BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate
reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62]
         (954 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040179|gb|ACT56975.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 954

 Score = 2001 bits (5185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/954 (100%), Positives = 954/954 (100%)

Query: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60
           MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK
Sbjct: 1   MHPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGK 60

Query: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120
           GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL
Sbjct: 61  GASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVL 120

Query: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180
           YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI
Sbjct: 121 YREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKI 180

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP
Sbjct: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI
Sbjct: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN
Sbjct: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK
Sbjct: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN
Sbjct: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI
Sbjct: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
           SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC
Sbjct: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600

Query: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL
Sbjct: 601 NLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV
Sbjct: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720

Query: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780
           FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ
Sbjct: 721 FPIDSIGLLAEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQ 780

Query: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840
           SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD
Sbjct: 781 SIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDD 840

Query: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900
           LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT
Sbjct: 841 LKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTT 900

Query: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ
Sbjct: 901 YYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954


>gi|315122311|ref|YP_004062800.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495713|gb|ADR52312.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 934

 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/937 (75%), Positives = 812/937 (86%), Gaps = 3/937 (0%)

Query: 18  LAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTE 77
           + YPFPEK+KG++VI+RNG  T FDPSKIS AIMKAF+AVEGK AS S RV++I+  LTE
Sbjct: 1   MTYPFPEKVKGIKVIRRNGKTTPFDPSKISWAIMKAFIAVEGKSASSSSRVRNIVNVLTE 60

Query: 78  QTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS 137
           +TV +LL    S LI+HIE IQDQVE SLM++ HHK+ REYVLYREERS +R A++HSKS
Sbjct: 61  ETVLKLLHEYSSNLIIHIEAIQDQVEASLMRNDHHKVAREYVLYREERSGIRTAKAHSKS 120

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESD 197
           D P    LKI MDD T +  +SKRL+MI+EE+C+GLQDVS +++LSET KNMYDG+SE +
Sbjct: 121 DTP---HLKIRMDDDTFVPLDSKRLKMIIEESCAGLQDVSLELILSETIKNMYDGMSEVE 177

Query: 198 LETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFC 257
           LE AL+F+SR LIE+EPNYAKVT R LL+KLRREVLT +YK P+KATH EM  LY  YF 
Sbjct: 178 LELALVFASRALIEREPNYAKVTTRLLLDKLRREVLTAIYKTPKKATHQEMSNLYKNYFL 237

Query: 258 RYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMP 317
           +YIEEG+KA LL ESM +FDL YLAN LK +RD  FEYLGLQ LYDRYFLH++GSR EMP
Sbjct: 238 QYIEEGIKAHLLAESMKEFDLSYLANALKPDRDLMFEYLGLQTLYDRYFLHVDGSRFEMP 297

Query: 318 QAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
           QAFFMRVAMG+ALKE EKEKRAVEFYNL+SSFHFMCSTPTLFN+GTRHPQLSSCFLTTVP
Sbjct: 298 QAFFMRVAMGIALKEPEKEKRAVEFYNLISSFHFMCSTPTLFNAGTRHPQLSSCFLTTVP 357

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           DDL  IF A+++NA+LAKYSGGLGNDWT VRGLG+HI GTNGKSQGVIPFLKVANDTAVA
Sbjct: 358 DDLGDIFEAIKDNALLAKYSGGLGNDWTSVRGLGSHIQGTNGKSQGVIPFLKVANDTAVA 417

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
           VNQGGKRKGAVCAYLETWHID+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +N 
Sbjct: 418 VNQGGKRKGAVCAYLETWHIDIEEFLNLRKNTGDDRRRTHDMNTANWVPDLFMKRVEKNE 477

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            WTLFSPDEV DLH LYG +FE AY NYE++A+RGEIK+FRKI+AV+LWRKMLTM+FETG
Sbjct: 478 QWTLFSPDEVGDLHHLYGHDFEKAYSNYEKKAERGEIKLFRKIAAVSLWRKMLTMVFETG 537

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFD 617
           HPWITFKDPCNIRSPQQHVG V  SNLCTEITLN S +E AVCNLGSINL AH   N  D
Sbjct: 538 HPWITFKDPCNIRSPQQHVGNVLCSNLCTEITLNISKDEVAVCNLGSINLAAHLTENGLD 597

Query: 618 YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
           YDKLA+TI TAVR+LDNVID+N + I+KA+ SN  HR IGLGLMGFQSALH L IPY S 
Sbjct: 598 YDKLANTIHTAVRMLDNVIDVNRYAIKKAENSNRKHRPIGLGLMGFQSALHALRIPYESV 657

Query: 678 EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELA 737
           EAV+ AD+SMEFISFHAISAS  LA+ERG YS+FKGSLW +G+ PIDS+ LL EVRD+  
Sbjct: 658 EAVDFADQSMEFISFHAISASTNLAEERGPYSTFKGSLWSKGILPIDSLQLLEEVRDKCE 717

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++++SRL WD L++RVK++GMRNSNCMAIAPTATI+NICGVSQSI+PSYQNL+VKSNMSG
Sbjct: 718 IDKSSRLGWDVLRERVKSVGMRNSNCMAIAPTATISNICGVSQSIEPSYQNLFVKSNMSG 777

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           DFT+VNS LVN+LK R LWDE MISDLK++DGSIGNIERIP+DLKK+HATAFEIDP+WLI
Sbjct: 778 DFTIVNSCLVNDLKARGLWDEVMISDLKHYDGSIGNIERIPEDLKKLHATAFEIDPIWLI 837

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           ++ASRRQKWIDQAQSLNLYL +PSGKKLDFIYRQ+WLMGLKTTYYLRSRSAT VEKSTLK
Sbjct: 838 KAASRRQKWIDQAQSLNLYLSDPSGKKLDFIYRQSWLMGLKTTYYLRSRSATHVEKSTLK 897

Query: 918 GVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            VDGKLN+VP+ D NSS       SSC S  ECEVCQ
Sbjct: 898 EVDGKLNSVPIMDHNSSELLSTPQSSCDSGVECEVCQ 934


>gi|110635037|ref|YP_675245.1| ribonucleotide-diphosphate reductase subunit alpha [Mesorhizobium
           sp. BNC1]
 gi|110286021|gb|ABG64080.1| ribonucleoside-diphosphate reductase, alpha subunit [Chelativorans
           sp. BNC1]
          Length = 954

 Score = 1277 bits (3305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/925 (65%), Positives = 737/925 (79%), Gaps = 2/925 (0%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG VT FDPSKI+ A+ KAF+AVEG  A+ S RV +++++LTEQ V  L + N++
Sbjct: 32  RVIRRNGSVTPFDPSKIAIALTKAFLAVEGSVAAGSRRVHEVVEDLTEQVVGALTRRNEA 91

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIE+IQDQVE +LM+ GHHK+ R YVLYREER+  RAA   +++ A   P L++M+
Sbjct: 92  GRTFHIEEIQDQVELALMRDGHHKVARAYVLYREERARERAATKTAENAA--QPILQVML 149

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
           +DG+    +  RL  +VEEAC GL+ VS++ +LSE  +N+YDG++  +L  A I ++RTL
Sbjct: 150 EDGSKTPLDIARLTAVVEEACQGLEAVSAEAILSEAQRNLYDGITLDELSLAPILAARTL 209

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           +E EPNY++V+AR LL+KLRRE LT V  +P +AT  EM   YP YF  +I  G++A ++
Sbjct: 210 VETEPNYSQVSARLLLDKLRREALTFVEGRPTQATQAEMVERYPAYFEGFIAAGIQAEMI 269

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              +  FDL  L   LK ERD  F+YLG Q LYDRYFLH +G R E+PQAFFMRVAMGLA
Sbjct: 270 DPELGRFDLKRLGAALKPERDLRFQYLGFQTLYDRYFLHEDGVRYELPQAFFMRVAMGLA 329

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E ++E RA+EFY+L+S+F FMCSTPTLFN+GT  PQLSSCFLTTV DDL GIF A+++
Sbjct: 330 LREIDREARAIEFYDLISTFDFMCSTPTLFNAGTLRPQLSSCFLTTVSDDLDGIFKAVKD 389

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+LAKYSGGLGNDWTPVRGLGA I GTNGKSQG++PFLKVANDTA+AVNQGGKRKGAVC
Sbjct: 390 NALLAKYSGGLGNDWTPVRGLGARIKGTNGKSQGIVPFLKVANDTAIAVNQGGKRKGAVC 449

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+RV  +  WTLFSPDE  D
Sbjct: 450 AYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMERVEADGEWTLFSPDETPD 509

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDLYG  F+ AYE YE +A RGEI+VFR++ AV LWR+MLTMLFETGHPWITFKDPCN+
Sbjct: 510 LHDLYGPAFKAAYEEYEARAARGEIRVFRQVRAVDLWRRMLTMLFETGHPWITFKDPCNL 569

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQ+H GVVHSSNLCTEITLN+S +E AVCNLGSINL AH +    D +KLA T+ TA+
Sbjct: 570 RSPQRHAGVVHSSNLCTEITLNTSKDEVAVCNLGSINLAAHVSEKGLDMEKLARTVATAM 629

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +TI +A++SN  HR +GLGLMGFQ AL  L +PYAS  AVE AD SME 
Sbjct: 630 RMLDNVIDINFYTIPEARRSNLRHRPVGLGLMGFQDALQTLRLPYASEGAVEFADRSMEA 689

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTSRLPWDEL 749
           I++HAISASVELA+ERGAY+SF+GSLW +GV PIDS+  +AE R    M+R + L W+ L
Sbjct: 690 IAYHAISASVELAKERGAYASFEGSLWSKGVLPIDSLSFVAESRGVDGMDRGTTLDWESL 749

Query: 750 KKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNE 809
           + RV   GMRNSN MAIAPTATI+NICGVSQSI+P+YQNL+VKSNMSGDFTVVN+ LV++
Sbjct: 750 RARVVEHGMRNSNTMAIAPTATISNICGVSQSIEPAYQNLFVKSNMSGDFTVVNAALVHD 809

Query: 810 LKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQ 869
           LK R LWDE M+SDLKY+DG +G I+R+PDDLK ++ATAFEIDP WLIE+ASRRQKWIDQ
Sbjct: 810 LKARGLWDEVMVSDLKYYDGLLGQIDRVPDDLKALYATAFEIDPAWLIEAASRRQKWIDQ 869

Query: 870 AQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           AQSLNLY+  PSGKKLD +YR AW  GLKTTYYLRSRSAT VEKSTLK  DGKLNAV V 
Sbjct: 870 AQSLNLYIANPSGKKLDELYRLAWRKGLKTTYYLRSRSATHVEKSTLKRADGKLNAVAVM 929

Query: 930 DPNSSTHSLGIPSSCTSDTECEVCQ 954
              ++    G+ +    D +CE CQ
Sbjct: 930 PQPAAFELEGVKACAIDDPDCEACQ 954


>gi|209885873|ref|YP_002289729.1| ribonucleoside-diphosphate reductase alpha subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874069|gb|ACI93865.1| ribonucleoside-diphosphate reductase alpha subunit [Oligotropha
           carboxidovorans OM5]
          Length = 969

 Score = 1269 bits (3283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/951 (64%), Positives = 738/951 (77%), Gaps = 13/951 (1%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           P    P P +   +Q+I+RNG V+ FDPSKIS A+ KAF+AVEG  A+ S RV +I++ L
Sbjct: 20  PESLAPSPRE-PAMQIIRRNGTVSRFDPSKISIAMTKAFLAVEGHTAAASRRVHEIVEGL 78

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           T++ VT L +        HIED+QDQVE +LM+S HHK+ R YVLYREER+  RAA   +
Sbjct: 79  TQEVVTNLTRRLGEGRTFHIEDVQDQVELALMRSEHHKVARAYVLYREERARERAAGKSA 138

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
           ++     P L++ + +GT    + KRLE+I+ EA  GL  V    VL+E  +N+YDG+S+
Sbjct: 139 EAAVSNEPALQMTLANGTRAPLDIKRLELIIREAGEGLDGVDPAPVLAEARRNLYDGISQ 198

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            +L  A I ++RTL+E EPNYA V+AR LL+KLR EVLT +YK P  A+  +M   Y EY
Sbjct: 199 DELALAPIMAARTLVEHEPNYAYVSARLLLDKLRSEVLTYLYKTPTSASQADMATRYAEY 258

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  Y++ G++A LL   +  FDL  LA+ LK ERD  F++LGLQ LYDRYFLH+ GSR+E
Sbjct: 259 FPVYVKAGIEAELLDPELGRFDLDRLASALKPERDLQFQFLGLQTLYDRYFLHVGGSRLE 318

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVAMGLA++E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSCFLTT
Sbjct: 319 LPQAFFMRVAMGLAVREIDREARAIEFYNLLSSFDFMASTPTLFNSGTLRPQLSSCFLTT 378

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           V DDL GIF A+++NA+LAKYSGGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVANDTA
Sbjct: 379 VADDLDGIFKAVKDNALLAKYSGGLGNDWTNVRGLGAHIKGTNGESQGVVPFLKVANDTA 438

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           +AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+RV +
Sbjct: 439 IAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQRVEE 498

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSPDE  DLHDLYG  F+ AYE YE +A RGEI VF+++ A  LWR+MLTMLFE
Sbjct: 499 DGTWTLFSPDETPDLHDLYGPAFKAAYEGYEAKAARGEIHVFKEMRATDLWRRMLTMLFE 558

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINLL H     
Sbjct: 559 TGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTSADEVAVCNLGSINLLNHTTREG 618

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            ++DKL  TI TAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGFQ ALH+  IP  
Sbjct: 619 LNHDKLKRTIATAVRMLDNVIDINFYTIPEARRSNLKHRPVGLGLMGFQDALHIQRIPIT 678

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S  AV  ADESME IS+HAISASV+LA ERG Y SF+GSLW QG+ PIDS+ +LA+ R+ 
Sbjct: 679 SDAAVAFADESMEIISYHAISASVDLAGERGRYPSFEGSLWSQGMLPIDSVSILAKARNG 738

Query: 736 LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNM 795
             ++ ++ L W  L++RVKT GMRNSN MAIAPTATI+NICGV+QSI+P+YQNLYVKSNM
Sbjct: 739 APLDTSATLDWSGLRERVKTDGMRNSNVMAIAPTATISNICGVTQSIEPAYQNLYVKSNM 798

Query: 796 SGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMW 855
           SGDFTVVN FLV +LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++AT FEID  W
Sbjct: 799 SGDFTVVNEFLVRDLKSRGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATVFEIDTSW 858

Query: 856 LIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
           LI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW +GLKTTYYLRSRSAT VEKST
Sbjct: 859 LIQAAARRQKWIDQAQSLNLYIANPSGKKLDQLYRLAWQLGLKTTYYLRSRSATHVEKST 918

Query: 916 LKGVDGKLNAV-----------PVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           LKG DGKLNAV           P+  PN +   L    +C+ D  +CE CQ
Sbjct: 919 LKGTDGKLNAVSASIPSAQQHAPIVVPNDTAPDLTGVKACSIDNPDCEACQ 969


>gi|90425008|ref|YP_533378.1| ribonucleotide-diphosphate reductase subunit alpha
           [Rhodopseudomonas palustris BisB18]
 gi|90107022|gb|ABD89059.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 960

 Score = 1260 bits (3260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/956 (62%), Positives = 736/956 (76%), Gaps = 21/956 (2%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D  PS+         G ++I+RNG VT FDP+KI+ A+ KAF+AVEG  A+ S R+ D++
Sbjct: 12  DRPPSVVEHVTAANPGYRLIRRNGTVTRFDPTKITLALTKAFLAVEGSSAASSRRIHDVV 71

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LT+Q V+ L +         IED+QDQVE +LM+  +HK+ R YVLYRE+R+  R   
Sbjct: 72  GGLTQQIVSSLTRRADLGHTFLIEDVQDQVELALMRGEYHKVARAYVLYREDRAKQRIES 131

