HHsearch alignment for GI: 254780502 and conserved domain: PRK08447

>PRK08447 ribonucleotide-diphosphate reductase subunit alpha; Validated.
Probab=100.00  E-value=0  Score=1778.49  Aligned_cols=719  Identities=42%  Similarity=0.713  Sum_probs=674.5

Q ss_pred             EEEEECCCCEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHC-CCCHHHHHHHH
Q ss_conf             28980599760259899999999985166668999999989730378988899999999999987441-87714677999
Q gi|254780502|r  145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEK-EPNYAKVTARF  223 (954)
Q Consensus       145 l~V~krDG~~e~~d~~ki~~~i~~ac~gL~~v~~~~i~~~~~~~lydgitt~el~~~li~aA~~Li~~-ePdy~~vAaRl  223 (954)
T Consensus         1 m~ViKRdG~~e~~d~~KI~~~i~~a~~gl~~v~~~~i~~~~~~~lydgitT~eI~~~li~ta~~~is~~~PdY~~lAaRl   80 (788)
T PRK08447          1 ITVIKRNGRTEPLDISKIQKYTSDAVEGLEGVSQSELEVDAKIQFRDKITTEEIQQTLIKTAVDKIDIDTPNWTFVAARL   80 (788)
T ss_pred             CEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             95893899881207999999999996789889889999998745679984999999999999985775685499999999


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9999999862100333101104467775478889986655767787777517-739999976412101128989999999
Q gi|254780502|r  224 LLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD-FDLVYLANDLKYERDFAFEYLGLQILY  302 (954)
Q Consensus       224 ll~~l~kev~~~~~~~~~~~~~~~~~~~y~~~f~~~i~~G~~~~~i~~~l~~-~dl~~L~~~Id~~RD~~F~Y~Gl~tL~  302 (954)
T Consensus        81 ~l~~l~ke~~~~~~--------------~-~~~~~~~~~~~~~~~~~~~l~~~~~le~L~~~I~~~RD~~f~y~g~~~l~  145 (788)
T PRK08447         81 FLYDLYHKVSGFTG--------------Y-NHLKEYFEKGEKEGRILLGLKEKYDLDDLNAYIKPERDLQFNYLGIKTLY  145 (788)
T ss_pred             HHHHHHHHHCCCCC--------------H-HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             99999998608765--------------6-89999999877524214645436579999704472443577819999999


Q ss_pred             HHHHHC-CCCCEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCHH
Q ss_conf             976211-4892753889999999965416454536899999999974330358611222100222232110254766413
Q gi|254780502|r  303 DRYFLH-INGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY  381 (954)
Q Consensus       303 ~rYllk-~~~~~~E~pQ~~~mrVA~~la~~e~~~~~~~~~~Y~~ls~~~~~~atPtl~Nagt~~~qlsSCfl~~v~Dsl~  381 (954)
T Consensus       146 ~~Yl~k~~~~~~~E~PQ~~~mrvA~~~~~~~~~~~~~~~~~Y~~~s~~~~~~~tPtl~nagt~~~qlsSCfl~~v~Dsl~  225 (788)
T PRK08447        146 DRYLLKDRNNNPIELPQHMFMAIAMFLAQNEQDPQEWAKKFYDLISKFEVMLATPTLSNARTTRHQLSSCYIGSTPDNIE  225 (788)
T ss_pred             HHHCCCCCCCCEEECHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCCHH
T ss_conf             84282668999837789999999999715755679999999999875882469865642899998767458268898889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCHHH
Q ss_conf             58999989999985105444101244311120001278764288999999899999740466677247898356788999
Q gi|254780502|r  382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEE  461 (954)
Q Consensus       382 ~I~~~~~~~a~isk~ggGiG~~~s~iR~~Gs~I~g~~G~ssG~v~flk~~n~~~~~v~QgG~RrGA~~~~l~~wH~Di~e  461 (954)
T Consensus       226 ~I~~~~~~~a~isk~gGGiG~~~s~iR~~Gs~I~~~~g~ssG~vpfmk~~~~~~~~v~QgG~RrGA~~~yl~~wH~DI~~  305 (788)
T PRK08447        226 GIFDSYKEMALLSKFGGGIGWDWSKVRAMGSYIDGHKNAAGGIIPFLKITNDIAIAVDQLGTRKGAIAVYLEPWHMDISD  305 (788)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHH
T ss_conf             99999999999850377332333203778971378887379831499999999999973898663058875788551999


Q ss_pred             HHHHCCCCCCHHHHHHCCCHHHCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEE
Q ss_conf             97302578730233202320203487999985212874787101144410013443789987787521048860577866
Q gi|254780502|r  462 FLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS  541 (954)
Q Consensus       462 Fl~~k~n~G~~~~r~~~~~~av~i~D~Fm~~v~~~~~w~Lf~P~~~~~L~d~~g~~fe~~Y~~~e~~~~~~~~~~~k~i~  541 (954)
T Consensus       306 Fl~~k~n~g~e~~r~~~l~~~v~i~D~FM~rv~~d~~w~Lf~P~~~~~L~~~~G~eFe~~Y~~~e~~~----~~~k~~i~  381 (788)
T PRK08447        306 FIDLRKNSGEERRRAHDLFPALWINDLFMKRVEEDAMWTLFDPYECKDLTELYGEEFEKRYLEYEKDE----KIIKEYIN  381 (788)
T ss_pred             HHHHCCCCCCHHHHHHCCHHHHCCCHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCC----CCCEEEEC
T ss_conf             99851357735553202606650349999999839986986863575077775268899999987457----75137872


