HHsearch alignment for GI: 254780502 and conserved domain: TIGR02506

>TIGR02506 NrdE_NrdA ribonucleoside-diphosphate reductase, alpha subunit; InterPro: IPR013346 This entry represents the alpha (large) chain of the class I ribonucleotide reductase (RNR). RNR's are responsible for the conversion of the ribose sugar of RNA into the deoxyribose sugar of DNA. This is the rate-limiting step of DNA biosynthesis. Class I RNR's generate the required radical (on tyrosine) via a "non-heme" iron cofactor which resides in the beta (small) subunit. The alpha subunit contains the catalytic and allosteric regulatory sites. The mechanism of this enzyme requires molecular oxygen . E. coli contains two versions of this enzyme which are regulated independently (NrdAB and NrdEF, where NrdA and NrdE are the large chains , ). Most organisms contain only one, but the application of the gene symbols NrdA and NrdE are somewhat arbitrary. This model identifies RNR's in diverse clades of bacteria, eukaryotes as well as numerous DNA viruses and phage.; GO: 0005971 ribonucleoside-diphosphate reductase complex.
Probab=100.00  E-value=0  Score=1481.72  Aligned_cols=611  Identities=46%  Similarity=0.770  Sum_probs=582.1

Q ss_pred             HHHHHHHHHHHHHCC--CCCEEECHHHHHHHHHH-HHHCCCCC-CHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             899999999762114--89275388999999996-54164545-368999999999743303586112221002222321
Q gi|254780502|r  295 YLGLQILYDRYFLHI--NGSRIEMPQAFFMRVAM-GLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS  370 (954)
Q Consensus       295 Y~Gl~tL~~rYllk~--~~~~~E~pQ~~~mrVA~-~la~~e~~-~~~~~~~~Y~~ls~~~~~~atPtl~Nagt~~~qlsS  370 (954)
T Consensus         1 ~~G~~~l~~~Y~~~~~~~~~~~e~~q~~~~~~a~~~~~~~~~~~~~~~~~~~Y~~~s~~~~~~aTP~l~n~g~~~~~l~S   80 (685)
T TIGR02506         1 YMGLKELYNRYLLRKAATGAIYESPQEAYMRVAMLGLASLEPDTRLADAIRFYDLLSRLKISPATPTLFNAGTKKGQLSS   80 (685)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             91036633356432110464121077899999999973278505799999999997568523576223678656886214


Q ss_pred             CCCCCC-CCC-HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCE
Q ss_conf             102547-664-135899998999998510544410124431112000127876428899999989999974046667724
Q gi|254780502|r  371 CFLTTV-PDD-LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV  448 (954)
Q Consensus       371 Cfl~~v-~Ds-l~~I~~~~~~~a~isk~ggGiG~~~s~iR~~Gs~I~g~~G~ssG~v~flk~~n~~~~~v~QgG~RrGA~  448 (954)
T Consensus        81 CfL~~~r~~~~l~~I~~~~~~~~~l~~~~GGiG~~~~~~R~~G~~I~g~~~~s~G~~p~~K~~~~~~~a~nQgg~R~Ga~  160 (685)
T TIGR02506        81 CFLLDVRMDDELESIYKAIDDVAQLSKHGGGIGLNLSKLRAIGSPIRGTNNKSSGIIPFLKLLDSSVEAVNQGGKRPGAV  160 (685)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             78842668887778999999999998617976864234013586415777767760125889989999972068755406