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           + +    P +P L++   DG ++  ++ RL  +VEEAC+GL DV +  VLSET +N+YDG
Sbjct: 132 AQNAQLEPASP-LRVTATDGIVVPLDAVRLAAVVEEACAGLDDVRASQVLSETRRNLYDG 190

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +S  +L  A I ++RTLIE EPNYAKV+AR LL+KLRRE L+ V  +P++ATH EM   Y
Sbjct: 191 ISLDELALAPILAARTLIETEPNYAKVSARLLLDKLRREALSFVAGRPEQATHAEMAGRY 250

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +YF  YI  G+ + LL   +  FDLV L+  LK ERD  F+YLGLQ LYDRYFLH++G+
Sbjct: 251 GDYFKAYIATGIASELLDRELGRFDLVRLSAALKPERDLQFDYLGLQTLYDRYFLHVDGT 310

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQAFFMRVA GLAL+E ++E +A+EFY LLSSF FM STPTLFN+GT  PQLSSCF
Sbjct: 311 RFELPQAFFMRVACGLALREIDREDKAIEFYELLSSFDFMASTPTLFNAGTLRPQLSSCF 370

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GIF ++++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVAN
Sbjct: 371 LTTVPDDLDGIFKSIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVAN 430

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTA+AVNQGGKRKGAVCAYLETWHID+E+FLDLRKNTGDDRRRTHDMNTANW+PDLFM R
Sbjct: 431 DTAIAVNQGGKRKGAVCAYLETWHIDIEQFLDLRKNTGDDRRRTHDMNTANWVPDLFMTR 490

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V Q+ GWTLFSPDE  DLHDL G+ F   YE YE +A+RGE++VF+++ A  LWRKMLTM
Sbjct: 491 VEQDGGWTLFSPDETPDLHDLTGQAFVERYEQYEAKAERGEMRVFKRLRAADLWRKMLTM 550

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S+ E AVCNLGSINL+ H  
Sbjct: 551 LFETGHPWITFKDPCNLRSPQSHAGVVHSSNLCTEITLNTSTTEVAVCNLGSINLVNHLV 610

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           N   D+ +LA ++ T +R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++L +
Sbjct: 611 NGAIDHARLARSVGTGMRMLDNVLDVNFYTIPEARSSNLKHRPVGLGIMGFQDALNILRL 670

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS +AV  ADESME +S+ AISASV+LA ERG Y SF+GSLW +GV P+DSI  +   
Sbjct: 671 PYASEQAVAFADESMESVSYWAISASVDLAAERGRYPSFEGSLWSKGVLPLDSIARVDAA 730

Query: 733 RD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++R+ RL WD L+ RVK +GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYV
Sbjct: 731 RALPVEVDRSFRLDWDGLRARVKAVGMRNSNTMAIAPTATISNICGVSQSIEPAYQNLYV 790

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSNMSGDFTVVN++LVN+LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEI
Sbjct: 791 KSNMSGDFTVVNTYLVNDLKARGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATAFEI 850

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           D  WLIE+A+RRQKWIDQ+QSLNLYL  P+GKKLD +YR AW  GLKTTYYLRSRSAT V
Sbjct: 851 DSAWLIEAAARRQKWIDQSQSLNLYLANPNGKKLDALYRLAWRRGLKTTYYLRSRSATHV 910

Query: 912 EKSTLKGVDGKLNAVPVTDPNSSTHSLGIP------------SSCT-SDTECEVCQ 954
           EKSTLKG DGKLNAV      S+  ++  P             +C   D  CEVCQ
Sbjct: 911 EKSTLKGTDGKLNAV------SAGLAMDTPRAVAVACGAVAGQACAIDDPTCEVCQ 960


>gi|75677069|ref|YP_319490.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter
           winogradskyi Nb-255]
 gi|74421939|gb|ABA06138.1| ribonucleotide reductase large subunit [Nitrobacter winogradskyi
           Nb-255]
          Length = 969

 Score = 1258 bits (3256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/954 (63%), Positives = 738/954 (77%), Gaps = 15/954 (1%)

Query: 16  PSL--AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           PSL  A   P      QVI+RNG V+ FD +KI+ A+ KAF+AVEG  A+ S RV DI+ 
Sbjct: 16  PSLSAAATAPSSEPACQVIRRNGSVSPFDSAKIAVALTKAFLAVEGNSAAASRRVHDIVT 75

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+Q V  L + + +    HIEDIQDQVE +LM+S HHK+ R YVLYREER+  RA   
Sbjct: 76  GLTDQIVASLTRRSDAGRTFHIEDIQDQVELALMRSEHHKVARAYVLYREERARERAKAQ 135

Query: 134 HSKSDAPIAPK----LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNM 189
            SKS    A      L++   DG+LI+ ++ RL  +VEEAC+GL DVS+  +L+ET++N+
Sbjct: 136 ESKSKKGGAAAAKAALRMKSADGSLIALDTPRLTAVVEEACAGLGDVSASAILTETHRNL 195

Query: 190 YDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQ 249
           YDG+S  +L  A I ++RTL+E +P+YAKV+AR LL+K+RRE L+ V  + ++AT  EM 
Sbjct: 196 YDGISVDELAQAPILAARTLVETDPDYAKVSARLLLDKMRREALSFVAGRLEQATQAEMA 255

Query: 250 CLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI 309
             Y +YF  Y+  G+   LL   +  FDL  LA  LK ERD  F+YLGLQ LYDRYFLH+
Sbjct: 256 ERYADYFLSYVRAGIDHELLDPEIGRFDLDRLAAALKPERDLRFDYLGLQTLYDRYFLHV 315

Query: 310 NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLS 369
              R E+PQAFFMRVA GLAL+E ++E++A+ FY+LLSSF FM STPTLFN+GT  PQLS
Sbjct: 316 RSVRFELPQAFFMRVACGLALREIDREEKAIAFYDLLSSFDFMASTPTLFNAGTLRPQLS 375

Query: 370 SCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLK 429
           SCFLTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLK
Sbjct: 376 SCFLTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLK 435

Query: 430 VANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLF 489
           VANDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLF
Sbjct: 436 VANDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLF 495

Query: 490 MKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKM 549
           M+RV ++  WTLFSPDE  DLHDL GK F   Y  YE +A RGE++V +++ AV LWR+M
Sbjct: 496 MQRVEEDGMWTLFSPDETPDLHDLTGKAFAGRYAYYEEKAARGELRVTKQVRAVDLWRRM 555

Query: 550 LTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA 609
           LTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+ E AVCNLGS+NL+ 
Sbjct: 556 LTMLFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSNTEVAVCNLGSVNLVN 615

Query: 610 HFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
           H  + + D++ LA T+R A+R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++
Sbjct: 616 HIKDGKLDHEHLARTVRIAMRMLDNVLDVNFYTIPEARTSNLRHRPVGLGIMGFQDALNI 675

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
           L +PYAS EAV  ADESME I++HAIS SVELA ERG Y S++GSLW +GV P+DS+ L+
Sbjct: 676 LRLPYASDEAVSFADESMEAIAYHAISGSVELAAERGRYPSYQGSLWSKGVLPLDSLELV 735

Query: 730 AEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
            E R  E+ ++R+SRL WD L++RV TIGMRNSNCMAIAPTATI+NICGVSQSI+P+YQN
Sbjct: 736 DEARGAEVDIDRSSRLDWDSLRQRVMTIGMRNSNCMAIAPTATISNICGVSQSIEPAYQN 795

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DGS+G I+R+PDDLK ++ATA
Sbjct: 796 LYVKSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGSVGEIDRVPDDLKALYATA 855

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEID  WLI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW  GLKTTYYLRSRSA
Sbjct: 856 FEIDSAWLIDAAARRQKWIDQAQSLNLYIANPSGKKLDALYRHAWKRGLKTTYYLRSRSA 915

Query: 909 TSVEKSTLKGVDGKLNAVPVT--------DPNSSTHSLGIPSSCTSDTECEVCQ 954
           T VEKSTLKG DGKLNAV  +            ++ S G  S    D  CE CQ
Sbjct: 916 THVEKSTLKGTDGKLNAVAASVSVAPLNGHAAVASASEGWKSCRVDDPTCEACQ 969


>gi|299134881|ref|ZP_07028073.1| ribonucleoside-diphosphate reductase, alpha subunit [Afipia sp.
           1NLS2]
 gi|298590691|gb|EFI50894.1| ribonucleoside-diphosphate reductase, alpha subunit [Afipia sp.
           1NLS2]
          Length = 967

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/948 (64%), Positives = 739/948 (77%), Gaps = 12/948 (1%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           SLA P P +   +Q+I+RNG V+ FDPSKIS A+ KAF+AVEG  A+ S RV + ++ LT
Sbjct: 22  SLA-PSPSE-PAMQIIRRNGTVSRFDPSKISIAMTKAFLAVEGHTAAASRRVHEAVEQLT 79

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           ++ V  L +        HIED+QDQVE +LM+S HHK+ R YVLYREER+  RAA   S 
Sbjct: 80  QEVVGTLTRRLGEGRTFHIEDVQDQVELALMRSEHHKVARAYVLYREERARERAADRAST 139

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
           + +   P L++ + +G  +  + KR E+I+ EAC GL  V    VL+E  +N+YDG+S+ 
Sbjct: 140 TVSSNEPTLQMTLANGARVPLDLKRFELIIREACEGLDAVDPAPVLAEARRNLYDGISQD 199

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           +L  A I ++RTL+E+EPNYA V+AR LL+KLR EVL+ V+  P  A+  +M   Y EYF
Sbjct: 200 ELALASIMAARTLVEQEPNYAYVSARLLLDKLRSEVLSFVHGTPTSASQSDMATRYAEYF 259

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             YI+ G++A LL   +   DL  LA+ LK ERD  F++LGLQ LYDRYFLH++G+RIE+
Sbjct: 260 PAYIKTGIEAELLDPELGRHDLARLASALKPERDMLFQFLGLQTLYDRYFLHVHGARIEL 319

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQAFFMRVAMGLA++E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSCFLTTV
Sbjct: 320 PQAFFMRVAMGLAMREIDREGRAIEFYNLLSSFDFMASTPTLFNSGTLRPQLSSCFLTTV 379

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GIF A+++NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLKVANDTA+
Sbjct: 380 ADDLDGIFKAVKDNALLAKYSGGLGNDWTPVRGLGAHIKGTNGESQGVVPFLKVANDTAI 439

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+RV Q+
Sbjct: 440 AVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQRVEQD 499

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSPDE  +LHDLYG  F+ AYE YE +A RGE++VF+++ A  LWR+MLTMLFET
Sbjct: 500 GEWTLFSPDETPELHDLYGPRFKAAYEAYEAKAARGEMRVFKQVRATDLWRRMLTMLFET 559

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S++E AVCNLGSINLL H      
Sbjct: 560 GHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTSADEVAVCNLGSINLLNHTTREGL 619

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D +KL  TI TAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGFQ ALH+  IP AS
Sbjct: 620 DQNKLKRTITTAVRMLDNVIDINFYTIPEARRSNLKHRPVGLGLMGFQDALHVQRIPIAS 679

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDEL 736
             AV  AD SME IS+HAISAS +LA ERG Y SF GSLW QG+ PIDS+ +L++ RD  
Sbjct: 680 EAAVAFADASMEIISYHAISASADLAVERGRYPSFDGSLWSQGILPIDSVAVLSKSRDGT 739

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
           A+N +  L W  L++RV+  GMRNSN MAIAPTATI+NICGV+QSI+PSYQNL+VKSNMS
Sbjct: 740 ALNASMTLDWTGLRERVRKDGMRNSNVMAIAPTATISNICGVAQSIEPSYQNLFVKSNMS 799

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           GDFTVVN  LV +LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFE+D  WL
Sbjct: 800 GDFTVVNEHLVRDLKSRGLWDEVMVSDLKYFDGSVGQIDRVPDDLKALYATAFEVDTSWL 859

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           IESA+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW +GLKTTYYLRSRSAT VEKSTL
Sbjct: 860 IESAARRQKWIDQAQSLNLYIANPSGKKLDQLYRLAWQLGLKTTYYLRSRSATHVEKSTL 919

Query: 917 KGVDGKLNAV---------PVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           KG DGKLNAV         P+  PN++   L    +C+ D  +CE CQ
Sbjct: 920 KGTDGKLNAVSASGMLAHAPIIVPNATAPDLDGVKACSIDNPDCEACQ 967


>gi|85714831|ref|ZP_01045817.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698317|gb|EAQ36188.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrobacter sp.
           Nb-311A]
          Length = 956

 Score = 1249 bits (3233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/954 (62%), Positives = 738/954 (77%), Gaps = 15/954 (1%)

Query: 16  PSL--AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           PSL  A   P      QVI+RNG V+ FD +KI+ A+ KAF+AVEG  A+ S RV DI+ 
Sbjct: 3   PSLSAAAAMPPSEPAYQVIRRNGSVSPFDSAKIAVALTKAFLAVEGNSAAASRRVHDIVA 62

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA-- 131
            LT Q V  L + + +    HIEDIQDQVE +LM+S HHK+ R YVLYREER+  RA   
Sbjct: 63  ELTGQIVASLTRRSDAGRTFHIEDIQDQVELALMRSEHHKVARAYVLYREERARERAKSQ 122

Query: 132 QSHSKSDAPIAPK--LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNM 189
           +S +K     A K  L++   DG+LI+ ++KRL  +V EAC+GL DVS+  +L+ET++N+
Sbjct: 123 ESKAKKGNTTAAKTVLRMKSADGSLIALDTKRLATVVVEACAGLGDVSASAILAETHRNL 182

Query: 190 YDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQ 249
           YDG+S  +L  A I ++RTL+E +P+YAK +AR LL+KLRRE L+ V  + ++AT  EM 
Sbjct: 183 YDGISVDELALAPILAARTLVETDPDYAKASARLLLDKLRREALSFVSGRSEQATQAEMA 242

Query: 250 CLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI 309
             Y +YF  Y+  G+   LL   +  FDL  LA  LK ERD  F+YLGLQ LYDRYFLH+
Sbjct: 243 ERYADYFRAYVRTGIDNELLDLEIGRFDLDRLAAALKPERDLRFDYLGLQTLYDRYFLHV 302

Query: 310 NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLS 369
            G R E+PQAFFMRVA GLAL+E ++E++A+ FY+LLSSF FM STPTLFN+GT  PQLS
Sbjct: 303 RGVRFELPQAFFMRVACGLALREIDREEKAIAFYDLLSSFDFMASTPTLFNAGTLRPQLS 362

Query: 370 SCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLK 429
           SCFLTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLK
Sbjct: 363 SCFLTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLK 422

Query: 430 VANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLF 489
           VANDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLF
Sbjct: 423 VANDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLF 482

Query: 490 MKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKM 549
           M+RV ++  WTLFSPDE  DLHDL GK F   Y  YE +A RGE++V +++ AV LWR+M
Sbjct: 483 MRRVEEDGMWTLFSPDETPDLHDLTGKAFTERYACYEEKAARGELRVTKQVRAVDLWRRM 542

Query: 550 LTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA 609
           LTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+ E AVCNLGS+NL++
Sbjct: 543 LTMLFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSNTEVAVCNLGSVNLVS 602

Query: 610 HFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
           H  + + D++ LA T+R A+R+LDNV+D+N +TI +A+ SN  HR +GLG+MGFQ AL++
Sbjct: 603 HIKDGKLDHEHLARTVRIAMRMLDNVLDVNFYTIPEARTSNLRHRPVGLGVMGFQDALNI 662

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
           L +PYAS  AV  ADESME I+++AIS SVELA ERG Y S++GSLW +G+ P+DS+ L+
Sbjct: 663 LRLPYASNGAVSFADESMEAIAYYAISGSVELAAERGRYPSYQGSLWSKGILPLDSLTLV 722

Query: 730 AEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
            E R   + ++R+SRL WD L++ V TIGMRNSNCMAIAPTATI+NICGVSQSI+P+YQN
Sbjct: 723 DEARGAAVDIDRSSRLDWDSLRESVMTIGMRNSNCMAIAPTATISNICGVSQSIEPAYQN 782

