HHsearch alignment for GI: 254780502 and conserved domain: cd00576

>cd00576 RNR_PFL Ribonucleotide reductase and Pyruvate formate lyase. Ribonucleotide reductase (RNR) and pyruvate formate lyase (PFL) are believed to have diverged from a common ancestor. They have a structurally similar ten-stranded alpha-beta barrel domain that hosts the active site, and are radical enzymes. RNRs are found in all organisms and provide the only mechanism by which nucleotides are converted to deoxynucleotides. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs use a diiron-tyrosyl radical while Class II RNRs use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. PFL, an essential enzyme in anaerobic bacteria, catalyzes the conversion of pyruvate and CoA to acteylCoA and formate in a mechanism that uses a glycyl radical.
Probab=100.00  E-value=0  Score=454.79  Aligned_cols=365  Identities=21%  Similarity=0.231  Sum_probs=312.9

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCHH---------------HHHHHHHHHHHHHHH--CCCCCC
Q ss_conf             999999974330358611222100222232110254766413---------------589999899999851--054441
Q gi|254780502|r  340 VEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY---------------GIFGALQENAMLAKY--SGGLGN  402 (954)
Q Consensus       340 ~~~Y~~ls~~~~~~atPtl~Nagt~~~qlsSCfl~~v~Dsl~---------------~I~~~~~~~a~isk~--ggGiG~  402 (954)
T Consensus         2 ~~~~~~~~~~~~~~~~p~--------~p~~nC~li~~~dmL~~G~~~~~e~p~s~~~A~~~~~qiia~vas~q~ggG~s~   73 (401)
T cd00576           2 ERIYEAVKSGVITVGRPD--------LPFTGCVLVDYGDSLDPGIKGVNETAKSINEAIQKTYQIIALAASNQNGGGVSF   73 (401)
T ss_pred             CHHHHHHHHCCCCCCCCC--------CCCCEEEEEECHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             168899874541378888--------770205899864434346414677872199999999999999996466666612


Q ss_pred             CC--CCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCC-----CCHHHHHHHCCCCCCHHH
Q ss_conf             01--24431112000-12787642889999998999997404666772478983567-----889999730257873023
Q gi|254780502|r  403 DW--TPVRGLGAHIH-GTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWH-----IDVEEFLDLRKNTGDDRR  474 (954)
Q Consensus       403 ~~--s~iR~~Gs~I~-g~~G~ssG~v~flk~~n~~~~~v~QgG~RrGA~~~~l~~wH-----~Di~eFl~~k~n~G~~~~  474 (954)
T Consensus        74 ~ri~~~l~p~~~~~~~~~~~t~~g~~~fmq~f~~~i~ti~q~ggr~g~~t~~l~~~h~~~~~~i~~~~l~~k~~~g~~~~  153 (401)
T cd00576          74 ARASSILSPYGSRDYAKGSGTETDAVEAADAFNLALKEVGQGNGRTGAATGFIGGVHKGKGDKISQEFLNLALANGGEGI  153 (401)
T ss_pred             CHHHCCCCCCEEEECCCCCEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             51321256400221257855661616699999999999773699775589998489763203679999999985799777


Q ss_pred             HHHCCCHHHCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHH
Q ss_conf             32023202034879999852128747871011444100134437899877875210488605778668899999999998
Q gi|254780502|r  475 RTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF  554 (954)
Q Consensus       475 r~~~~~~av~i~D~Fm~~v~~~~~w~Lf~P~~~~~L~d~~g~~fe~~Y~~~e~~~~~~~~~~~k~i~A~~l~~~i~~~~~  554 (954)
T Consensus       154 ~~~fp~l~v~i~~~~~~----------------------------------------------~~~~a~~l~~l~~~~a~  187 (401)
T cd00576         154 PLNFPNLSVRVSSDKPG----------------------------------------------ILVKAVELKQLIAEEAR  187 (401)
T ss_pred             CCCCCCEEEEECCCCCC----------------------------------------------CCCCHHHHHHHHHHHHH
T ss_conf             67777269995788755----------------------------------------------67778999999999999