Q ss_pred             EEEEECCCCCHHHHHHHCCCCC--CHHHHHHCCCHHHCCCHHHHHHHHC----CCCEEEEECCCCCCCCCCCC-----CC
Q ss_conf             7898356788999973025787--3023320232020348799998521----28747871011444100134-----43
Q gi|254780502|r  449 CAYLETWHIDVEEFLDLRKNTG--DDRRRTHDMNTANWIPDLFMKRVTQ----NAGWTLFSPDEVSDLHDLYG-----KE  517 (954)
Q Consensus       449 ~~~l~~wH~Di~eFl~~k~n~G--~~~~r~~~~~~av~i~D~Fm~~v~~----~~~w~Lf~P~~~~~L~d~~g-----~~  517 (954)
T Consensus       161 avYLe~wH~di~~FL~~k~~~g~~~~~~R~~~~~~g~~~pDlFmkr~~~~~ngd~~W~LFsP~dv~~l~~~~g~d~~~~~  240 (685)
T TIGR02506       161 AVYLEVWHPDIEEFLELKKNNGGADERRRADNLFYGLWIPDLFMKRVEEDANGDKDWTLFSPYDVPGLYELYGADLYEEE  240 (685)
T ss_pred             EEECCCHHHHHHHHHHCCCCCCCCCHHHHHCCCCCEEECCHHHHHHHHHCCCCCCEEEEECHHHHHHHCCCCCCCCHHHH
T ss_conf             88658420238999962778889871010033762012142899999942578941786474765335022248703467


Q ss_pred             HHHHHHHHHHHHCCCCCEEEE-EEEHHHHHHHHHHHHHHHCCCEEEEECHHH-CCCCCC-CCCEEEECCCCCCCCCCCCC
Q ss_conf             789987787521048860577-866889999999999882881278331120-222124-66703404675200136654
Q gi|254780502|r  518 FEIAYENYERQADRGEIKVFR-KISAVALWRKMLTMLFETGHPWITFKDPCN-IRSPQQ-HVGVVHSSNLCTEITLNSSS  594 (954)
Q Consensus       518 fe~~Y~~~e~~~~~~~~~~~k-~i~A~~l~~~i~~~~~etG~P~i~f~D~~N-~~~p~~-~~g~I~~sNlC~Ei~l~~~~  594 (954)
T Consensus       241 fe~~Y~~~~~~~~~~~~~~~~~~v~ar~l~~~~~~~~~~TG~PYi~fkD~~N~~~~~~~~~~~~i~~SNLC~EI~~~~~~  320 (685)
T TIGR02506       241 FEEEYERLEKEVEARKKLKKKKKVSARDLFKKILRTRVETGRPYILFKDAVNNKHNPNKTGGGAIKMSNLCTEILQPTDD  320 (685)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHHHHHHCCCCEEEHHHHCCCCCCCCCCCCCEECCCCCEEEEEECCC
T ss_conf             99999999851133454522884009999999999999849950331010145446410267622024350556540567


Q ss_pred             C------------------CCCCCCHHHHHHHHHCCCC------------------CCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             4------------------3321112554068625434------------------479888558999999997653112
Q gi|254780502|r  595 E------------------ETAVCNLGSINLLAHFANN------------------QFDYDKLASTIRTAVRVLDNVIDI  638 (954)
Q Consensus       595 ~------------------e~~vCnL~SiNL~~~v~~~------------------~~D~~~l~~~v~~avr~LDnVId~  638 (954)
T Consensus       321 ~~~~~~l~~~d~~k~~~ige~~vCNL~S~nL~~~~~~~~~~~~l~T~~n~e~~p~~~fD~~~l~~~~~~a~~~ld~~id~  400 (685)
T TIGR02506       321 SEKITDLYRTDAVKEDPIGETAVCNLASVNLANFVLEDEAEGRLETYENAEKDPTGEFDFEKLEEAVRIAVRFLDNVIDL  400 (685)
T ss_pred             CCCCCCCEECCCCCCCCCCCEEEEHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             65444430012001214742265114666667550676656740002666578741257789999999999988876523