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DGS+G I+R+PDDLK ++ATA
Sbjct: 783 LYVKSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGSVGQIDRVPDDLKALYATA 842

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEID  WLI++A+RRQKWIDQAQSLNLY+  PSGKKLD +YR AW  GLKTTYYLRSRSA
Sbjct: 843 FEIDSSWLIDAAARRQKWIDQAQSLNLYIANPSGKKLDALYRHAWKRGLKTTYYLRSRSA 902

Query: 909 TSVEKSTLKGVDGKLN-------AVPVTD-PNSSTHSLGIPSSCTSDTECEVCQ 954
           T VEKSTLKG DGKLN       A P+     +++ S G  S    D  CE CQ
Sbjct: 903 THVEKSTLKGTDGKLNAVAASVSAAPLNGHATAASASEGWKSCRIEDPTCEACQ 956


>gi|300022336|ref|YP_003754947.1| ribonucleoside-diphosphate reductase, subunit alpha [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524157|gb|ADJ22626.1| ribonucleoside-diphosphate reductase, alpha subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 956

 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/929 (63%), Positives = 720/929 (77%), Gaps = 6/929 (0%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RNG VT FD SKIS A+ KAF+AVEG  A+ S RV + +  LT Q V  L +    
Sbjct: 30  QVIRRNGSVTPFDASKISVALTKAFLAVEGGRAAASRRVHETVDGLTSQIVVALTRRGVQ 89

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIE+IQDQVE +LM+  HHK+ R YVLYREER   RAA++ +    P  P + +  
Sbjct: 90  ERTFHIEEIQDQVELALMRGEHHKVARAYVLYREERKRERAAETAAP--IPTMPSISVKS 147

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG+L   ++ RL  ++EE+C+GL DVS++ +LSET +N+YDG++  +L  A + ++RTL
Sbjct: 148 KDGSLAPLDAARLRKLIEESCAGLADVSAEAILSETQRNLYDGITRDELADAPVLAARTL 207

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE EPNY  VTAR L++KLRRE L+ V  +  +A   EM   YPEYF  +I +G+ A LL
Sbjct: 208 IETEPNYTFVTARLLMDKLRREALSFVAGRTDEARQSEMGERYPEYFRAFIAKGIVADLL 267

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              +  FDL  L   LK ERD  F+YLGLQ LYDRYFL  +G R E+PQAFFMRVAMGLA
Sbjct: 268 DPELARFDLDRLGGALKPERDGIFQYLGLQTLYDRYFLQTHGIRFELPQAFFMRVAMGLA 327

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E ++E +A+EFY+L+S+F FMCSTPTLFN+GT  PQLSSCFLTTVPDDL GIF ++++
Sbjct: 328 LREIDREAKAIEFYDLISTFDFMCSTPTLFNAGTPRPQLSSCFLTTVPDDLDGIFKSIKD 387

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+LAKYSGGLGNDWT VRGLGAHI GTNG+SQGV+PFLKVANDTA+AVNQGGKRKGAVC
Sbjct: 388 NALLAKYSGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLKVANDTAIAVNQGGKRKGAVC 447

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWHID+EEFLDLRKN GDDRRRTHDMNTA+WIPDLFM+RV ++  WTLFSPDE  D
Sbjct: 448 AYLETWHIDIEEFLDLRKNAGDDRRRTHDMNTAHWIPDLFMQRVAEDGQWTLFSPDETPD 507

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDLYG  F   YE YE +A+R E+KV R++ AV LWR+MLTMLFETGHPWITFKDPCN+
Sbjct: 508 LHDLYGTAFAERYEAYEEKAERMEMKVARRVRAVDLWRRMLTMLFETGHPWITFKDPCNL 567

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQH G+VHSSNLC EITLN+S++E AVCNLGSINL+AH  N+  D+DKL  T++TA+
Sbjct: 568 RSPQQHCGIVHSSNLCAEITLNTSNDEVAVCNLGSINLVAHVTNDGVDFDKLERTVKTAM 627

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +TI +A++SN  HR +G+GLMGFQ AL  L I Y S EAV  AD SME 
Sbjct: 628 RMLDNVIDINFYTIPEARRSNLRHRPVGMGLMGFQDALQALRINYGSEEAVAFADTSMEA 687

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDE 748
           ISFHAISASV+LA ERG Y SF GSLW QG+ PIDSI LL   R  +L ++ +S L WD 
Sbjct: 688 ISFHAISASVDLAAERGRYPSFDGSLWSQGILPIDSIELLKSARGTDLRLDTSSTLDWDG 747

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L+ RV+T GMRNSN MAIAPTATI+NICGV+QSI+P+++NLYVKSNMSGDFTVVN FLV 
Sbjct: 748 LRDRVRTTGMRNSNTMAIAPTATISNICGVAQSIEPAFRNLYVKSNMSGDFTVVNPFLVR 807

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
           +LK R LWDE MISDLKY DGS+G I+RIP+DLK ++ATAFEID  WL+++A+RRQKWID
Sbjct: 808 DLKARGLWDEVMISDLKYFDGSLGAIDRIPEDLKALYATAFEIDAHWLVDAAARRQKWID 867

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           Q QSLNLY+  P+G+KLD +YR AW  GLKTTYYLRS+SAT VEKSTLKG DGKLNAV  
Sbjct: 868 QGQSLNLYIAAPNGRKLDALYRLAWERGLKTTYYLRSQSATHVEKSTLKGTDGKLNAVSS 927

Query: 929 TDPNSS---THSLGIPSSCTSDTECEVCQ 954
           +  +S+     ++   +    D  CE CQ
Sbjct: 928 SVHHSAPENIEAMAGKACLIDDPTCEACQ 956


>gi|92119122|ref|YP_578851.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrobacter
           hamburgensis X14]
 gi|91802016|gb|ABE64391.1| Ribonucleoside-diphosphate reductase [Nitrobacter hamburgensis X14]
          Length = 966

 Score = 1244 bits (3220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/954 (62%), Positives = 734/954 (76%), Gaps = 15/954 (1%)

Query: 16  PSL--AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           PSL  A   P      QVI+RNG V+ FD SKI+ A+ KAF+AVEG  A+ S RV DI+ 
Sbjct: 13  PSLPAAAAMPSSEPAYQVIRRNGSVSPFDSSKIAVALTKAFLAVEGNSAAASRRVHDIVT 72

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+Q V  L + + +    HIEDIQDQ E +LM+S HHK+ R YVLYREER+  RA   
Sbjct: 73  ELTDQIVASLTRRSDAGRTFHIEDIQDQAELALMRSAHHKVARAYVLYREERARERAKAQ 132

Query: 134 HSKSDAPI----APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNM 189
            S +         P L++   DG++   +++RL  +VEEAC+GL+ VS++ +L+ET++N+
Sbjct: 133 ESNAKKSNAAAATPALRMKSVDGSMAPLDTRRLAAVVEEACAGLEGVSAEAILTETHRNL 192

Query: 190 YDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQ 249
           YDG+S  +L  A I ++RTL+E +P+YAK +AR LL+KLRRE L+ +  +P++AT  EM 
Sbjct: 193 YDGISADELALAPILAARTLVETDPDYAKASARLLLDKLRREALSLIAGRPEQATQAEMT 252

Query: 250 CLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI 309
             Y EYF  Y++ G++  LL   +  FDL  LA  LK ERD  F+YLG Q LYDRYFLH+
Sbjct: 253 GRYAEYFLGYVQTGIENELLDPEIGRFDLDRLAAALKPERDLQFDYLGFQTLYDRYFLHV 312

Query: 310 NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLS 369
            G+R E+PQAFFMRVA GLAL+E ++E +A+ FYNLLSSF FM STPTLFN+GT+  QLS
Sbjct: 313 RGTRFELPQAFFMRVACGLALREIDREDKAIAFYNLLSSFDFMASTPTLFNAGTQRAQLS 372

Query: 370 SCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLK 429
           SCFLTTV DDL GIF A+++NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQGV+PFLK
Sbjct: 373 SCFLTTVADDLDGIFKAIKDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGESQGVVPFLK 432

Query: 430 VANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLF 489
           VANDTA+AVNQGGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLF
Sbjct: 433 VANDTAIAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLF 492

Query: 490 MKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKM 549
           M+RV ++  WTLFSP+E  DLHDL GK F   Y +YE +A RGE++V +++ AV LWR+M
Sbjct: 493 MQRVEEDGVWTLFSPNETPDLHDLTGKAFAERYAHYEGKAARGEMRVTKQVRAVDLWRRM 552

Query: 550 LTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA 609
           LTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S+ E AVCNLGS+NL+ 
Sbjct: 553 LTMLFETGHPWITFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSNTEVAVCNLGSVNLVN 612

Query: 610 HFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHL 669
           H  + + D+  LA T++TA+R+LDNV+++N +TI +A+ SN  HR +GLGLMGFQ AL++
Sbjct: 613 HLHDGKLDHAHLARTVKTAMRMLDNVLNVNFYTIPEARTSNLRHRPVGLGLMGFQDALNI 672

Query: 670 LHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL 729
           L +PYA  EAV  ADESME IS+ AIS SV+LA ERG Y S++GSLW +G+ P+DS+ L+
Sbjct: 673 LRLPYACDEAVSFADESMEAISYWAISGSVDLAAERGRYPSYQGSLWSKGILPLDSLALV 732

Query: 730 AEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
            E R   + ++R+SRL W+ L++RV T+GMRNSNCMAIAPTATI+NICGVSQSI+P+YQN
Sbjct: 733 DEARGAPIDLDRSSRLDWEALRQRVMTVGMRNSNCMAIAPTATISNICGVSQSIEPAYQN 792

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSNMSGDFTVVN+ LV +LK R LWDE MISDLKY DG +  I+R+PDDLK ++ATA
Sbjct: 793 LYVKSNMSGDFTVVNAHLVRDLKARGLWDEVMISDLKYFDGGLSRIDRVPDDLKALYATA 852

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEID  WLI++A+RRQKWIDQAQSLNLY+ +PSGKKLD +YR AW  GLKTTYYLRSRSA
Sbjct: 853 FEIDSAWLIDAAARRQKWIDQAQSLNLYIADPSGKKLDALYRHAWKRGLKTTYYLRSRSA 912

Query: 909 TSVEKSTLKGVDGKLNAVPV---TDP-----NSSTHSLGIPSSCTSDTECEVCQ 954
           T VEKSTLK  DGKLNAV     T P      S   S G  +    D  CE CQ
Sbjct: 913 THVEKSTLKVTDGKLNAVSASVSTAPLNGHAASVAESDGWKACRIDDPTCEACQ 966


>gi|192291020|ref|YP_001991625.1| ribonucleotide-diphosphate reductase subunit alpha
           [Rhodopseudomonas palustris TIE-1]
 gi|192284769|gb|ACF01150.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 974

 Score = 1240 bits (3208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/941 (62%), Positives = 721/941 (76%), Gaps = 17/941 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+R+G V+ FD SKI+ A+ KAF+AVEG  A+ S RV D +  LT+Q V  L +    
Sbjct: 35  QVIRRSGEVSPFDASKIAVALTKAFLAVEGSNAAASRRVHDTVAELTDQIVANLTRRVGP 94

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQ E +LM+S HHK+ R YV+YREER+  RA  + ++   P+AP L+   
Sbjct: 95  GRTFHIEDIQDQAELALMRSEHHKVARAYVIYREERTRERAKAAAAQVK-PVAPALRTKS 153

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DGTL   + +RL  I+ EAC+GL  VS   VL+ET +N+YDG+S+ +L  A I ++R  
Sbjct: 154 ADGTLHLIDMQRLAAIIAEACAGLDGVSVDAVLAETQRNLYDGISDDELALAPILAARIF 213

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           +E EP+YAKV+AR LL+KLRRE L+ V  +P +AT  +M   Y +YF  Y++ G+   L+
Sbjct: 214 VETEPDYAKVSARLLLDKLRREALSFVEGRPHQATQAQMAERYADYFSAYVKAGIAHELI 273

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              +  FD+  LA  +K ERD  F+YLGLQ LYDRYFLH++G+R E+PQAFFMRVA G+A
Sbjct: 274 DPEIGRFDVSKLAAAIKPERDLQFDYLGLQTLYDRYFLHVHGTRFELPQAFFMRVACGIA 333

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E ++E +A+EFY+LLSSF FM STPTLFN+GT  PQLSSCFLTTVPDDL GIF ++++
Sbjct: 334 LREVDREAKAIEFYDLLSSFDFMASTPTLFNAGTLRPQLSSCFLTTVPDDLDGIFKSIKD 393

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+KY+GGLGNDWT VRGLGAHI GTNG+SQG++PFLKVANDTA+AVNQGGKRKGAVC
Sbjct: 394 NALLSKYAGGLGNDWTHVRGLGAHIKGTNGESQGIVPFLKVANDTAIAVNQGGKRKGAVC 453

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFM+RV QN  WTLFSPDE  D
Sbjct: 454 AYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMQRVEQNGPWTLFSPDETPD 513

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDL G+ F   Y  YE +A RGE++V ++I AV LWR+MLTMLFETGHPWITFKDPCN+
Sbjct: 514 LHDLTGRAFAERYAFYEARAARGELRVTKQIRAVDLWRRMLTMLFETGHPWITFKDPCNL 573

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQH GVVHSSNLCTEITLN+S  E AVCNLGS+NL+ H  + + D  +L  T+ TA+
Sbjct: 574 RSPQQHCGVVHSSNLCTEITLNTSEREVAVCNLGSVNLVNHVVDGRLDCARLERTVTTAM 633

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVID+N +TI +A+ SN  HR +GLGLMGFQ AL++L +PYAS EAV  ADESME 
Sbjct: 634 RMLDNVIDVNFYTIPEARASNLRHRPVGLGLMGFQDALNILRLPYASDEAVAFADESMEA 693

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDE 748
           I++ +ISASV+LA ERG Y+S+ GSLW QG+ P+DSI LL E R   + ++R SRL W+ 
Sbjct: 694 IAYWSISASVDLAAERGRYASYDGSLWSQGILPLDSIDLLDEARGAAIEVDRGSRLDWEA 753

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L+KRV   GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSNMSGDFTVVN+ LV 
Sbjct: 754 LRKRVTATGMRNSNVMAIAPTATISNICGVSQSIEPAYQNLYVKSNMSGDFTVVNTHLVR 813

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
           +LK R LWDE MISDLKY DGS+G I+R+PDDLK ++ATAFEID  WLIE+A+RRQKWID
Sbjct: 814 DLKGRGLWDEVMISDLKYFDGSLGQIDRVPDDLKALYATAFEIDATWLIEAAARRQKWID 873

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPV 928
           QAQSLNLYL  PSGK LD +YR AW  GLKTTYYLRSRSAT VEKSTL+G DGKLNAV  
Sbjct: 874 QAQSLNLYLANPSGKTLDALYRLAWRRGLKTTYYLRSRSATHVEKSTLRGTDGKLNAVSA 933

Query: 929 -------TDP-------NSSTHSLGIPSSCT-SDTECEVCQ 954
                   +P       N    + G   +C   D  CE CQ
Sbjct: 934 IILPTASAEPSRSNGAGNGHAATEGWGKACAIDDPGCEACQ 974


>gi|220935778|ref|YP_002514677.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997088|gb|ACL73690.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 971

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/931 (62%), Positives = 719/931 (77%), Gaps = 9/931 (0%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH-NKS 89
           VI+RNG VT+FD SKI  AI KAF+AVEG  A+ S R+ DI+  L EQ    L +    S
Sbjct: 43  VIRRNGKVTAFDASKIKVAITKAFLAVEGGNAAASRRIHDIVAELAEQVCENLFRRAGGS 102

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK--LKI 147
           A+ VHIEDIQDQVE +LM+ GHHKI R YVLYRE+++  RAA++ ++  A  A    + +
Sbjct: 103 AVTVHIEDIQDQVELALMRGGHHKIARAYVLYREQQAQKRAAEAATRKPARQAEAAVIHV 162

