HHsearch alignment for GI: 254780502 and conserved domain: PRK09209

>PRK09209 ribonucleotide-diphosphate reductase subunit alpha; Validated.
Probab=94.60  E-value=0.12  Score=31.06  Aligned_cols=87  Identities=16%  Similarity=0.231  Sum_probs=52.6

Q ss_pred             CCHHHCCCEEEECCC-CCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHH
Q ss_conf             510211646980289-7322486799999999998704877643210799999999999999985066789852114548
Q gi|254780502|r   22 FPEKIKGVQVIKRNG-GVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQD  100 (954)
Q Consensus        22 ~~~~~~~m~ViKRnG-~vv~Fd~~KI~~AI~KAFlav~~~~~~~s~~~~~~v~~lt~~Vv~~i~~~~~~~~~~~VE~IQD  100 (954)
T Consensus        24 ~~~~~~~~~v~k~~g~~~~p~~~~k~~~~v~~a~~~l~~v~~----------~~v~~~~~~~~--q~~dg--i~t~~i~~   89 (785)
T PRK09209         24 KEEQNVSTWITKEAGNRKLPFEPERLERAIDQIHAEFPQLDV----------EDYKRRVFGFV--ERKDS--VNADDLVD   89 (785)
T ss_pred             CCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCH----------HHHHHHHHHCC--CCCCC--CCHHHHHH
T ss_conf             767765358994688746886889999999999654668999----------99999998188--54289--61999999


Q ss_pred             HHH---HHHHH---CCCHHHHHHHHHHH
Q ss_conf             999---99986---12089999988909
Q gi|254780502|r  101 QVE---CSLMQ---SGHHKITREYVLYR  122 (954)
Q Consensus       101 ~VE---~~LM~---~g~~~VAkaYILYR  122 (954)
T Consensus        90 ~li~~a~~li~~~~P~y~~vaarl~~~~  117 (785)
T PRK09209         90 LLIREAEARVDLTTPEWEHFAARLYLRR  117 (785)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             9999999865877974899999999999