BLAST/PSIBLAST alignment of GI: 254780502 and GI: 300022336 at iteration 1
>gi|300022336|ref|YP_003754947.1| ribonucleoside-diphosphate reductase, subunit alpha [Hyphomicrobium denitrificans ATCC 51888] Length = 956
>gi|299524157|gb|ADJ22626.1| ribonucleoside-diphosphate reductase, alpha subunit [Hyphomicrobium denitrificans ATCC 51888] Length = 956
 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/929 (63%), Positives = 720/929 (77%), Gaps = 6/929 (0%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RNG VT FD SKIS A+ KAF+AVEG  A+ S RV + +  LT Q V  L +    
Sbjct: 30  QVIRRNGSVTPFDASKISVALTKAFLAVEGGRAAASRRVHETVDGLTSQIVVALTRRGVQ 89

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIE+IQDQVE +LM+  HHK+ R YVLYREER   RAA++ +    P  P + +  
Sbjct: 90  ERTFHIEEIQDQVELALMRGEHHKVARAYVLYREERKRERAAETAAP--IPTMPSISVKS 147

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG+L   ++ RL  ++EE+C+GL DVS++ +LSET +N+YDG++  +L  A + ++RTL
Sbjct: 148 KDGSLAPLDAARLRKLIEESCAGLADVSAEAILSETQRNLYDGITRDELADAPVLAARTL 207

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE EPNY  VTAR L++KLRRE L+ V  +  +A   EM   YPEYF  +I +G+ A LL
Sbjct: 208 IETEPNYTFVTARLLMDKLRREALSFVAGRTDEARQSEMGERYPEYFRAFIAKGIVADLL 267

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              +  FDL  L   LK ERD  F+YLGLQ LYDRYFL  +G R E+PQAFFMRVAMGLA
Sbjct: 268 DPELARFDLDRLGGALKPERDGIFQYLGLQTLYDRYFLQTHGIRFELPQAFFMRVAMGLA 327

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E ++E +A+EFY+L+S+F FMCSTPTLFN+GT  PQLSSCFLTTVPDDL GIF ++++
Sbjct: 328 LREIDREAKAIEFYDLISTFDFMCSTPTLFNAGTPRPQLSSCFLTTVPDDLDGIFKSIKD 387

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+LAKYSGGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVANDTA+AVNQGGKRKGAVC
Sbjct: 388 NALLAKYSGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVANDTAIAVNQGGKRKGAVC 447

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWHID+EEFLDLRKN GDDRRRTHDMNTA+WIPDLFM+RV ++  WTLFSPDE  D
Sbjct: 448 AYLETWHIDIEEFLDLRKNAGDDRRRTHDMNTAHWIPDLFMQRVAEDGQWTLFSPDETPD 507

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDLYG  F   YE YE +A+R E+KV R++ AV LWR+MLTMLFETGHPWITFKDPCN+
Sbjct: 508 LHDLYGTAFAERYEAYEEKAERMEMKVARRVRAVDLWRRMLTMLFETGHPWITFKDPCNL 567

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQH G+VHSSNLC EITLN+S++E AVCNLGSINL+AH  N+  D+DKL  T++TA+
Sbjct: 568 RSPQQHCGIVHSSNLCAEITLNTSNDEVAVCNLGSINLVAHVTNDGVDFDKLERTVKTAM 627

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +TI +A++SN  HR +G+GLMGFQ AL  L I Y S EAV  AD SME 
Sbjct: 628 RMLDNVIDINFYTIPEARRSNLRHRPVGMGLMGFQDALQALRINYGSEEAVAFADTSMEA 687

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDE 748
           ISFHAISASV+LA ERG Y SF GSLW QG+ PIDSI LL   R  +L ++ +S L WD 
Sbjct: 688 ISFHAISASVDLAAERGRYPSFDGSLWSQGILPIDSIELLKSARGTDLRLDTSSTLDWDG 747

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L+ RV+T GMRNSN MAIAPTATI+NICGV+QSI+P+++NLYVKSNMSGDFTVVN FLV 
Sbjct: 748 LRDRVRTTGMRNSNTMAIAPTATISNICGVAQSIEPAFRNLYVKSNMSGDFTVVNPFLVR 807

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
           +LK R LWDE MISDLKY DGS+G I+RIP+DLK ++ATAFEID  WL+++A+RRQKWID
Sbjct: 808 DLKARGLWDEVMISDLKYFDGSLGAIDRIPEDLKALYATAFEIDAHWLVDAAARRQKWID 867

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           Q QSLNLY+  P+G+KLD +YR AW  GLKTTYYLRS+SAT VEKSTLKG DGKLNAV  
Sbjct: 868 QGQSLNLYIAAPNGRKLDALYRLAWERGLKTTYYLRSQSATHVEKSTLKGTDGKLNAVSS 927

Query: 929 TDPNSS---THSLGIPSSCTSDTECEVCQ 954
           +  +S+     ++   +    D  CE CQ
Sbjct: 928 SVHHSAPENIEAMAGKACLIDDPTCEACQ 956