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
              DGT    ++ RL  +VEEAC+GL+ V  +++L+E  +N++DG++E D+ TAL+ S+R
Sbjct: 163 TRPDGTRAPLDTARLVKVVEEACAGLEAVDGQLILNEAQRNLFDGVAEKDVGTALVMSAR 222

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
            LIEKEPNY++VTAR L++ LRRE L+ +   PQ AT  EM   YPEYF  Y++   +  
Sbjct: 223 VLIEKEPNYSQVTARLLMDTLRREALSFIAGLPQAATQAEMTQRYPEYFKAYVKRAAELE 282

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  +DL  L   LK ERD  F YLGLQ LYDRYF+H  G R E+PQAFFMRVAMG
Sbjct: 283 LLDSELTRYDLDRLGAALKPERDLQFTYLGLQTLYDRYFIHSGGVRFELPQAFFMRVAMG 342

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQLSSC+LTTVPDDL GIFGA+
Sbjct: 343 LAIHEIDREGRAIEFYNLLSSFDFMSSTPTLFNSGTLRPQLSSCYLTTVPDDLDGIFGAI 402

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VRG+GAHI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 403 KDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 462

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+DVEEF++LRKNTGDDRRRTHDMN+ANWIPDLFMKRV +   WTLFSP+E 
Sbjct: 463 VCAYLETWHVDVEEFIELRKNTGDDRRRTHDMNSANWIPDLFMKRVAEEGEWTLFSPNET 522

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G+ FE  Y  YE +A RGEIKVF+K+ AV LWRKML MLFETGHPW+TFKDPC
Sbjct: 523 PDLHDLVGEAFEQRYAEYEAKAARGEIKVFKKLKAVDLWRKMLAMLFETGHPWMTFKDPC 582

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL AH   N  + +KL  T+ T
Sbjct: 583 NLRSPQQHVGVVHSSNLCTEITLNTSDDEIAVCNLGSVNLAAHVDENGLNLEKLERTVST 642

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVID N +++ +A++SN  HR +GLG+MGFQ AL+   IPYAS +AVE AD SM
Sbjct: 643 AMRMLDNVIDYNYYSVPQARRSNLRHRPVGLGIMGFQDALYQQRIPYASEDAVEFADRSM 702

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELAMNRTS-RLPW 746
           E +S++AI AS +LA+ERG Y SF GSLW QGV PIDSI LLA+ R +     TS    W
Sbjct: 703 EAVSYYAIKASTDLAEERGRYQSFDGSLWSQGVLPIDSIELLAKSRGQYLQQDTSMTFDW 762

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ RVKT+GMRNSN MAIAPTATI+NICGVSQSI+P+YQNL+VKSN+SG+FTV+N  L
Sbjct: 763 DSLRDRVKTVGMRNSNTMAIAPTATISNICGVSQSIEPTYQNLFVKSNLSGEFTVINPNL 822

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           VN+LK R LWDE M++DLKY+DGS+  I+R+P DLK+++ATAFE+D  WL+E+ASRRQKW
Sbjct: 823 VNDLKARKLWDEVMVNDLKYYDGSVQPIDRVPADLKQLYATAFELDARWLVEAASRRQKW 882

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD--GKLN 924
           +DQAQSLNLY+ EPSGKKLD +Y+ AW+ GLKTTYYLRS  AT VEKST+       KLN
Sbjct: 883 LDQAQSLNLYMAEPSGKKLDNLYKLAWVRGLKTTYYLRSMGATHVEKSTVADASRANKLN 942

Query: 925 AVPVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           A  V   +++  +   P  C+  D ECE CQ
Sbjct: 943 A--VKGADAAAPATEAPKMCSILDPECEACQ 971


>gi|289208616|ref|YP_003460682.1| ribonucleoside-diphosphate reductase, subunit alpha
           [Thioalkalivibrio sp. K90mix]
 gi|288944247|gb|ADC71946.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Thioalkalivibrio sp. K90mix]
          Length = 964

 Score = 1211 bits (3133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/952 (60%), Positives = 722/952 (75%), Gaps = 15/952 (1%)

Query: 15  FPSLAYPFPEKIKGV----QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQD 70
           +P  A P  E +       QVI+RNG VT FD SKI  A+ KAF+AVEG  A+ S R+ +
Sbjct: 16  YPPQAEPSAEVLATSPGQHQVIRRNGKVTGFDASKIEVAVTKAFLAVEGGNAAASRRIHE 75

Query: 71  IIKNLTEQTVTRLLQH-NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVR 129
           + K +  Q V  L +      + VHIEDIQDQVE +LM+ GHHK+ R YV+YRE+++  R
Sbjct: 76  VSKEVAGQVVDSLFRRAGTQGMTVHIEDIQDQVELALMRGGHHKVARAYVIYREQQAQKR 135

Query: 130 AAQSHSKS--DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYK 187
           AA++  +S  +   A  L +   DGT    +  RL+ +V EAC G++ V  + +L+E  +
Sbjct: 136 AAEAAEQSPEEQEAAAALNVTRADGTQAPLDEARLQAVVAEACDGIEHVDGEKILTEARR 195

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N++DG++E D+ TAL+ ++R +IEKEPNY++VTAR L++ LRRE L+ V+ +P++AT  +
Sbjct: 196 NLFDGVAEKDVATALVMAARVMIEKEPNYSEVTARLLMDALRREALSFVHGRPEEATQAQ 255

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           +   Y EYF  YI       L+   +  +DL  L   +K ERD  F YLGLQ LYDRYF+
Sbjct: 256 LAERYAEYFGAYIRRAADLELVDSELTRYDLDKLGAAIKPERDLQFTYLGLQTLYDRYFI 315

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H +G+R E+PQAFFMRVAMGLA+ E ++E RA+EFYNLLSSF FM STPTLFNSGT  PQ
Sbjct: 316 HSDGTRFELPQAFFMRVAMGLAINEIDREARAIEFYNLLSSFDFMSSTPTLFNSGTLRPQ 375

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LT+VPDDL GI+ A+++NA+L+K++GGLGNDWT VRG+GAHI GTNGKSQGV+PF
Sbjct: 376 LSSCYLTSVPDDLDGIYSAIRDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGKSQGVVPF 435

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEF++LRKNTGDDRRRTHDMN+ANWIPD
Sbjct: 436 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFIELRKNTGDDRRRTHDMNSANWIPD 495

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV ++  WTLFSP+E  DLHDL G +FE  Y  YE +A RGE++V + + AV LWR
Sbjct: 496 LFMKRVAEDGDWTLFSPNETPDLHDLVGTDFEKRYCEYEEKAARGELRVHKTMKAVDLWR 555

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML MLFETGHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S +E AVCNLGSINL
Sbjct: 556 KMLGMLFETGHPWMTFKDPCNLRSPQQHTGVVHSSNLCTEITLNTSDDEIAVCNLGSINL 615

Query: 608 LAHFAN-NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSA 666
            AH     + D DKL  T+ TA+R+LDNVID N +++ +A++SN  HR +GLG+MGFQ A
Sbjct: 616 AAHINEAGELDQDKLEQTVNTAMRMLDNVIDYNYYSVPQARRSNLRHRPVGLGIMGFQDA 675

Query: 667 LHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSI 726
           L+ L +PYAS  AVE AD SME +S++AI AS +LA+ERG Y SF GSLW QG+ PIDS+
Sbjct: 676 LYKLRMPYASEAAVEFADTSMEAVSYYAIKASTDLAEERGRYESFPGSLWSQGILPIDSV 735

Query: 727 GLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPS 785
             LAE R D L M+ T RL WD+L+KRVK +GMRNSN MAIAPTATI+NICGVSQSI+P+
Sbjct: 736 EKLAETRGDYLQMDTTQRLEWDKLRKRVKKVGMRNSNTMAIAPTATISNICGVSQSIEPT 795

Query: 786 YQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIH 845
           YQNL+VKSN+SG+FTV+N +LV +LK R+LWDE M++DLKY+DGS+  ++R+PDDLK ++
Sbjct: 796 YQNLFVKSNLSGEFTVINPYLVRDLKDRELWDEVMVNDLKYYDGSVQPLDRVPDDLKALY 855

Query: 846 ATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRS 905
           ATAFE+D  WL+E+ASRRQKWIDQAQSLNLY+ EPSG KLD +Y+ AW+ GLKTTYYLRS
Sbjct: 856 ATAFELDTRWLVEAASRRQKWIDQAQSLNLYMAEPSGPKLDALYKLAWVRGLKTTYYLRS 915

Query: 906 RSATSVEKSTLKGVD--GKLNAVPVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
             AT VEKST+       KLNAV      S   +   P +C+  D +CE CQ
Sbjct: 916 MGATHVEKSTVADSSRANKLNAVSGGQQASEPEA---PKACSILDPDCEACQ 964


>gi|300784784|ref|YP_003765075.1| ribonucleoside-diphosphate reductase alpha chain [Amycolatopsis
           mediterranei U32]
 gi|299794298|gb|ADJ44673.1| ribonucleoside-diphosphate reductase alpha chain [Amycolatopsis
           mediterranei U32]
          Length = 972

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/901 (62%), Positives = 695/901 (77%), Gaps = 6/901 (0%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
            ++VI+R+G V+ FD  KIS A+ KAF+AVEG  A+ S RV  ++  LT+Q  T LL+H 
Sbjct: 17  AIRVIRRDGSVSPFDAGKISVALTKAFLAVEGGDAAASSRVHHVVAELTQQVETTLLRHA 76

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
                +HIE IQD VE +LM+  HHK+ R YVLYR+ER+  R A   + ++A     L +
Sbjct: 77  GPETALHIEQIQDIVELALMRGEHHKVARAYVLYRDERAKAREAVKPATTEA----TLNV 132

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
              DG L   +  R+  +V EA +GL+DV+++ VL+E  +N+YDG+S  +L  A I ++R
Sbjct: 133 KGTDGVLRPLDWARVSHVVGEAVAGLEDVTAEPVLAEAKRNLYDGISADELALAQIMAAR 192

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
            L+E+EPNY+ V+AR LL+KLR E L+ +   P+ A+  EM   YP YF  Y+   ++  
Sbjct: 193 VLVEQEPNYSYVSARLLLDKLRGEALSYLAGTPRLASQDEMAAEYPAYFRAYLRRAIELE 252

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           L+   +  FDL  +   ++ ERD  F +LGLQ LYDRYF H +G+R E+PQAFFMRVAMG
Sbjct: 253 LVDAELQRFDLDKITAAIRPERDLDFGFLGLQTLYDRYFQHHDGTRFELPQAFFMRVAMG 312

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++E ++E RA+EFY LLSSFHFM STPTLFNSGT  PQLSSCFLTTV DDL  IF A 
Sbjct: 313 LAIREGDREARAIEFYELLSSFHFMASTPTLFNSGTTRPQLSSCFLTTVDDDLDSIFQAY 372

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLK+ANDTAVAVNQGGKRKGA
Sbjct: 373 KNNALLAKYSGGLGNDWTPVRGLGAHIKGTNGQSQGVVPFLKIANDTAVAVNQGGKRKGA 432

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
            CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PD F++RV  +A WTLFSP+E 
Sbjct: 433 ACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDEFLRRVEADAQWTLFSPNET 492

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYG EF   Y  YE  ADRGEIKVFR+  AV LWR+MLTMLFETGHPWITFKDPC
Sbjct: 493 PDLHDLYGNEFATRYREYEAAADRGEIKVFRRARAVDLWRRMLTMLFETGHPWITFKDPC 552

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++SEE AVCNLGS+NLL H      D  +L  T+RT
Sbjct: 553 NLRSPQQHVGVVHSSNLCTEITLNTNSEEVAVCNLGSVNLLKHVTPEGLDTKRLEKTVRT 612

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ AL  + +P+AS EAV+ AD SM
Sbjct: 613 AVRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALFEIGVPFASEEAVKFADVSM 672

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLP 745
           E +S++AISAS +LA+ERG Y SF+GSLW +G+ PIDS+ LL + R  D L ++ +S L 
Sbjct: 673 EHLSYYAISASTDLAEERGQYQSFEGSLWSKGILPIDSLQLLIDARQGDGLDVDTSSTLD 732

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  L++RVKT+GMRNSN MAIAPTATI+NI GV QSI+P +QNL+VKSNMSGDFTVVN  
Sbjct: 733 WAPLRERVKTVGMRNSNVMAIAPTATISNISGVGQSIEPLFQNLFVKSNMSGDFTVVNPH 792

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV  LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEI+  W++++ S RQK
Sbjct: 793 LVRSLKARGLWDEVMVSDLKYFDGSLGQIDRVPDDLKALYATAFEIESKWIVDAGSVRQK 852

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+  PSG+KLD +YR AW  GLKTTYYLR++SAT VEKSTL+G DGKLNA
Sbjct: 853 WIDQAQSLNLYIAAPSGRKLDQLYRYAWHKGLKTTYYLRAQSATHVEKSTLRGTDGKLNA 912

Query: 926 V 926
           V
Sbjct: 913 V 913


>gi|88812073|ref|ZP_01127325.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790577|gb|EAR21692.1| ribonucleotide-diphosphate reductase alpha subunit [Nitrococcus
           mobilis Nb-231]
          Length = 955

 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/943 (59%), Positives = 714/943 (75%), Gaps = 14/943 (1%)

Query: 14  AFPSLAYPFPE-KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           + P+ ++  PE + + + VI+R+G V+ FDP KI+ A+ KA++AVEG  AS S R+++ +
Sbjct: 25  SLPAESFEHPESRARDLHVIRRDGQVSGFDPGKITVAMTKAYLAVEGANASGSQRIRETV 84

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + L  Q V  L +   +   VHIEDIQDQVE +LM++G H++ R YVLYREER+  RA Q
Sbjct: 85  ERLVGQVVEALTRRQPAGGRVHIEDIQDQVELALMRAGEHRVARAYVLYREERA--RARQ 142

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
             ++  A  A +L++   DG  +  +  RL  IVEE+C  +  V  + +++ET++N+YDG
Sbjct: 143 DQAEPVAAQAERLRVTRADGGQVPLDEARLRRIVEESCQRIAGVEPEAIVAETHRNLYDG 202

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           + E++L TAL+  +RTLIE+EP Y+ V A  LL+ LRRE L+ +      AT  EM   Y
Sbjct: 203 IPEAELGTALVMCARTLIEREPGYSYVAAGLLLDTLRREALSFLGGVEAGATFEEMAKRY 262

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
           P+YF  Y+  GV+  LL   +++FDL  LA  L+  RD  F YLGLQ LYDRYFLH +G+
Sbjct: 263 PDYFIAYVRRGVELELLDPRLLEFDLERLARVLEPARDRQFGYLGLQTLYDRYFLHYDGT 322

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
             E+PQAFFMRVAMGLAL E ++E+RA EFY LL+SF FM STPTLFN+GTR PQLSSC+
Sbjct: 323 HFELPQAFFMRVAMGLALNEIDREERAAEFYRLLASFDFMSSTPTLFNAGTRRPQLSSCY 382

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           L+T+PDDL GI+ A+++NA+L+K++GGLGNDWTPVR LGAHI GTNG+SQGV+PFLKVAN
Sbjct: 383 LSTIPDDLDGIYSAIRDNALLSKFAGGLGNDWTPVRALGAHIKGTNGRSQGVVPFLKVAN 442

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGG+R+GAVCAYLE WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDLFM+R
Sbjct: 443 DTAVAVNQGGRRRGAVCAYLEIWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLFMRR 502

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V   A WTLFSPDE  DLHDLYG  FE  Y  YE QA+RGE++ ++++SAVALWR+ML+M
Sbjct: 503 VIDEADWTLFSPDETPDLHDLYGAAFEAHYREYEAQAERGELRNYKRVSAVALWRRMLSM 562

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKD CN RSPQQH GVVHSSNLCTEITLN+S +E AVCNLGS+NL AH  
Sbjct: 563 LFETGHPWITFKDACNARSPQQHTGVVHSSNLCTEITLNTSDDEIAVCNLGSVNLAAHVG 622

