMEIIVYAMKNTGI  638 (703)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             478777889999999999984799