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECHHHCCCCCCCCCEEEECCCCCCCCCCCCCC--------------------------
Q ss_conf             889999999999882881278331120222124667034046752001366544--------------------------
Q gi|254780502|r  542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSE--------------------------  595 (954)
Q Consensus       542 A~~l~~~i~~~~~etG~P~i~f~D~~N~~~p~~~~g~I~~sNlC~Ei~l~~~~~--------------------------  595 (954)
T Consensus       382 Ar~l~~~I~~~~~etG~Pyi~f~D~~N~~np~~~~g~I~sSNLC~EI~q~t~p~~~~~~v~~~~g~~~~~~~e~~v~~d~  461 (788)
T PRK08447        382 AKELWKKILTNYFETGLPFLCFKDNANRANPNAHAGIIRSSNLCTEIFQNTAPNHYKIKVEFEDGSIEFFEEEELVTTDS  461 (788)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECHHHHCCCCCCCCEEEECCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCHHHCCCCC
T ss_conf             89999999999998568604660366644986678837862387442467883122100012345422222010003343


Q ss_pred             ------------------------------CCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             ------------------------------33211125540686254344798885589999999976531121000188
Q gi|254780502|r  596 ------------------------------ETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEK  645 (954)
Q Consensus       596 ------------------------------e~~vCnL~SiNL~~~v~~~~~D~~~l~~~v~~avr~LDnVId~n~yp~~~  645 (954)
T Consensus       462 ~~~~~~~~~~~ld~~~~~~~~~~~~~~~~g~~avCnL~SinL~~~~-----~~~~l~~~v~~avr~LDnVID~n~yP~~~  536 (788)
T PRK08447        462 GITKPAKKITSLDSLKGKKIYIVEKEKKDGKTAVCNLASINLSKIN-----TKEDIERVVPIAIRMLDNVIDLNFYPNRK  536 (788)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             2122111012222224532100012356775699865885898732-----76679999999999999866036685399


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCHHH
Q ss_conf             88864433100021111889999729632337889999999999857799978987531177887667812138762446
Q gi|254780502|r  646 AKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDS  725 (954)
Q Consensus       646 ~~~~~~~~R~iGlGv~Glad~L~~~gi~Y~S~ea~~~~~~i~e~i~~~a~~aS~~LAkErG~~~~f~gS~~~~G~~~~d~  725 (954)
T Consensus       537 ~~~~n~~~R~IGLGvmGlad~L~~lgi~Y~S~ea~~~~~~i~e~i~~~a~~aS~eLAkerG~~p~f~~S~~~~G~l~~d~  616 (788)
T PRK08447        537 VKATNLKSRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDEIMEQISYNAIDASSNLAKEKGVYPDFEGSNWSKGIFPIDK  616 (788)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHH
T ss_conf             99998987750855012999999769986898999999999999999999999999996589988888822217672432


Q ss_pred             HHCCHHHCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCHHEEEEECCCCCEEEECHH
Q ss_conf             63005522533454021027289999999841204430110774368778388988475601203453267613664658
Q gi|254780502|r  726 IGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF  805 (954)
Q Consensus       726 ~~~~~~~~~~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~aiAPT~t~S~i~g~s~gIEP~~a~~y~r~~~~G~~~~vn~~  805 (954)
T Consensus       617 ~~~~~~~~~~~~~l~~~~~dW~~Lr~~i~k~G~RNs~l~AiaPT~StS~I~g~t~sIEP~~~~~~~~~~~~g~~~~~~p~  696 (788)
T PRK08447        617 ANNEAKKLTDRGGLFDQACDWQKLREKVKKDGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEENLSGLIPVVVPN  696 (788)
T ss_pred             HCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEECCCHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEECCC
T ss_conf             01024555202556653024999999998738251224532884799998099854284813346885235278876898


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHHHHHHHCCHHCCCEEEEEECC--CCCHH
Q ss_conf             9998998589868999999851996277644886788650522206889999999852063005232047548--99989
Q gi|254780502|r  806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLD--EPSGK  883 (954)
Q Consensus       806 l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~~~a~~Q~~IDqsiS~tl~~~--~~t~~  883 (954)
T Consensus       697 l-------------------------------~~~~~~~y~tA~ei~~~~~I~~~A~rQ~~IDQs~S~nl~~~~~~~t~~  745 (788)
T PRK08447        697 L-------------------------------SPETWQYYTPAYDLDQKLLIKAAAVRQKWIDQGQSLNIFLSLDKASGK  745 (788)
T ss_pred             C-------------------------------CHHHHHHHCCHHHCCHHHHHHHHHHHCCCCCCCCCCCEEECCCCCCHH
T ss_conf             8-------------------------------877998708586399899999999875785311137162089999999


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCC
Q ss_conf             99999999997298679796588411112101244
Q gi|254780502|r  884 KLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG  918 (954)
Q Consensus       884 ~i~~~y~~Aw~~GlKt~yy~R~~s~~~~ek~t~~~  918 (954)
T Consensus       746 ~l~~~y~~Awk~GlKt~YY~Rt~~~~~~~~~~~d~  780 (788)
T PRK08447        746 YLNEIYTLAWKLGLKSTYYLRSESPDSEKKNVLDR  780 (788)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHHHHHHCCCCC
T ss_conf             99999999998598879996388520334414878