HHsearch alignment for GI: 254780502 and conserved domain: PRK12364

>PRK12364 ribonucleotide-diphosphate reductase subunit alpha; Provisional.
Probab=100.00  E-value=0  Score=2008.30  Aligned_cols=796  Identities=35%  Similarity=0.550  Sum_probs=732.5

Q ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             46980289732248679999999999870487764321079999999999999998506678985211454899999986
Q gi|254780502|r   29 VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQ  108 (954)
Q Consensus        29 m~ViKRnG~vv~Fd~~KI~~AI~KAFlav~~~~~~~s~~~~~~v~~lt~~Vv~~i~~~~~~~~~~~VE~IQD~VE~~LM~  108 (954)
T Consensus         1 l~ViKRnG~vv~Fd~~KI~~AI~KAFlAv~~~~~------~e~v~~l~~~V~~~~~~~~~~g~~~hIE~IQD~VEl~LMr   74 (842)
T PRK12364          1 MEIIKRNGETEPYDREKIAVAIRKAFASVGNELA------PEIIYSLVAEVENFLFEMNKNGANVSVEKIQDLVEKTLME   74 (842)
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCH------HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9178359960587879999999999997589731------7899999999999999747899996840058999999986


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCEECCCHHHHHHHHHHHHCCCC--CCCHHHHHHHHH
Q ss_conf             120899999889099999999876421000023442289805997602598999999999851666--689999999897
Q gi|254780502|r  109 SGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ--DVSSKIVLSETY  186 (954)
Q Consensus       109 ~g~~~VAkaYILYRe~Ra~~R~~~~~~~~~~~~~~~l~V~krDG~~e~~d~~ki~~~i~~ac~gL~--~v~~~~i~~~~~  186 (954)
T Consensus        75 ~G~~~VAraYILYReeRa~~R~~~~~~~~~~------------------~~~~~~~~l~~i~~~~~~~~~~l~~l~~~~~  136 (842)
T PRK12364         75 HGFYAEVKNFILYRWQRTKRRKAREQIICFF------------------TDDTVLGVLKEIQKDFTSPEYSLDALAEKFL  136 (842)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------------------CCHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             7769999999998999999998654222245------------------6167888999887403621314999999998


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             303789888999999999999874418-7714677999999999986210033310110446777547888998665576
Q gi|254780502|r  187 KNMYDGLSESDLETALIFSSRTLIEKE-PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK  265 (954)
Q Consensus       187 ~~lydgitt~el~~~li~aA~~Li~~e-Pdy~~vAaRlll~~l~kev~~~~~~~~~~~~~~~~~~~y~~~f~~~i~~G~~  265 (954)
T Consensus       137 ~~~~~~~~~~e~~~~li~aa~~lie~e~P~y~~VaARlL~~~l~~~i~~~~-------~~~~i~~~~-~~~~~~~~~G~~  208 (842)
T PRK12364        137 SFCKENMSERESLALLIKAAVELTAQEAPDWEFIAARLLNLQLSLKLKKQL-------EKAGIHSFY-EKIRYLEEEGLY  208 (842)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH-------HHCCHHHHH-HHHHHHHHCCHH
T ss_conf             740357735678999999789870324862899999998889999998775-------430188889-999888860304


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC-CCCEEECHHHHHHHHHHHHHCCC-CCCHHHHHHHH
Q ss_conf             77877775177399999764121011289899999999762114-89275388999999996541645-45368999999
Q gi|254780502|r  266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAFFMRVAMGLALKE-TEKEKRAVEFY  343 (954)
Q Consensus       266 ~~~i~~~l~~~dl~~L~~~Id~~RD~~F~Y~Gl~tL~~rYllk~-~~~~~E~pQ~~~mrVA~~la~~e-~~~~~~~~~~Y  343 (954)
T Consensus       209 ~~~l~~~~~~~~~~~l~~~i~~~rd~~f~y~g~~~l~~ryl~~~~~~~~~e~pq~~~m~vam~l~~~e~~~~~~~~~~fY  288 (842)
T PRK12364        209 GSYIRAAYSRQEIEEAAGFICPERDKLFTYSGLDLLLKRYLIRTRSHEPLESPQEMFLGIALHLAMPEKQDRMQWVKKFY  288 (842)
T ss_pred             HHHHHHHCCHHHHHHHHHHHCHHHCCCCCHHHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             65552322899999999754832222566278999999998741578578632789999999875256410799999999