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
               D  +L  T+RTA+R+LDNVIDIN +++ +A+++N  HR +GLG+MGFQ AL+ L +
Sbjct: 623 AEGIDAARLERTVRTAMRMLDNVIDINWYSVPQARRANMRHRPVGLGVMGFQDALYRLGL 682

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS EAV+ AD SME IS++AI AS ELAQERGAY+SF GSLW +G+ PIDSI LLAE 
Sbjct: 683 PYASREAVDFADRSMETISYYAIQASSELAQERGAYASFAGSLWSRGILPIDSIRLLAEQ 742

Query: 733 RDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R E L M+ ++ L WD L++R++  GMRNSNC+AIAPTATIANI GVS SI+P+Y+NLYV
Sbjct: 743 RGEPLTMDTSTTLDWDALRERIRRTGMRNSNCLAIAPTATIANIVGVSPSIEPTYRNLYV 802

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSN+SG+FTVVN  LV  LK R LWD  +++DLKY DGS+  IER+P+ +K ++ TAFEI
Sbjct: 803 KSNLSGEFTVVNPHLVEALKARGLWDAVLVNDLKYFDGSVQAIERVPEPIKALYTTAFEI 862

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
           DP WL+E+ASRRQKW+DQ+QSLNLY+ E SG KLD +YR AW  GLKTTYYLRS  AT V
Sbjct: 863 DPNWLVEAASRRQKWLDQSQSLNLYMAEASGPKLDALYRNAWRRGLKTTYYLRSLGATHV 922

Query: 912 EKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           EKST+   DG LN V          +   P+    D ECE CQ
Sbjct: 923 EKSTV--ADGALNRV--------AAAPAAPACAVDDPECEACQ 955


>gi|192361574|ref|YP_001982049.1| ribonucleotide-diphosphate reductase subunit alpha [Cellvibrio
           japonicus Ueda107]
 gi|190687739|gb|ACE85417.1| ribonucleoside reductase, large chain [Cellvibrio japonicus
           Ueda107]
          Length = 978

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/951 (59%), Positives = 717/951 (75%), Gaps = 28/951 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  FD SKI+ A+ KAF+AVEG  A+ S RV++ + NLT+Q      +   
Sbjct: 31  LRVIKRNGTVVPFDASKIAIAMTKAFLAVEGGTAAASTRVRETVDNLTKQITATFKRRMP 90

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH-SKSDA-PIAPKLK 146
           S   +HIE+IQDQVE  LM++G  K+ R+YVLYREE + +R AQ   +K++A P  P + 
Sbjct: 91  SGGTIHIEEIQDQVELILMRAGEQKVARDYVLYREEHARLRRAQKEVNKTEADPDYPAMS 150

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           +   DGT    +  R+  IV EAC+GL  V  K +L E  +N+YDG++E D+ T+L+ ++
Sbjct: 151 VTQADGTRAPLDIARMRTIVSEACAGLAGVEEKAILDEAMRNLYDGVAEKDVNTSLVITA 210

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTL+EKEPNY   TAR LL+KLR E L  +   P  AT  +M+  Y      YI++GV+ 
Sbjct: 211 RTLVEKEPNYTYATARLLLDKLRAEALGFLGVAPS-ATQSDMELYYARALPVYIQKGVEL 269

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            L+   +++FDL  L   L  +RD  F YLGLQ LYDRYF+H + +RIE+PQ FFMRVAM
Sbjct: 270 ELISPELLNFDLDKLGKALIADRDLQFTYLGLQTLYDRYFIHSDSTRIELPQIFFMRVAM 329

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL+E ++E+RA+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPDDL+GI+GA
Sbjct: 330 GLALQEDKREERAIEFYRLLSSFDYMSSTPTLFNSGTLRPQLSSCYLTTVPDDLHGIYGA 389

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +Q+NAML+K++GGLGNDWTPVRGLGA+I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKG
Sbjct: 390 IQDNAMLSKFAGGLGNDWTPVRGLGAYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKG 449

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV ++  WTLFSP++
Sbjct: 450 AVCAYLETWHMDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFEDQEWTLFSPND 509

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHDLYGK FE  YE+YE+ A +G++++F+ + A+ LWRKML MLFETGHPWITFKDP
Sbjct: 510 VPDLHDLYGKAFEERYEHYEQLAAQGKVRLFKTVRALDLWRKMLGMLFETGHPWITFKDP 569

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNS-SSEETAVCNLGSINLLAHFANNQFDYDKLASTI 625
           CN+RSPQQH GVVHSSNLCTEITLN+ + +E AVCNLGS+NL  H  N + D  KL  T+
Sbjct: 570 CNLRSPQQHAGVVHSSNLCTEITLNTKAGDEIAVCNLGSVNLAQHIVNGKLDLAKLEKTV 629

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
            TA+R+LDNVIDIN + ++ +K+SN  HR IGLG+MGFQ AL+   I Y+S  AV+ AD 
Sbjct: 630 STAIRMLDNVIDINYYAVDTSKQSNLRHRPIGLGIMGFQDALYEQRIAYSSQAAVDFADT 689

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSR 743
           SME +S++AI AS +LAQERG YS+F+GSLW +GV PIDSI +LA+ R E  + ++R+  
Sbjct: 690 SMEAVSYYAIKASCQLAQERGKYSTFEGSLWSKGVLPIDSIDILAQNRGENYIKVDRSKT 749

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
             WD L+  VKT GMRNSN MAIAPTATI+NI GV+QSI+P+YQNLYVKSN+SG+FTVVN
Sbjct: 750 FDWDSLRTEVKTKGMRNSNVMAIAPTATISNITGVTQSIEPTYQNLYVKSNLSGEFTVVN 809

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV++LK R LWD  M++DLKY++GS+  I+RIP+D+K I+ATAFE++P W++ESASRR
Sbjct: 810 PYLVHDLKDRGLWDSVMVNDLKYYEGSVQKIDRIPEDMKAIYATAFEVEPKWIVESASRR 869

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLNLY+   +GKKLD  YR AW  GLKTTYYLR+ +AT+ EKST+    G L
Sbjct: 870 QKWIDQAQSLNLYIAGANGKKLDITYRMAWYSGLKTTYYLRALAATTTEKSTIN--TGAL 927

Query: 924 NAVPVT-------------------DPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           NAV  T                   +  S   +  +P +C+ D  +CE CQ
Sbjct: 928 NAVSATGNSGLSAAPAAAKPVVADIEEASFAEAAPVPKACSIDNPDCEACQ 978


>gi|226227155|ref|YP_002761261.1| ribonucleoside-diphosphate reductase alpha subunit [Gemmatimonas
           aurantiaca T-27]
 gi|226090346|dbj|BAH38791.1| ribonucleoside-diphosphate reductase alpha subunit [Gemmatimonas
           aurantiaca T-27]
          Length = 957

 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/929 (60%), Positives = 717/929 (77%), Gaps = 4/929 (0%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RN  ++ FDPSKI+ A+ KAF+AVEG  A+ S RV+DI++      V  L +H  +
Sbjct: 29  QVIRRNRTLSPFDPSKIAVAMTKAFVAVEGSSAATSARVRDIVERRCVSVVEALTRHADA 88

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK-LKIM 148
              +HIE+IQDQVE +LM+ GHHK+ R YVLYREER+ +R      ++   +A   ++  
Sbjct: 89  QRALHIEEIQDQVELALMRGGHHKVARAYVLYREERARLRRESGAEETTPGVATSTVRFR 148

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L + +   L +++++AC GL  VS+  VL ET +N+YDG++  +L  A I ++RT
Sbjct: 149 TATGELRTIDQGHLGLVIDDACDGLDGVSAVSVLDETLRNIYDGITADELSLAPILAART 208

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E EPNYA V+AR LLE+LR EVL+ ++ +  +A   +M   Y +YF  ++  G+   L
Sbjct: 209 LVETEPNYAYVSARLLLERLRAEVLSGIHGQEVEARPADMTRHYVDYFPLFVARGIDTGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  LA+ L+ ERD AF YLGLQ LYDRY LH +G R+E+PQ FFMRVAMGL
Sbjct: 269 LDPELARFDLHRLASALRPERDLAFRYLGLQTLYDRYLLHNDGVRLELPQTFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E ++E RA+EFY LLSSF FMCSTPTLFNSGT   QLSSCFLTTVPDDL GIF +++
Sbjct: 329 ALREVDREARAIEFYELLSSFDFMCSTPTLFNSGTPRAQLSSCFLTTVPDDLDGIFKSVK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+LAKYSGGLGNDW+ VRGLG++I GTNG+SQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 389 DNALLAKYSGGLGNDWSRVRGLGSYIRGTNGRSQGVVPFLKVANDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWHID+E+FLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV ++  WTLFSPDEV 
Sbjct: 449 CAYLETWHIDIEDFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVEEDGDWTLFSPDEVP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG+ F   Y  +E +A+RGE+ V +++ AV LWR+MLTMLFETGHPWITFKDPCN
Sbjct: 509 DLHDLYGRAFAERYVQHEIRAERGEVTVHKRVKAVDLWRRMLTMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S  E AVCNLGS+NL  H +    D  +LA+T+RTA
Sbjct: 569 LRSPQQHTGVIHSSNLCTEITLNTSDSEVAVCNLGSVNLANHISGGGIDRARLANTVRTA 628

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ ALH+L +PYAS  A+  ADESME
Sbjct: 629 VRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALHMLRVPYASEAAIRFADESME 688

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWD 747
           F+S+ AI+AS +LA ERG+Y SF GSLW +G+ PIDS+ LL   R+  L  +R+SRL W 
Sbjct: 689 FLSYEAIAASSDLAVERGSYGSFNGSLWQRGILPIDSLALLDASREGRLECDRSSRLDWS 748

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++RV+T G+RNSN +AIAPTATI+NICGVSQSI+PSY+NL+VKSNMSG+FT VN +LV
Sbjct: 749 SLRERVQTQGIRNSNLLAIAPTATISNICGVSQSIEPSYRNLFVKSNMSGEFTEVNEYLV 808

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK R LWDE M+ DLKY DGS+G I+R+P+DLK+++ TAFE+D  WLIE+A+RRQKWI
Sbjct: 809 QDLKSRGLWDEVMVGDLKYFDGSLGPIDRVPEDLKQLYMTAFEVDCAWLIEAAARRQKWI 868

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY+  P+G++LD +YR AW  GLKTTYYLRS++AT VEKSTL   DGKLNAV 
Sbjct: 869 DQAQSLNLYVARPNGRQLDTLYRLAWRRGLKTTYYLRSQAATHVEKSTLTRTDGKLNAVA 928

Query: 928 VTDPN--SSTHSLGIPSSCTSDTECEVCQ 954
           V      S+  ++  P+    + +CE CQ
Sbjct: 929 VAAAQTVSAIEAVTAPACSIDNPDCEACQ 957


>gi|254282207|ref|ZP_04957175.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [gamma proteobacterium NOR51-B]
 gi|219678410|gb|EED34759.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [gamma proteobacterium NOR51-B]
          Length = 961

 Score = 1184 bits (3062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/941 (59%), Positives = 711/941 (75%), Gaps = 10/941 (1%)

Query: 19  AYPFPEKIKG-VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTE 77
           A P      G ++VIKRNG V +F+ SK+S AI KAF+AVEG  A+ S R+ + +  LTE
Sbjct: 26  ASPLAATAPGQLRVIKRNGTVVAFEDSKVSVAITKAFLAVEGGTAAASSRIHETVAKLTE 85

Query: 78  QTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH-SK 136
           Q V    +   S   +HIEDIQDQVE +LM++G HKI R+YV+YRE R+  RAA++  S 
Sbjct: 86  QVVATFKRRMPSGGTIHIEDIQDQVELALMRAGEHKIARDYVIYREARAQERAAKAALSP 145

Query: 137 SDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSES 196
                A ++ ++  DG+    + +R+  IV EAC GL DVS   ++ E  +N+YDG++  
Sbjct: 146 ESQQAAERINVVQADGSRSPLDIERVRTIVAEACEGLADVSEAAIIDEALRNLYDGVAAE 205

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           ++ TAL+ ++RTLIE+EPNY+   AR LL+ LR E L+ +    + AT  +M   YP   
Sbjct: 206 EVSTALVITARTLIEQEPNYSYAAARLLLDNLRAEGLSFM-GVAELATQQDMTIHYPAAL 264

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             +I+ G++  LL   + DFDL  L + L  ERD  F YLGLQ LYDRYF+H + +R E+
Sbjct: 265 KAFIKRGIELELLAPDLQDFDLEELGSALLPERDLQFSYLGLQTLYDRYFIHSDNTRFEL 324

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRVAMGLA +E  K  RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTV
Sbjct: 325 PQIFFMRVAMGLAAREEAKNARAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTV 384

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
           PDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNGKSQG++PFLKV NDTAV
Sbjct: 385 PDDLFGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGKSQGIVPFLKVVNDTAV 444

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +
Sbjct: 445 AVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDD 504

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP++V DLHDLYGK FE  Y+ YE  A  GE+K+ + + A +LWRKML M+FET
Sbjct: 505 GDWTLFSPNDVPDLHDLYGKAFEERYQQYEAMAASGELKLHKTLKAQSLWRKMLGMIFET 564

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQF 616
           GHPW+TFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL  H  N   
Sbjct: 565 GHPWMTFKDPCNLRSPQQHCGVVHSSNLCTEITLNTSADEIAVCNLGSVNLPQHIENGVL 624

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           + DKL STIRTA+R+LDNVIDIN +++ +A++SN  HR IG+G+MGFQ AL+ L + Y S
Sbjct: 625 NLDKLRSTIRTAIRMLDNVIDINYYSVPQAEQSNFRHRPIGMGVMGFQDALYKLDVAYGS 684

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE- 735
            +AV  AD+SME IS++AI AS ELA+ERG+YSS++GSLW QG+FP DS+ LL + R E 
Sbjct: 685 DQAVSFADQSMEAISYYAIEASSELAEERGSYSSYEGSLWSQGIFPHDSLDLLIQHRGED 744

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            + +NR   + W  LK +V   GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN
Sbjct: 745 YIQVNRDQSMDWAPLKAKVAANGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSN 804

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTVVN +LV +LK R LWD+ M++DLKY+DGS+  I+RIPDDLK  +ATAFE++P 
Sbjct: 805 LSGEFTVVNPYLVKDLKARGLWDKVMVNDLKYYDGSVQAIDRIPDDLKAKYATAFEVEPR 864

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           WL++SASRRQKWIDQAQSLNLY++  SGKKLD  YR AW  GLKTTYYLRS +AT  EKS
Sbjct: 865 WLVDSASRRQKWIDQAQSLNLYINNASGKKLDVTYRMAWFNGLKTTYYLRSLAATGTEKS 924

Query: 915 TLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           T++   GKLNA  V+  +++     +P +C+  D +CE CQ
Sbjct: 925 TVES--GKLNA--VSSGSATPQPAPVPQACSLDDPDCEACQ 961


>gi|110833572|ref|YP_692431.1| ribonucleotide-diphosphate reductase subunit alpha [Alcanivorax
           borkumensis SK2]
 gi|110646683|emb|CAL16159.1| ribonucleoside reductase [Alcanivorax borkumensis SK2]
          Length = 962

 Score = 1184 bits (3062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/962 (59%), Positives = 722/962 (75%), Gaps = 24/962 (2%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+ D N  D+    S+A   P +++   VIKRNG V  +D  KI+ AI KAF+AVEG  A
Sbjct: 15  PASDSNDQDQ----SIASTAPGQLR---VIKRNGKVVGYDDDKITVAISKAFLAVEGGTA 67

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YVLYR
Sbjct: 68  AASSRIHETVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRNGEQKVARDYVLYR 127

Query: 123 EERSDVRAAQSHSKSDAPIAPK----LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSS 178
           E+R+  RAA+  S +D P AP     + + M+DG+    +  RLE ++  ACSGL+DV++
Sbjct: 128 EQRASKRAAEQKS-TDLP-APTHQVDMSVTMEDGSKAPLDMARLEHLIRAACSGLEDVNA 185