Q ss_pred             HHCCCEEEEECHHHCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCC-----CCCHHHHHHHHHHHH
Q ss_conf             828812783311202221246670340467520013665443321112554068625434-----479888558999999
Q gi|254780502|r  555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLASTIRTAV  629 (954)
Q Consensus       555 etG~P~i~f~D~~N~~~p~~~~g~I~~sNlC~Ei~l~~~~~e~~vCnL~SiNL~~~v~~~-----~~D~~~l~~~v~~av  629 (954)
T Consensus       188 k~g~P~ii~~~---------------------------------~cn~~siNL~ri~l~a~~g~~~~~~~~Lee~~~lav  234 (401)
T cd00576         188 KTGSPGIFNDE---------------------------------LCNLVSLNLARIMEKAINGSMDVVLEELEELAFLAV  234 (401)
T ss_pred             HHCCCCEEECC---------------------------------CCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             87899889734---------------------------------457886618999875247878879999999999999


Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9976531121000188888644331000211118899997296323-378899999999998577999789875311778
Q gi|254780502|r  630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA-SPEAVEIADESMEFISFHAISASVELAQERGAY  708 (954)
Q Consensus       630 r~LDnVId~n~yp~~~~~~~~~~~R~iGlGv~Glad~L~~~gi~Y~-S~ea~~~~~~i~e~i~~~a~~aS~~LAkErG~~  708 (954)
T Consensus       235 raLd~~id~~~~p~~~~~~~~~~~rtIgLG~iGlae~l~~lg~~~~~~~ea~~~a~~i~~~l~~~~~k~s~e--------  306 (401)
T cd00576         235 RALDCVIDSHDERIPTIELGGDERRTVGLGIAGVADLLIKLGLEKVGDPEADDLAAELVDQLKKHLVKATNE--------  306 (401)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCEEEEECHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH--------
T ss_conf             999999997256378999860598068454989999999939987898789999999999999999997674--------


Q ss_pred             CCCCCCHHHCCCCCHHHHHCCHHHCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCHH
Q ss_conf             87667812138762446630055225334540210272899999998412044301107743687783889884756012
Q gi|254780502|r  709 SSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN  788 (954)
Q Consensus       709 ~~f~gS~~~~G~~~~d~~~~~~~~~~~~~~~~~~~~dW~~Lr~~i~~~G~RNs~l~aiAPT~t~S~i~g~s~gIEP~~a~  788 (954)
T Consensus       307 -------------------------------------------------~~~~~s~~~tPseS~t~~~~~tng~~P~~~~  337 (401)
T cd00576         307 -------------------------------------------------RGFNFLLGLSPSESNSSGAPATNGVSPSRGX  337 (401)
T ss_pred             -------------------------------------------------HCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             -------------------------------------------------4974001347466000665767871777687


Q ss_pred             EEEEECCCCCEEEECHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHCCCHHHHHHHHHHHCCHHC
Q ss_conf             03453267613664658999899858986899999985199627764488678865052220688999999985206300
Q gi|254780502|r  789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID  868 (954)
Q Consensus       789 ~y~r~~~~G~~~~vn~~l~~~l~~~g~~~~~~~~~i~~~~Gsv~~i~~ip~~~k~~f~ta~ei~~~~~i~~~a~~Q~~ID  868 (954)
T Consensus       338 ~~------------------------------------------------------~~v~~~i~p~~kl~~ea~fq~~s~  363 (401)
T cd00576         338 IA------------------------------------------------------IVLNGDIGPEESLASVAILQFYAD  363 (401)
T ss_pred             CE------------------------------------------------------EEECCCCCHHHHHHHHHHCHHHCC
T ss_conf             13------------------------------------------------------651468988998766540332458


Q ss_pred             CCEEEEEECCC-C-CHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             52320475489-9-9899999999999729867979
Q gi|254780502|r  869 QAQSLNLYLDE-P-SGKKLDFIYRQAWLMGLKTTYY  902 (954)
Q Consensus       869 qsiS~tl~~~~-~-t~~~i~~~y~~Aw~~GlKt~yy  902 (954)
T Consensus       364 gg~i~yve~Pn~~~n~~aL~~v~d~a~~~~~~~~~v  399 (401)
T cd00576         364 NGISDTITIPDSATNLDQLLAVIDGAAAIKTTHVRV  399 (401)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEECC
T ss_conf             976985768985529899999999998638713047