Q ss_pred             HHHHHCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99974330358611222100222232110254766413589999899999851054441012443111200012787642
Q gi|254780502|r  344 NLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQG  423 (954)
Q Consensus       344 ~~ls~~~~~~atPtl~Nagt~~~qlsSCfl~~v~Dsl~~I~~~~~~~a~isk~ggGiG~~~s~iR~~Gs~I~g~~G~ssG  423 (954)
T Consensus       289 ~~ms~~~f~~~TPtl~Nagt~~~QlSSCFl~~v~Dsl~~I~~~~~~~A~isK~gGGiG~~~s~lR~~Gs~I~gt~G~ssG  368 (842)
T PRK12364        289 DVLSKLEVTMATPTLSNARKPYHQLSSCFIDTVPDSLEGIYRSIDNFAQVSKFGGGMGLYFGKVRAVGGPIRGFQGVAGG  368 (842)
T ss_pred             HHHHHCCCCCCCCEECCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             99871662679885226898677765158278777689999999999999732674675135568899803788983687


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHCCCCCCHHHHHHCCCHHHCCCHHHHHHHHC--CCCEEE
Q ss_conf             889999998999997404666772478983567889999730257873023320232020348799998521--287478
Q gi|254780502|r  424 VIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ--NAGWTL  501 (954)
Q Consensus       424 ~v~flk~~n~~~~~v~QgG~RrGA~~~~l~~wH~Di~eFl~~k~n~G~~~~r~~~~~~av~i~D~Fm~~v~~--~~~w~L  501 (954)
T Consensus       369 ~vpfmkv~n~~~~~v~QgG~RrGA~~~yL~~wHpDI~eFl~lK~n~Gd~~~r~~~l~~~v~i~D~Fm~~v~~d~~~~w~L  448 (842)
T PRK12364        369 VIRWIKLANDTAVAVDQLGVRQGSVAVYLDVWHKDIPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWKMVRDDLNQSWYL  448 (842)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHCCCCEEECHHHHHHHHHCCCCCEEE
T ss_conf             10299999999999970897745527887788858999996433066077776522320000289999997415783697


Q ss_pred             EECCCCC-----CCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHHHHCCCEEEEECHHHCCCCCCCC
Q ss_conf             7101144-----41001344378998778752104886057786688999999999988288127833112022212466
Q gi|254780502|r  502 FSPDEVS-----DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHV  576 (954)
Q Consensus       502 f~P~~~~-----~L~d~~g~~fe~~Y~~~e~~~~~~~~~~~k~i~A~~l~~~i~~~~~etG~P~i~f~D~~N~~~p~~~~  576 (954)
T Consensus       449 f~P~ev~~~~g~~l~d~~g~ef~~~y~~~~~~~~~~----kr~i~A~~L~~~i~~~~~etG~P~i~f~D~~N~~np~~~~  524 (842)
T PRK12364        449 FCPHEILTVKGYALEDYYGEEWEKRYWDCVNDSRIS----KRSIPIKDLVRLVLKSAVETGTPFTFNRDTVNRANPNAHR  524 (842)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC----CEEEEHHHHHHHHHHHHHHHCCCEEEECCHHHCCCCCCCC
T ss_conf             278644323465367654179999999988546543----4055299999999999998689259961043205887777