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
             +++ET KN+YDG+S  D+ T+++ ++RT+IE EPNY++VTAR L++K+R E L  + +
Sbjct: 186 DKIITETVKNLYDGVSIHDVNTSMVITARTMIEVEPNYSQVTARLLMDKIRAEALQFL-R 244

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGL 298
             ++A+H EM  LY +    YI +G++  LL   + ++DL  L   L   RD  F YLGL
Sbjct: 245 VAERASHDEMNALYSDALKAYISKGIELELLSPQLAEYDLDALGAALDGNRDLQFSYLGL 304

Query: 299 QILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTL 358
           Q LYDRYF+H N +RIE+PQ FFMRVAMGLA +E  +E RA+EFYNLLSSF +M STPTL
Sbjct: 305 QTLYDRYFIHHNDTRIELPQCFFMRVAMGLAAEEDNREARAIEFYNLLSSFDYMSSTPTL 364

Query: 359 FNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTN 418
           FN+GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTN
Sbjct: 365 FNAGTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTN 424

Query: 419 GKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHD 478
           G+SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHD
Sbjct: 425 GRSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHD 484

Query: 479 MNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFR 538
           MN+ANWIPDLFMKRV     WTLFSP++  DLHDLYG+ FE AY  YE +   GE+K+F+
Sbjct: 485 MNSANWIPDLFMKRVINEEDWTLFSPNDTPDLHDLYGEAFEKAYTEYEAKTRSGELKLFK 544

Query: 539 KISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETA 598
           ++ A+ LWRKML+MLFETGHPW TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ EE A
Sbjct: 545 RLPAINLWRKMLSMLFETGHPWFTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNQEEIA 604

Query: 599 VCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGL 658
           VCNLGS+NL  H   N  + +KL STI TAVR+LDNVIDIN +++ +AK+SN  HR +GL
Sbjct: 605 VCNLGSVNLAQHVDENGLNIEKLQSTINTAVRMLDNVIDINYYSVPQAKRSNMKHRPVGL 664

Query: 659 GLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQ 718
           G+MGFQ AL+   I YAS +AV  AD SME +S++AI AS +LA+ERGAY +F GSLW Q
Sbjct: 665 GIMGFQDALYKQGISYASSDAVTFADTSMEAVSYYAIQASAKLAEERGAYQTFDGSLWSQ 724

Query: 719 GVFPIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANIC 776
           G+ PIDSI +L + R E    ++R+  L WD ++   K  GMRNSN MAIAPTATIANI 
Sbjct: 725 GILPIDSIDILVKQRGEDYCKVDRSQTLDWDSVRAMAKK-GMRNSNVMAIAPTATIANIT 783

Query: 777 GVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIER 836
           GVSQSI+P+YQNLYVKSN+SG+FTVVN +LV  LK+R LWD  M++DLKY+DGS   IER
Sbjct: 784 GVSQSIEPTYQNLYVKSNLSGEFTVVNPYLVKALKERGLWDNVMVNDLKYYDGSAQPIER 843

Query: 837 IPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMG 896
           IP DLK+   TAFE++P WL+E+ASRRQKWIDQAQSLNLY+ E +GKKLD  Y+ AWL+G
Sbjct: 844 IPADLKEQFRTAFEVEPRWLVEAASRRQKWIDQAQSLNLYIAEANGKKLDVTYKMAWLLG 903

Query: 897 LKTTYYLRSRSATSVEKSTLKGVDGKLNAV---PVTDPNSSTHSLGIPSSCTSD-TECEV 952
           LKTTYYLR+  AT  EKST+   DGKLN V   P T P     +  +P +C+ D  +CE 
Sbjct: 904 LKTTYYLRAIGATQTEKSTIS--DGKLNQVSSGPET-PAEFNQAADVPKACSIDEPDCEA 960

Query: 953 CQ 954
           CQ
Sbjct: 961 CQ 962


>gi|53804298|ref|YP_114078.1| ribonucleotide-diphosphate reductase subunit alpha [Methylococcus
           capsulatus str. Bath]
 gi|53758059|gb|AAU92350.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylococcus
           capsulatus str. Bath]
          Length = 969

 Score = 1183 bits (3060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/942 (60%), Positives = 708/942 (75%), Gaps = 18/942 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           V+VI+RNG VT FD +KIS AI KAF+AVEG  A+ S R+ + ++ LT+  V  LL+   
Sbjct: 30  VRVIRRNGKVTGFDAAKISVAITKAFLAVEGGNAAASRRIHESVEELTDLVVRALLRRLP 89

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKI 147
               +HIEDIQDQVE +LM++GH K+ R YVLYREER+ +RA  Q+  K+       +++
Sbjct: 90  GGGTIHIEDIQDQVELALMRAGHQKVARAYVLYREERARLRAEKQNEGKAQGGAEDVVQV 149

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            ++DGT    ++ RL  +VEEAC GL DV    ++ ET +N++DG+ E ++   L+ ++R
Sbjct: 150 TLEDGTRKPLDTARLRHVVEEACRGLSDVEPAWIIEETRRNLFDGVPEKEVAPTLVMTAR 209

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IE+E NY+ V AR LL+ LRRE L+ +      AT  EM   Y EYF  Y++ GV+  
Sbjct: 210 TRIEQESNYSYVAARLLLDALRREALSFLGHGAVSATQDEMSERYGEYFKDYVKRGVELE 269

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  L   LK ERD  F YLGLQ LYDRYF+H    R E+PQAFFMRVAMG
Sbjct: 270 LLSPELARFDLQRLGEALKPERDLQFNYLGLQTLYDRYFIHSGDIRFELPQAFFMRVAMG 329

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++E ++E+RA+EFY+LLSSF FM STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+
Sbjct: 330 LAIQEVDREERAIEFYDLLSSFDFMSSTPTLFNAGTLRPQLSSCYLTTVPDDLDGIYSAI 389

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VRG+GAHI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 390 KDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 449

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFMKRV +   WTLFSP++ 
Sbjct: 450 VCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMKRVAEEREWTLFSPNDT 509

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G+ FE  Y+ YE +ADRGEIK+++++ AV LWRKML+MLFETGHPW+ FKDPC
Sbjct: 510 PDLHDLTGQSFERRYQEYEAKADRGEIKLYKRLPAVQLWRKMLSMLFETGHPWLAFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA-NNQFDYDKLASTIR 626
           N+R   QH GVVHSSNLCTEITL+++  E AVCNLGS+NL AH   +   D +KL  TI 
Sbjct: 570 NLRYTNQHAGVVHSSNLCTEITLHTNDNEIAVCNLGSVNLAAHITPDGALDTEKLQRTIA 629

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           T +R+LDNVIDIN +++ +A++SN  HR +GLG+MGFQ AL+ L +PYAS EAV  AD S
Sbjct: 630 TGMRMLDNVIDINYYSVPQARRSNLRHRPVGLGIMGFQDALYKLRLPYASQEAVAFADLS 689

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME +S++AI AS +LA ERG YSSF GSLW +G+ PIDSI LL E R   L M+R+  L 
Sbjct: 690 MEAVSYYAIQASCDLAAERGRYSSFDGSLWSRGILPIDSIALLEEGRGGYLQMDRSQTLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W+ L++RV+T+GMRNSN MAIAPTATI+NICGVSQSI+P+YQNL+VKSN+SG+FTVVN +
Sbjct: 750 WNALRERVRTVGMRNSNTMAIAPTATISNICGVSQSIEPTYQNLFVKSNLSGEFTVVNPY 809

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK   LWD  MI+DLKY+DGS+  IERIP+ LK+++ATAFEID  WLIE+ SRRQK
Sbjct: 810 LVRDLKTLGLWDAVMINDLKYYDGSVQKIERIPETLKQLYATAFEIDARWLIEAGSRRQK 869

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           W+DQAQSLNLYL EPSGKKLD +Y+ AW+ GLKTTYYLRS  AT VEKST    DGKLNA
Sbjct: 870 WLDQAQSLNLYLAEPSGKKLDTLYKLAWVRGLKTTYYLRSLGATHVEKST--AFDGKLNA 927

Query: 926 V---PVTDPNSSTHSLGI---------PSSC-TSDTECEVCQ 954
           V   P+ D       L           P +C   D  CE CQ
Sbjct: 928 VKTDPIDDAIPGLRPLETVYADTRPAEPKACLIDDPTCEACQ 969


>gi|254428366|ref|ZP_05042073.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Alcanivorax sp. DG881]
 gi|196194535|gb|EDX89494.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Alcanivorax sp. DG881]
          Length = 962

 Score = 1182 bits (3058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/959 (59%), Positives = 720/959 (75%), Gaps = 18/959 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+ D N  D+    SLA   P +++   VIKRNG V S+D  KI+ AI KAF+AVEG  A
Sbjct: 15  PASDSNDQDQ----SLASTAPGQLR---VIKRNGKVVSYDDDKITVAISKAFLAVEGGTA 67

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + +  LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YVLYR
Sbjct: 68  AASSRIHETVARLTEQVSATFKRRMPSGGTIHIEEIQDQVELALMRNGEQKVARDYVLYR 127

Query: 123 EERSDVRAAQSHSKSDAPI-APKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIV 181
           E+++  RAA+  S   AP     + + M+DG+    +  RLE ++  ACSGL+DV++  +
Sbjct: 128 EQQASKRAAEHSSDLPAPTHQVDMSVTMEDGSKAPLDMARLEHLIRAACSGLEDVNADKI 187

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           ++ET KN+YDG+S  D+ T+++ ++RT+IE EPNY++VTAR L++K+R E L  +    +
Sbjct: 188 ITETVKNLYDGVSIHDVNTSMVITARTMIEVEPNYSQVTARLLMDKIRAEALQFL-NVAE 246

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +A+H EM  LY E    YI +G++  LL   + ++DL  L   L   RD  F YLGLQ L
Sbjct: 247 RASHDEMNALYGEALKAYIGKGIELELLSPQLAEYDLDKLGAALDGNRDLQFSYLGLQTL 306

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYF+H N +RIE+PQ FFMRVAMGLA++E  +E RA+EFYNLLSSF +M STPTLFN+
Sbjct: 307 YDRYFIHHNDTRIELPQCFFMRVAMGLAVEEDNREARAIEFYNLLSSFDYMSSTPTLFNA 366

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GT  PQLSSC+LTTVPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LGA+I GTNG+S
Sbjct: 367 GTLRPQLSSCYLTTVPDDLHGIYGAIQDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGRS 426

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMN+
Sbjct: 427 QGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNS 486

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           ANWIPDLFMKRV     WTLFSP++  DLHDLYG+ FE AY  YE +   GE+K+F+++ 
Sbjct: 487 ANWIPDLFMKRVINEEDWTLFSPNDAPDLHDLYGEAFEKAYLEYEAKTRSGELKLFKRLP 546

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           A+ LWRKML+MLFETGHPW TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ EE AVCN
Sbjct: 547 AINLWRKMLSMLFETGHPWFTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNQEEIAVCN 606

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGS+NL  H   N  D +KL  TI TAVR+LDNVIDIN +++ +A++SN  HR +GLG+M
Sbjct: 607 LGSVNLAQHVDENGLDIEKLQGTINTAVRMLDNVIDINYYSVPQAERSNMKHRPVGLGIM 666

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+   I YAS +AV  AD SME +S++AI AS +LA+ERGAY +F GSLW QGV 
Sbjct: 667 GFQDALYKQGISYASSDAVTFADNSMEAVSYYAIQASAKLAEERGAYQTFDGSLWSQGVL 726

Query: 722 PIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           PIDSI +L   R E    ++R+  L WD ++   K  GMRNSN MAIAPTATIANI GVS
Sbjct: 727 PIDSIEILVNQRGEDYCKVDRSQTLDWDSVRAMAKK-GMRNSNVMAIAPTATIANITGVS 785

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNLYVKSN+SG+FTVVN +LV+ LK+R LWD  M++DLKY+DGS   IERIP 
Sbjct: 786 QSIEPTYQNLYVKSNLSGEFTVVNPYLVSALKERGLWDNVMVNDLKYYDGSAQPIERIPA 845

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK+   TAFE++P WL+E+ASRRQKWIDQAQSLNLY+ E +GKKLD  Y+ AWL+GLKT
Sbjct: 846 DLKEQFRTAFEVEPRWLVEAASRRQKWIDQAQSLNLYIAEANGKKLDVTYKMAWLLGLKT 905

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVP--VTDPNSS-THSLGIPSSCT-SDTECEVCQ 954
           TYYLR+  AT  EKST+   DGKLN V   V +P +    +  +P +C+  D +CE CQ
Sbjct: 906 TYYLRAIGATQTEKSTIN--DGKLNRVSSKVEEPAAEFGQAADVPQACSLDDPDCEACQ 962


>gi|256822963|ref|YP_003146926.1| ribonucleoside-diphosphate reductase subunit alpha [Kangiella
           koreensis DSM 16069]
 gi|256796502|gb|ACV27158.1| ribonucleoside-diphosphate reductase, alpha subunit [Kangiella
           koreensis DSM 16069]
          Length = 957

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/933 (60%), Positives = 718/933 (76%), Gaps = 15/933 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VI+RNG VT +D SKI  A+ KAF+AVEG  A+ S RV + ++ LT+Q      +   
Sbjct: 33  IRVIRRNGKVTPYDDSKIEVAMTKAFLAVEGGAAAASSRVHETVRQLTKQITDAFKRRMP 92

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP-KLKI 147
              I+HIED+QDQVE +LM++G  K+ R YVLYREERS  RAA+  +K DA +   ++ +
Sbjct: 93  GGGIIHIEDVQDQVELALMRNGEQKVARSYVLYREERSRERAARDTAKLDALVGDNQVMV 152

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            ++DG+    + +RL  +V EAC  L DV    +L +T +N+YDG++  D   AL+ ++R
Sbjct: 153 TVEDGSKRPLDVERLHTVVVEACKDLSDVEPDQILKDTMRNLYDGVAIKDAYQALVMTAR 212

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEKEPNY  VTAR LL+ +R E L  +    ++AT  EM  +YPE F  Y+  GV+  
Sbjct: 213 TMIEKEPNYTYVTARLLLDSIRSEALREL-GVAKRATQSEMNAIYPEAFKAYLSVGVENE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   ++ FDL  +AN +K ERD  F YLG+Q L+DRYF+H +  RIE+PQ F+MRVAMG
Sbjct: 272 LLSPELLSFDLDKIANAIKPERDMLFTYLGIQTLFDRYFIHKDEVRIELPQVFWMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E ++E RA+EFY++LS+FH+M STPTLFNSGT  PQLSSC+LT VPDDL GI+GA+
Sbjct: 332 LAVNEDDREARAIEFYDVLSTFHYMSSTPTLFNSGTLRPQLSSCYLTNVPDDLDGIYGAI 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWTPVRGLGA+I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTPVRGLGAYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWHID+EEFL+LRKNTGDDRRRTHDMN+ANW+PDLF+KRV+ +  WTLFSP+EV
Sbjct: 452 VCAYLETWHIDIEEFLELRKNTGDDRRRTHDMNSANWVPDLFLKRVSSDGDWTLFSPNEV 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYGKEFE  YE YE  A  G+IK  + I A  LWRKML+MLFETGHPWITFKDPC
Sbjct: 512 PDLHDLYGKEFEERYEYYEEMAKYGKIKTAKTIPANVLWRKMLSMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNS-SSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           N+RSPQQHVGVVHSSNLCTEITLN+ + EE AVCNLGS+NL  H  + + D ++L  T+ 
Sbjct: 572 NLRSPQQHVGVVHSSNLCTEITLNTKAGEEIAVCNLGSVNLPKHMKDGKLDTEQLEKTVS 631

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TAVR+LDNVIDIN + ++ A+KSN  HR +GLGLMGFQ AL+L +IPY S  AV+ AD +
Sbjct: 632 TAVRMLDNVIDINFYPVDTARKSNMRHRPVGLGLMGFQDALYLQNIPYTSEAAVDFADNA 691

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME IS++AI AS +LA+ERG+Y SF GSLW QG+ PIDSI  L E R    + ++ +S +
Sbjct: 692 MEAISYYAIQASTDLAEERGSYESFAGSLWSQGILPIDSIEKLIEERGAEFIEVDTSSTM 751

