BLAST/PSIBLAST alignment of GI: 254780502 and GI: 90425008 at iteration 1
>gi|90425008|ref|YP_533378.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodopseudomonas palustris BisB18] Length = 960
>gi|90107022|gb|ABD89059.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris BisB18] Length = 960
 Score = 1260 bits (3260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/956 (62%), Positives = 736/956 (76%), Gaps = 21/956 (2%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D  PS+         G ++I+RNG VT FDP+KI+ A+ KAF+AVEG  A+ S R+ D++
Sbjct: 12  DRPPSVVEHVTAANPGYRLIRRNGTVTRFDPTKITLALTKAFLAVEGSSAASSRRIHDVV 71

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LT+Q V+ L +         IED+QDQVE +LM+  +HK+ R YVLYRE+R+  R   
Sbjct: 72  GGLTQQIVSSLTRRADLGHTFLIEDVQDQVELALMRGEYHKVARAYVLYREDRAKQRIES 131

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           + +    P +P L++   DG ++  ++ RL  +VEEAC+GL DV +  VLSET +N+YDG
Sbjct: 132 AQNAQLEPASP-LRVTATDGIVVPLDAVRLAAVVEEACAGLDDVRASQVLSETRRNLYDG 190

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +S  +L  A I ++RTLIE EPNYAKV+AR LL+KLRRE L+ V  +P++ATH EM   Y
Sbjct: 191 ISLDELALAPILAARTLIETEPNYAKVSARLLLDKLRREALSFVAGRPEQATHAEMAGRY 250

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +YF  YI  G+ + LL   +  FDLV L+  LK ERD  F+YLGLQ LYDRYFLH++G+
Sbjct: 251 GDYFKAYIATGIASELLDRELGRFDLVRLSAALKPERDLQFDYLGLQTLYDRYFLHVDGT 310

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQAFFMRVA GLAL+E ++E +A+EFY LLSSF FM STPTLFN+GT  PQLSSCF
Sbjct: 311 RFELPQAFFMRVACGLALREIDREDKAIEFYELLSSFDFMASTPTLFNAGTLRPQLSSCF 370

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GIF ++++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVAN
Sbjct: 371 LTTVPDDLDGIFKSIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVAN 430

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTA+AVNQGGKRKGAVCAYLETWHID+E+FLDLRKNTGDDRRRTHDMNTANW+PDLFM R
Sbjct: 431 DTAIAVNQGGKRKGAVCAYLETWHIDIEQFLDLRKNTGDDRRRTHDMNTANWVPDLFMTR 490

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V Q+ GWTLFSPDE  DLHDL G+ F   YE YE +A+RGE++VF+++ A  LWRKMLTM
Sbjct: 491 VEQDGGWTLFSPDETPDLHDLTGQAFVERYEQYEAKAERGEMRVFKRLRAADLWRKMLTM 550

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S+ E AVCNLGSINL+ H  
Sbjct: 551 LFETGHPWITFKDPCNLRSPQSHAGVVHSSNLCTEITLNTSTTEVAVCNLGSINLVNHLV 610

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           N   D+ +LA ++ T +R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++L +
Sbjct: 611 NGAIDHARLARSVGTGMRMLDNVLDVNFYTIPEARSSNLKHRPVGLGIMGFQDALNILRL 670

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS +AV  ADESME +S+ AISASV+LA ERG Y SF+GSLW +GV P+DSI  +   
Sbjct: 671 PYASEQAVAFADESMESVSYWAISASVDLAAERGRYPSFEGSLWSKGVLPLDSIARVDAA 730

Query: 733 RD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++R+ RL WD L+ RVK +GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYV
Sbjct: 731 RALPVEVDRSFRLDWDGLRARVKAVGMRNSNTMAIAPTATISNICGVSQSIEPAYQNLYV 790

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSNMSGDFTVVN++LVN+LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEI
Sbjct: 791 KSNMSGDFTVVNTYLVNDLKARGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATAFEI 850

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           D  WLIE+A+RRQKWIDQ+QSLNLYL  P+GKKLD +YR AW  GLKTTYYLRSRSAT V
Sbjct: 851 DSAWLIEAAARRQKWIDQSQSLNLYLANPNGKKLDALYRLAWRRGLKTTYYLRSRSATHV 910

Query: 912 EKSTLKGVDGKLNAVPVTDPNSSTHSLGIP------------SSCT-SDTECEVCQ 954
           EKSTLKG DGKLNAV      S+  ++  P             +C   D  CEVCQ
Sbjct: 911 EKSTLKGTDGKLNAV------SAGLAMDTPRAVAVACGAVAGQACAIDDPTCEVCQ 960