Q ss_pred             CCHHHHHHHHH-HHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCCCCCCH
Q ss_conf             10001888886-443310002111188999972963233788999999999985779997898753117--788766781
Q gi|254780502|r  639 NCHTIEKAKKS-NHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERG--AYSSFKGSL  715 (954)
Q Consensus       639 n~yp~~~~~~~-~~~~R~iGlGv~Glad~L~~~gi~Y~S~ea~~~~~~i~e~i~~~a~~aS~~LAkErG--~~~~f~gS~  715 (954)
T Consensus       401 ~~yp~~~~~~~~n~~~RsiGiGv~Gl~d~l~~~~~~Y~S~ea~~~~~~ife~~~Y~a~~~S~~LAKE~G~~~~~~F~~S~  480 (685)
T TIGR02506       401 QNYPTAPAAKSANQRRRSIGIGVMGLHDVLAKLGLPYDSEEARALNDRIFEAIYYYAIKASAELAKEKGKRPYPGFEGSK  480 (685)
T ss_pred             CCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             78983689998876116734133017999996588988988999999999999999999999999867888888789874


Q ss_pred             HHCCCCCHHHHHCCHHHCCC--CCCCCHHH----CCHHHHHHHHHHHH-HHHHHHCCCCCCHHHHHHHCCCCCCCCCCHH
Q ss_conf             21387624466300552253--34540210----27289999999841-2044301107743687783889884756012
Q gi|254780502|r  716 WDQGVFPIDSIGLLAEVRDE--LAMNRTSR----LPWDELKKRVKTIG-MRNSNCMAIAPTATIANICGVSQSIDPSYQN  788 (954)
Q Consensus       716 ~~~G~~~~d~~~~~~~~~~~--~~~~~~~~----~dW~~Lr~~i~~~G-~RNs~l~aiAPT~t~S~i~g~s~gIEP~~a~  788 (954)
T Consensus       481 ~~~G~l~~d~~~~~~~~~~~~~~~v~~~~~~~~~~~W~~L~~~ik~~G~~rNs~l~A~aPTaS~S~~~g~t~si~P~~~~  560 (685)
T TIGR02506       481 YAKGLLHYDTWEKTIDPLTEKVKLVDRTSKVPTEEDWEALRERIKEYGMLRNSQLTALAPTASSSQITGVTESIEPVFSN  560 (685)
T ss_pred             CCCCEEECCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCEEEHHHHCCCCCHHHHHHHCCCCCCCCCCCE
T ss_conf             55200002330025321367403530443446722379999999972660005441017631312542455554664130


Q ss_pred             EEEEECCCCCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHHHHHHHCCHHC
Q ss_conf             03453267613664658999899858986899999985199627764488678865052220688999999985206300
Q gi|254780502|r  789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID  868 (954)
Q Consensus       789 ~y~r~~~~G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~~~a~~Q~~ID  868 (954)
T Consensus       561 ~f~k~~~~gef~~~N~~L~~~L~~~~~w~~~~~-~~~~~~~~~~~~~~~~~~~~~~yktA~~~d~~~~i~~~A~rq~fvD  639 (685)
T TIGR02506       561 IFTKKTLSGEFLIPNKYLVKELEELGLWDAERR-DILENVGSIQPILAIPETLKYKYKTAYELDQKALIDMAAARQKFVD  639 (685)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHCCCCHHHHH-HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHCCHHC
T ss_conf             356753466621420899999974588818999-9997067762021662778874104441686899999997604002


Q ss_pred             CCEEEEEECCC-------CCHHHHHHHHHHHHHCCCCE-EEEECCC
Q ss_conf             52320475489-------99899999999999729867-9796588
Q gi|254780502|r  869 QAQSLNLYLDE-------PSGKKLDFIYRQAWLMGLKT-TYYLRSR  906 (954)
Q Consensus       869 qsiS~tl~~~~-------~t~~~i~~~y~~Aw~~GlKt-~yy~R~~  906 (954)
T Consensus       640 QsiS~nLfl~~~~~~~~~~~~~~l~~~~~~Awk~GlKTg~YY~r~~  685 (685)
T TIGR02506       640 QSISLNLFLTENKDEDEKVTAKDLLKLLLLAWKKGLKTGMYYCRSR  685 (685)
T ss_pred             CHHHHHHCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             1021300310004654466888999999988873014422100469