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L++RVKTIGMRNSN MAIAPTATI+NI GVSQSI+P+YQNLYVKSN+SG+FTVVN 
Sbjct: 752 DWDTLRERVKTIGMRNSNVMAIAPTATISNISGVSQSIEPTYQNLYVKSNLSGEFTVVNP 811

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           ++V ELK R LWD  M++DLKY++GS+ +I+RIP ++K++ ATAFE++P WL+E+ASRRQ
Sbjct: 812 YMVKELKARKLWDSVMVNDLKYYEGSLQHIDRIPSEIKELFATAFEVEPKWLVEAASRRQ 871

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLNLY+ EPSGKKLD +YR AW  GLKTTYYLRS  ATS EKST+   DGKLN
Sbjct: 872 KWIDQAQSLNLYMSEPSGKKLDMVYRMAWFRGLKTTYYLRSLGATSTEKSTIS--DGKLN 929

Query: 925 AVPVTDPNSSTHSLG--IPSSCTSD-TECEVCQ 954
           AV     +S   ++G   P +C  D  +CE CQ
Sbjct: 930 AV-----SSGPAAVGSAAPKACAIDEPDCEACQ 957


>gi|302525966|ref|ZP_07278308.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptomyces
           sp. AA4]
 gi|302434861|gb|EFL06677.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptomyces
           sp. AA4]
          Length = 967

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/911 (62%), Positives = 692/911 (75%), Gaps = 9/911 (0%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           PS A   P     V+VI+R+G V+ FD  KIS A+ KAF+AVEG  A+ S RV  ++  L
Sbjct: 31  PSAAEGAP---SAVRVIRRDGSVSPFDAGKISVALTKAFLAVEGGDAAASSRVHHVVAEL 87

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TEQ    LL+H      +HIE IQDQVE +LM+ GHHK+ R YVLYR    D RA    +
Sbjct: 88  TEQVEAALLRHTGPETALHIEQIQDQVELALMRGGHHKVARAYVLYR----DERAKAREA 143

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
            + A     L +   DGTL   +  R+  +V EA +GL+DVS++ VL+E  +N+YDG++ 
Sbjct: 144 AAPAHAEVALSVKGADGTLRPLDWARVSHVVGEAVAGLEDVSAEPVLAEAKRNLYDGITA 203

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            +L  A I ++R L+E+EPNY+ V+AR LL+KLR E L+ +   P++A+  EM   Y  Y
Sbjct: 204 DELALAQIMAARVLVEQEPNYSFVSARLLLDKLRGEALSYLAGAPRQASQDEMTSEYAPY 263

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  Y+   V+  L+   +  FDL  +   ++ ERD  F +LGLQ LYDRYF H NG R E
Sbjct: 264 FRAYLRRAVELELVDAELTTFDLDKITAAIRPERDLDFGFLGLQTLYDRYFQHHNGVRFE 323

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQAFFMRVAMGLA++E  +E RA+EFY LLS+FHFM STPTLFNSGT   QLSSCFLTT
Sbjct: 324 LPQAFFMRVAMGLAIREDNREARAIEFYELLSTFHFMASTPTLFNSGTNRAQLSSCFLTT 383

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           V DDL  IF A + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG+SQGV+PFLK+ANDTA
Sbjct: 384 VDDDLDSIFQAYKNNALLAKYSGGLGNDWTPVRGLGAHIKGTNGQSQGVVPFLKIANDTA 443

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGA CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PD F++RV  
Sbjct: 444 VAVNQGGKRKGAACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDEFLRRVEA 503

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           NA WTLFSP+E  DLHDLYG  F   Y  YE  A RGEIKVFRK+ AV LWR+MLTMLFE
Sbjct: 504 NAEWTLFSPNETPDLHDLYGNAFAQRYREYEAAAARGEIKVFRKVRAVELWRRMLTMLFE 563

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN++++E AVCNLGS+NLL H     
Sbjct: 564 TGHPWITFKDPCNLRSPQQHVGVVHSSNLCTEITLNTTTDEVAVCNLGSVNLLKHVTPEG 623

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D ++L  T+RTAVR+LDNVIDIN +TI +A++SN  HR +GLG+MGFQ AL  L +P+A
Sbjct: 624 LDTERLEKTVRTAVRMLDNVIDINFYTIPEARRSNLRHRPVGLGIMGFQDALFELGVPFA 683

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-- 733
           S EAV+ AD SME +S++AISAS +LA+ERG Y +F+GSLW +G+ PIDS+ LL + R  
Sbjct: 684 SEEAVKFADVSMEHLSYYAISASTDLAEERGQYQTFEGSLWSKGILPIDSMQLLIDARQG 743

Query: 734 DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
           D L ++ ++ L W  L++RVKT+GMRNSN MAIAPTATI+NI GV QSI+P +QNLYVKS
Sbjct: 744 DGLDVDTSTTLDWAPLRERVKTVGMRNSNVMAIAPTATISNISGVGQSIEPLFQNLYVKS 803

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTVVN  LV  LK R LWDE M+SDLKY DGS+G I+R+PDDLK ++ATAFEI+ 
Sbjct: 804 NMSGDFTVVNPHLVKSLKARGLWDEVMVSDLKYFDGSLGQIDRVPDDLKALYATAFEIES 863

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            W++++ S RQKWIDQAQSLNLY+  PSG+KLD +YR AW  GLKTTYYLR++SAT VEK
Sbjct: 864 KWIVDAGSVRQKWIDQAQSLNLYIAAPSGRKLDELYRYAWHKGLKTTYYLRAQSATHVEK 923

Query: 914 STLKGVDGKLN 924
           STL+G DGKLN
Sbjct: 924 STLRGTDGKLN 934


>gi|261855610|ref|YP_003262893.1| ribonucleotide-diphosphate reductase subunit alpha
           [Halothiobacillus neapolitanus c2]
 gi|261836079|gb|ACX95846.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Halothiobacillus neapolitanus c2]
          Length = 957

 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/928 (59%), Positives = 700/928 (75%), Gaps = 9/928 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VI+RNG VT+FD SKI  A+ KAF+AVEG GA+ S+RV D++  L++Q  + L +   
Sbjct: 37  LRVIRRNGKVTAFDDSKIKVAMTKAFLAVEGSGAAVSMRVHDLVNALSDQISSALKRRAP 96

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
               VHIEDIQDQVE +LM+ GHHK+ R YVLYRE ++  RAA++  ++   I   L + 
Sbjct: 97  GGGTVHIEDIQDQVELALMREGHHKVARAYVLYREHQAQKRAAEAPDQATPEIV--LNVT 154

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DGT    +  RL  ++ EACS L DV    VL ET +N++DG+ E ++ TAL+ S+RT
Sbjct: 155 HADGTRSPLDHVRLNALIGEACSNLTDVDPNAVLQETLRNLFDGVPEKEVNTALVMSART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+PNY+ V AR LL+ +R E L    +     T  E+  L+ +YF  YI  G++  L
Sbjct: 215 LIEKDPNYSFVAARLLLDGIRSEALRFTKQPVTVCTQSELSGLFADYFQSYINTGIEHEL 274

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L  ++  +D+  L + +   RD  F YLGLQ LYDRYFLH  G R E+PQAFFMRVAMGL
Sbjct: 275 LDPTLRQYDIKRLTDAIDTSRDLQFSYLGLQTLYDRYFLHEGGVRFELPQAFFMRVAMGL 334

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A+ E ++E  A+EFY LLSSF FM STPTLFNSGT  PQLSSC+LTTVPDDL GIF A++
Sbjct: 335 AINEIDRETHAIEFYKLLSSFDFMSSTPTLFNSGTLRPQLSSCYLTTVPDDLDGIFAAIK 394

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDW+ VR L +HI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 395 DNALLSKFAGGLGNDWSRVRALSSHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 454

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFMKRV +   WTLFSP +  
Sbjct: 455 CAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMKRVMEEGEWTLFSPADCP 514

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G  FE AY  YE + DRGE+K FR+I A  LWRKML+MLFETGHPWITFKDPCN
Sbjct: 515 DLHDLTGLAFEKAYTAYEARVDRGEMKNFRRIKATNLWRKMLSMLFETGHPWITFKDPCN 574

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +R   QH GVVHSSNLCTEITL+++ +E AVCNLGS+NL  H   N  D +KLA TI+TA
Sbjct: 575 LRYTNQHAGVVHSSNLCTEITLHTNDQEIAVCNLGSVNLAQHVTENGLDQEKLARTIKTA 634

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVI+ N +++ +A+ SN  HR +GLG+MGFQ ALH+  IPY+S +A+E AD SME
Sbjct: 635 MRMLDNVIEYNYYSVPQARNSNLRHRPVGLGIMGFQDALHIQKIPYSSEQAIEFADRSME 694

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            +S++AISAS +LA ERG Y SF+GSLW +G+ PIDSI LLAE R + L MNR + L W+
Sbjct: 695 TVSYYAISASSDLAAERGRYQSFEGSLWSRGILPIDSIDLLAEARGKYLVMNRDTTLDWE 754

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            ++ ++K  GMRNSN MAIAPTATI+NICGV+QSI+P+++NL+VKSN+SG+FTV+N +LV
Sbjct: 755 AVRAKIKVQGMRNSNTMAIAPTATISNICGVAQSIEPTFENLFVKSNLSGEFTVINPYLV 814

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  DLWDE M++DLKY DGS+  I+RIPD LK ++ATAFE++P WLIE+ SRRQKWI
Sbjct: 815 RDLKALDLWDEVMVNDLKYFDGSVQQIDRIPDSLKALYATAFEVEPRWLIEAGSRRQKWI 874

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLYL +PSG KLD +Y+ AWL+GLKTTYYLR+ S T VEK+T+  +DGKL  V 
Sbjct: 875 DQAQSLNLYLADPSGPKLDQMYKNAWLVGLKTTYYLRASSKTRVEKTTMTKLDGKLRGVS 934

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
             DP +      +P +C   D  CE CQ
Sbjct: 935 A-DPIAE----ALPKACAIDDPGCEACQ 957


>gi|119504229|ref|ZP_01626309.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119459737|gb|EAW40832.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 964

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/930 (60%), Positives = 711/930 (76%), Gaps = 7/930 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG VTSF+ SKIS AI KAF+AVEG  A+ S R+ + +  LTEQ +T   +   
Sbjct: 38  LRVIKRNGTVTSFEDSKISVAITKAFLAVEGGTAAASSRIHETVAKLTEQVITTFKRRMP 97

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH-SKSDAPIAPKLKI 147
           S   +HIEDIQDQVE +LM++G HKI R+YV+YREER+  RAA++  S      A  + +
Sbjct: 98  SGGTIHIEDIQDQVELALMRAGEHKIARDYVIYREERARDRAAKAALSPESQAAASGINV 157

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +M DG+    N +R+  IV EAC+ L DVS   ++ E  +N+YDG++  ++ T+L+ ++R
Sbjct: 158 VMPDGSREPLNIERVRTIVSEACADLVDVSESAIIDEALRNLYDGVTADEVSTSLVITAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IE++PNY+ V AR LL+ LR E L  +    + AT  +M  LY E    +I +GV   
Sbjct: 218 TMIEQDPNYSYVAARLLLDNLRAESLNYL-GVAKSATQSDMAQLYSEALSAFIHQGVTLE 276

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +++FD+  L   L  ERD  F YLGLQ LYDRYF+H +  RIE+PQ FFMRVAMG
Sbjct: 277 LLSPELLEFDIAALGQALLPERDLQFSYLGLQTLYDRYFIHADEVRIELPQVFFMRVAMG 336

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+++E +   RA+EFY LLSSF +M STPTLFNSGT   QLSSC+LTTVPDDL+GI+GA+
Sbjct: 337 LSIREDDPNTRAIEFYQLLSSFDYMSSTPTLFNSGTLRSQLSSCYLTTVPDDLFGIYGAI 396

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQG++PFLKV NDTAVAVNQGGKRKGA
Sbjct: 397 QDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGIVPFLKVVNDTAVAVNQGGKRKGA 456

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSP++V
Sbjct: 457 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGDWTLFSPNDV 516

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYG+ FE  Y  YE  A  GEI+V + + A A+WRKML M+FETGHPW+TFKDPC
Sbjct: 517 PDLHDLYGRAFEDRYAQYEAMAASGEIRVHKTLKAQAVWRKMLGMIFETGHPWVTFKDPC 576

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN+S++E AVCNLGS+NL  H  + + +  KL +T+RT
Sbjct: 577 NLRSPQQHVGVVHSSNLCTEITLNTSADEIAVCNLGSVNLPQHIEDGKLNLKKLRATVRT 636

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN +++ +A++SN  HR IGLG+MGFQ AL+ + + YAS  AV  AD+SM
Sbjct: 637 AIRMLDNVIDINYYSVPQAEQSNMRHRPIGLGIMGFQDALYKIDVSYASKGAVSFADQSM 696

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLP 745
           E +S+ AI AS ELA ERGAYSS++GSLW QGVFP+DS+ +L E R  + + +NR     
Sbjct: 697 EAVSYFAIEASSELAAERGAYSSYEGSLWSQGVFPLDSLDILVEQRGANYIEVNRDMTFD 756

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W ELK RV   GMRNSNCMAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +
Sbjct: 757 WPELKGRVAKHGMRNSNCMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPY 816

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD+ M++DLKY DGS+ +I+RIPDDLK  ++TAFEI+P WL++SASRRQK
Sbjct: 817 LVRDLKARDLWDKVMVNDLKYFDGSVQSIDRIPDDLKAKYSTAFEIEPRWLVDSASRRQK 876

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY++  SGKKLD  YR AW  GLKTTYYLRS +AT  EKST++   GKLNA
Sbjct: 877 WIDQAQSLNLYINNASGKKLDVTYRMAWYSGLKTTYYLRSLAATGTEKSTVES--GKLNA 934

Query: 926 VPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           V      S+     +P +C+  D +CE CQ
Sbjct: 935 VASGAAESTPQPAPVPQACSLDDPDCEACQ 964


>gi|254492424|ref|ZP_05105596.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Methylophaga thiooxidans DMS010]
 gi|224462316|gb|EEF78593.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [Methylophaga thiooxydans DMS010]
          Length = 976

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/890 (61%), Positives = 687/890 (77%), Gaps = 2/890 (0%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
           G  VI+RNG VT FD  KI+ AI KAF+AVEG  A  S R+ D +K LT Q    LL+  
Sbjct: 18  GYSVIRRNGKVTDFDSGKIAVAITKAFLAVEGDSAQNSRRIHDTVKKLTGQITDNLLRRL 77

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
                VHIEDIQDQVE +LM+ G +K+ R YV+YRE++S+ RA +            L +
Sbjct: 78  DDGGTVHIEDIQDQVELALMREGEYKVARSYVVYREKQSEKRAEEEKKHPQPANETTLHV 137

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            + DGT    +  RL  ++ EAC GL +V  + +L +T +N++DG+ ESD+E AL+  +R
Sbjct: 138 TLADGTRQPLDIDRLHNLITEACEGLAEVDREAILRDTQRNLFDGVKESDVEKALVMGAR 197

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T IEK+P Y+ + AR L++ +RRE L+ V+K P++A  +EM  +YP+YF  YI   ++  
Sbjct: 198 TFIEKDPAYSTLAARLLMDGIRREALSFVFKMPKQAAQNEMVDIYPDYFKSYIHTAIEKE 257

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           L+   +  FDL  L   LK E DF F YLGLQ LYDRYF+H +G+R E+PQAF+MRVAMG
Sbjct: 258 LVDSELGLFDLDRLGKALKPELDFDFTYLGLQTLYDRYFIHYDGTRFELPQAFYMRVAMG 317

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E  +E+RA+EFYNLLSSF FM STPTLFNSGT  PQLSSC+LTTVPDDL GI+ A+
Sbjct: 318 LAINELNREERAIEFYNLLSSFDFMSSTPTLFNSGTLRPQLSSCYLTTVPDDLSGIYNAM 377