Q ss_pred             CEEEECCCCCCCCCCCCC-----------------------CCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             703404675200136654-----------------------433211125540686254344798885589999999976
Q gi|254780502|r  577 GVVHSSNLCTEITLNSSS-----------------------EETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLD  633 (954)
Q Consensus       577 g~I~~sNlC~Ei~l~~~~-----------------------~e~~vCnL~SiNL~~~v~~~~~D~~~l~~~v~~avr~LD  633 (954)
T Consensus       525 G~I~~SNlC~EI~~~~~~~~~~~~~~~~~~g~~~v~~~~~pge~~vCNL~SinL~~~~~~---d~~~l~~~v~~avR~LD  601 (842)
T PRK12364        525 GIIYCSNLCTEIAQNMSAIETVSTEITTEDGDTVVVKTTRPGDFVVCNLASLVLGNIDLE---DEEELKEVVSTAVRALD  601 (842)
T ss_pred             CEEEECCCCHHHCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEEECHHHHHCCCCCC---CHHHHHHHHHHHHHHHH
T ss_conf             837843685121257875344443234455642000146889768987156331136656---68999999999999999


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             53112100018888864433100021111889999729632337889999999999857799978987531177887667
Q gi|254780502|r  634 NVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKG  713 (954)
Q Consensus       634 nVId~n~yp~~~~~~~~~~~R~iGlGv~Glad~L~~~gi~Y~S~ea~~~~~~i~e~i~~~a~~aS~~LAkErG~~~~f~g  713 (954)
T Consensus       602 nVID~n~yP~~~~~~~n~~~R~IGLGvmGlad~L~~~gi~Y~S~ea~~~~~~i~e~I~~~A~~aS~eLAkErG~fp~f~g  681 (842)
T PRK12364        602 NVIDLNFYPLPYAQITNARYRSIGLGVSGYHHALAKRGIRWESEEHLAFADRVFERINYAAIEASSTIAKEKGAYEYFEG  681 (842)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             98873137579999999973321743007999999849972888999999999999999999999999998499867687


Q ss_pred             CHHHCCCCCHHHHHCCHHHCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCHHEEEEE
Q ss_conf             81213876244663005522533454021027289999999841204430110774368778388988475601203453
Q gi|254780502|r  714 SLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS  793 (954)
Q Consensus       714 S~~~~G~~~~d~~~~~~~~~~~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~aiAPT~t~S~i~g~s~gIEP~~a~~y~r~  793 (954)
T Consensus       682 S~~~~G~~~~--------------~~~~~~~dW~~L~~~i~~~G~RNs~l~AIAPTgSiS~I~g~s~gIEPi~~~~~~~~  747 (842)
T PRK12364        682 SDWQTGAYFK--------------KRGYVSEEWNRLAREVATNGMRNAYLLAVAPTSSTSIIAGTTAGVDPVMKRYFLEE  747 (842)
T ss_pred             CHHHCCCHHH--------------CCCCCCHHHHHHHHHHHHCCCCHHCCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             8454175021--------------16876232999999997508511035211781899998295877283737999998


Q ss_pred             CCCCCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHHHHHHHCCHHCCCEEE
Q ss_conf             26761366465899989985898689999998519962776448867886505222068899999998520630052320
Q gi|254780502|r  794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSL  873 (954)
Q Consensus       794 ~~~G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~~~a~~Q~~IDqsiS~  873 (954)
T Consensus       748 ~~~~~~~~v~-------------------------------p~l~~~~~~~y~tA~eI~~~~~I~~aA~rQk~IDqs~S~  796 (842)
T PRK12364        748 KKGALMPRVA-------------------------------PSLSDKTFWLYKSAHALDQRWSIRAAGLRQRHIDQAQSV  796 (842)
T ss_pred             HHCCCCCCCC-------------------------------CCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHCC
T ss_conf             7067401037-------------------------------767865654641471399599999999875635187508


Q ss_pred             EEECC-CCCHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             47548-999899999999999729867979658841
Q gi|254780502|r  874 NLYLD-EPSGKKLDFIYRQAWLMGLKTTYYLRSRSA  908 (954)
Q Consensus       874 tl~~~-~~t~~~i~~~y~~Aw~~GlKt~yy~R~~s~  908 (954)
T Consensus       797 nl~~~~~~t~~dv~~~y~~Awk~GlKt~yy~Rs~S~  832 (842)
T PRK12364        797 NLYITNEFTMRQVLDLYVLAWECGVKSVYYVRSKSL  832 (842)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             401699989999999999999839988999708987