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+KY+GGLGNDWT VRGLGAHI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 378 RDNALLSKYAGGLGNDWTRVRGLGAHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 437

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWHID+EEFLD+RKNTGDDRRRTHDMNTANWIPD+FMKRV +   WTLFSP+EV
Sbjct: 438 VCAYLETWHIDIEEFLDMRKNTGDDRRRTHDMNTANWIPDMFMKRVAEEGQWTLFSPEEV 497

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL G  FE AY  YE +A RGEI+ F+++ A  LWRKML MLFETGHPW+TFKDPC
Sbjct: 498 DDLHDLTGLAFEKAYTEYEEKAARGEIRNFKQLPATDLWRKMLGMLFETGHPWVTFKDPC 557

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQFDYDKLASTIR 626
           N+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+N++ H   N + D  KL  T+R
Sbjct: 558 NLRSPQQHVGVVHSSNLCTEITLNTSDKEIAVCNLGSVNMVKHIDENGKLDTQKLQKTVR 617

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVI+ N +++ +A+ SN  HR +GLG+MGFQ AL+ L +PY+S E V+ ADES
Sbjct: 618 TAMRMLDNVIEYNYYSVPQARNSNLLHRPVGLGIMGFQDALYKLRLPYSSEETVKFADES 677

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME +S++AI AS +LA ERG Y S++GSLW +G+ PIDSI LL E R E L  + +  + 
Sbjct: 678 MEAVSYYAIEASSDLAAERGKYQSYEGSLWSKGILPIDSIKLLQEARGEYLQQDDSQTMD 737

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ ++K  GMRNSN MAIAPTATI+NICGVSQSI+P+YQN++VKSN+SG+FTV+N +
Sbjct: 738 WDALRDKIKRQGMRNSNTMAIAPTATISNICGVSQSIEPTYQNIFVKSNLSGEFTVINPY 797

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           +V +LK RDLWDE MI+DLKY DGS+ +I+RIPD+LK ++ TAFE+D  WLIE+ASRRQK
Sbjct: 798 MVEDLKARDLWDEVMINDLKYFDGSLQSIDRIPDELKALYTTAFEMDARWLIEAASRRQK 857

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
           WIDQAQSLNLY+ EPSGKK+D +Y+ AW+ GLKTTYYLRS  AT  EK++
Sbjct: 858 WIDQAQSLNLYMAEPSGKKMDNLYKLAWVRGLKTTYYLRSMGATGAEKTS 907


>gi|254516738|ref|ZP_05128797.1| putative ribonucleoside-diphosphate reductase alpha subunit [gamma
           proteobacterium NOR5-3]
 gi|219675161|gb|EED31528.1| putative ribonucleoside-diphosphate reductase alpha subunit [gamma
           proteobacterium NOR5-3]
          Length = 967

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/930 (60%), Positives = 700/930 (75%), Gaps = 10/930 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  F+ SKIS AI KAF+AVEG  A+ S R+ + +  LTE       +   
Sbjct: 44  LRVIKRNGTVVPFEASKISVAITKAFLAVEGGTAAASSRIHETVAKLTEMVTATFKRRMP 103

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA-QSHSKSDAPIAPKLKI 147
           S   +HIED+QDQVE SLM++G HKI R+YV+YRE+++  RAA QS S      A ++ +
Sbjct: 104 SGGTIHIEDVQDQVELSLMRAGEHKIARDYVIYREQQAVKRAARQSLSAETQQAADRINV 163

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +  DG+    + +RL +IV EAC+GL+DVS   +L E  +N+YDG+S  +L T+L+ ++R
Sbjct: 164 VQLDGSKAPLDLERLHIIVSEACAGLEDVSESRILDEALRNLYDGVSMQELSTSLVITAR 223

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIE+EPNY   +AR L + LR E LT +    + AT  +M   YP+    YI+ GV+  
Sbjct: 224 TLIEQEPNYTYASARLLCDNLRTEALTFL-GVAESATQGDMDRYYPQALSAYIKRGVELE 282

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL  ++ D+DL  L   +  ERD  F YLGLQ LYDRYF+H +  RIE+PQ FFMRVAMG
Sbjct: 283 LLDPTLADYDLEQLGAAILPERDLQFTYLGLQTLYDRYFIHSDEVRIELPQIFFMRVAMG 342

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++E  +E RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA+
Sbjct: 343 LAVEEEHREARAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGAI 402

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 403 QDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 462

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC+YLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP++V
Sbjct: 463 VCSYLETWHMDIEEFVELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGDWTLFSPNDV 522

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYGK FE  Y  YE  A  GEIK  + + A  LWRKML MLFETGHPW+TFKDPC
Sbjct: 523 PDLHDLYGKAFEERYNTYEAMAANGEIKNHKTVKAQNLWRKMLGMLFETGHPWMTFKDPC 582

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL  H   N  + +KL  T+RT
Sbjct: 583 NLRSPQQHAGVVHSSNLCTEITLNTSADEIAVCNLGSINLPQHIDENGLNLEKLEQTVRT 642

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN ++++ A+ SN  HR +GLGLMGFQ AL+  HI Y S  AVE AD SM
Sbjct: 643 AVRMLDNVIDINYYSVDTARNSNFRHRPVGLGLMGFQDALYKQHIAYGSDAAVEFADRSM 702

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLP 745
           E IS++AI AS  LA ERGAYSS++GSLW QG+ PIDS+  L + R  D + ++ T+ L 
Sbjct: 703 EAISYYAIDASSSLAAERGAYSSYEGSLWSQGILPIDSLSKLVDERGSDYIKVDSTTTLD 762

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W+ L+  VK  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +
Sbjct: 763 WESLRTSVKARGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPY 822

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LVN+LK R LWD  M++DLKY+DGS+ +IERIP DL+ I++ AFE++P W++E ASRRQK
Sbjct: 823 LVNDLKARGLWDSVMVNDLKYYDGSVQSIERIPADLRAIYSNAFEVEPKWIVECASRRQK 882

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY++  SGKKLD  YR AW  GLKTTYYLRS +AT  EKST+    G+LNA
Sbjct: 883 WIDQAQSLNLYINNASGKKLDITYRMAWYSGLKTTYYLRSLAATGTEKSTI--ATGQLNA 940

Query: 926 VPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           V     ++      +P +C+  D +CE CQ
Sbjct: 941 V---SSSAEPQPAPVPQACSLDDPDCEACQ 967


>gi|329893651|ref|ZP_08269785.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC3088]
 gi|328923578|gb|EGG30890.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC3088]
          Length = 922

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/928 (60%), Positives = 700/928 (75%), Gaps = 10/928 (1%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +IKRNG V  FD SKIS AI KAF+AVEG  A+ S R+ + +  LT Q +    +   S 
Sbjct: 1   MIKRNGQVVPFDNSKISVAITKAFLAVEGGTAAASSRIHETVAKLTTQVMGTFERRMPSG 60

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP-IAPKLKIMM 149
             +HIEDIQDQVE +LM++G HKI R+YV+YREE++  RA +    ++A   A  + ++ 
Sbjct: 61  GTIHIEDIQDQVELALMRAGEHKIARDYVIYREEQARKRAQKRALSAEAERAAGAISVLQ 120

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG+    + +RL+ +V EAC+ L DVS+  +L E  +N+YDG++  ++ T+L+ ++RTL
Sbjct: 121 PDGSRAPLDIERLQTVVSEACADLADVSASKILEEALRNLYDGVTLDEVTTSLVITARTL 180

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE+EPNY    AR L + LR E L  +    Q+AT  EM   YP+    YI +G++  LL
Sbjct: 181 IEQEPNYTYAAARLLCDDLRSEALEFL-GVTQRATQQEMALYYPQALQAYIAKGIQLELL 239

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              + DFD+  L   ++ ERD  F YLGLQ LYDRYF+H N +R E+PQ FFMR+AMGLA
Sbjct: 240 SPELADFDIARLGAAIQPERDLQFTYLGLQTLYDRYFIHSNETRFELPQVFFMRIAMGLA 299

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           ++E +K  RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+GA+++
Sbjct: 300 VREDDKNARAIEFYQLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAIRD 359

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVC
Sbjct: 360 NALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVC 419

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+D+EEFL+LRKNTGDDRRRTHDMN+ANWIPDLFMKRV +   WTLFSP++  D
Sbjct: 420 AYLETWHLDIEEFLELRKNTGDDRRRTHDMNSANWIPDLFMKRVFEGGEWTLFSPNDTPD 479

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHD YG +FE  YE YE Q   GE+K+F+++ A  LWRKML MLFETGHPWITFKDPCN+
Sbjct: 480 LHDSYGADFEAKYEAYEAQTRSGELKLFKRVKAENLWRKMLGMLFETGHPWITFKDPCNL 539

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQ HVGVVHSSNLCTEITLN+S EE AVCNLGS+NL  H   N  + +KL  T+ TAV
Sbjct: 540 RSPQSHVGVVHSSNLCTEITLNTSDEEIAVCNLGSVNLPQHIDENGLNLEKLQKTVTTAV 599

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +++ +A++SN  HR +GLGLMGFQ AL+  HI Y+SPEAVE AD SME 
Sbjct: 600 RMLDNVIDINYYSVPQAERSNFRHRPVGLGLMGFQDALYKQHIAYSSPEAVEFADRSMEA 659

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPWD 747
           IS++AI AS  LA+ERG YSSF+GSLW QG+ PIDS+  LAE R +  L ++RT  L WD
Sbjct: 660 ISYYAIQASSALAEERGTYSSFEGSLWSQGILPIDSLERLAESRGDQYLQIDRTQTLDWD 719

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++RV+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 720 TLRERVRAKGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 779

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
           N+LK R+LWD+ M++DLKY+DGS   I+RIP DLK I++TAFE++P W++E+ASRRQKWI
Sbjct: 780 NDLKARNLWDKVMVNDLKYYDGSAQAIDRIPADLKAIYSTAFEVEPRWIVEAASRRQKWI 839

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY++  SGKKLD  YR AWL GLKTTYYLRS +AT  EKST+    G LNAV 
Sbjct: 840 DQAQSLNLYINNASGKKLDVTYRMAWLSGLKTTYYLRSLAATGTEKSTVD--KGTLNAVA 897

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
                          +C+  D +CE CQ
Sbjct: 898 AAAAPQPAPVP---KACSLDDPDCEACQ 922


>gi|313497536|gb|ADR58902.1| NrdA [Pseudomonas putida BIRD-1]
          Length = 959

 Score = 1172 bits (3032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/948 (58%), Positives = 709/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+ P LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNPDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ + A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTVQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTTKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 PYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     ++   + G   +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|119713587|gb|ABL97638.1| ribonucleotide-diphosphate reductase alpha subunit [uncultured
           marine bacterium EB0_39H12]
          Length = 955

 Score = 1172 bits (3031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/943 (58%), Positives = 716/943 (75%), Gaps = 18/943 (1%)

Query: 21  PFPEKIKG-VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQT 79
           P P    G ++VIKRNG V S+D  KI+ AI KAF+AVEG  A+ S R+ + +  L    
Sbjct: 22  PKPAIAPGQMRVIKRNGSVVSYDAEKIAIAITKAFLAVEGGAAAASTRIHNEVNQLANSV 81

Query: 80  VTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDA 139
            T   +   S   +HIE+IQDQVE  LM+SG  K+ R YVLYREER  +R  +   K   
Sbjct: 82  TTTFTRRMPSGGTLHIEEIQDQVELELMRSGEQKVARTYVLYREERKQLRQKEEPQKE-- 139

Query: 140 PIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLE 199
                +++ +++G   + + K LE++V EAC GL+  +++ ++ E  KN+YDG++E D  
Sbjct: 140 -EKEGIRVTLENGDEDTQDIKHLEIMVTEACEGLEGTNAQQIIDEANKNLYDGVTEEDAR 198

Query: 200 TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRY 259
           T+L+ +SRTL+E+EPNY  VTAR LL+ +R E LT +  + Q AT  EM+ LYP+    +
Sbjct: 199 TSLVMTSRTLVEQEPNYTYVTARILLDNIRTEALTYLELQKQ-ATQQEMKVLYPQALRSF 257

Query: 260 IEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQA 319
           + +GV+  +L+  +++ D+  L   +   RD  F YLGLQ LYDRYF+H    R E+PQ 
Sbjct: 258 LAKGVENEILNPELLEMDIEKLGKAIDSSRDMDFTYLGLQTLYDRYFIHDTEIRYELPQV 317

Query: 320 FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
           FFMRV+MGLAL+E ++E++A+EFYNLLSSF +M STPTLFNSGT+H QLSSC+LTTVPDD
Sbjct: 318 FFMRVSMGLALREEKREEKAIEFYNLLSSFDYMSSTPTLFNSGTKHSQLSSCYLTTVPDD 377

Query: 380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           L+GI+GA+Q+NAML+K++GGLGNDWTPVRGLG+ I GTNGKSQGV+PFLKV NDTAVAVN
Sbjct: 378 LHGIYGAIQDNAMLSKWAGGLGNDWTPVRGLGSQIKGTNGKSQGVVPFLKVVNDTAVAVN 437

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGGKRKGAVC+YLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW+PDLF+KRV+++  W
Sbjct: 438 QGGKRKGAVCSYLETWHVDIEEFVELRKNTGDDRRRTHDMNTANWVPDLFLKRVSEDKKW 497

Query: 500 TLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHP 559
           TLF+P +  DLHDLYG EFE  YE YE Q   GEI+ F+++ A  LW+KML+M+FETGHP
Sbjct: 498 TLFTPSDTPDLHDLYGLEFEKRYEEYETQTKTGEIEFFKEVEAKDLWKKMLSMVFETGHP 557

Query: 560 WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYD 619
           WITFKD CN+RSPQQH GVVHSSNLCTEITLN+S +E AVCNLGS+NL  H  + + D +
Sbjct: 558 WITFKDVCNLRSPQQHTGVVHSSNLCTEITLNTSQDEIAVCNLGSVNLTHHIKDGKMDEE 617

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL  TI TA+R+LDNVIDIN + ++ A+ SN  HR IGLG+MGF  AL++L  PYAS EA
Sbjct: 618 KLEKTINTAIRMLDNVIDINFYAVKAAETSNMKHRPIGLGIMGFHDALYMLETPYASQEA 677

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LA 737
           V+ AD+SME +S++AI AS +LA+ERGAY S++GSLW QG+ PIDSI LL E R E  L 
Sbjct: 678 VDFADKSMEMVSYYAIKASSDLAKERGAYQSYEGSLWSQGILPIDSIKLLKESRGEDYLE 737

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           M+ +S + WD L++ V+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG
Sbjct: 738 MDESSSMDWDGLREIVRNQGIRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSG 797

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTV N  +V  LK+  LWD  MI+DLKY+DGS+  I RIP+++K+++ATAF+I+P WLI
Sbjct: 798 EFTVTNIPMVENLKRLGLWDSVMINDLKYYDGSVKGISRIPEEVKELYATAFDIEPRWLI 857

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           ++ASRRQKWIDQ+QSLNLY+DEP+GKKLD +YR AWL GLKTTYYLRSRSAT+ EKST+ 
Sbjct: 858 DAASRRQKWIDQSQSLNLYIDEPNGKKLDIMYRMAWLRGLKTTYYLRSRSATTAEKSTIS 917

Query: 918 GVDGKLNAV-----PVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
              G+LNAV     P   P ++T +   PS+C+  D +C+ CQ
Sbjct: 918 --TGELNAVSATAQPEVQPQNNTTA---PSACSILDPDCDACQ 955


>gi|26987914|ref|NP_743339.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida KT2440]
 gi|24982623|gb|AAN66803.1|AE016309_5 ribonucleoside reductase, alpha subunit [Pseudomonas putida KT2440]
          Length = 959

 Score = 1169 bits (3024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/948 (58%), Positives = 708/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ + A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTVQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTTKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 PYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     ++   + G   +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|148546453|ref|YP_001266555.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida F1]
 gi|148510511|gb|ABQ77371.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida F1]
          Length = 959

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/948 (58%), Positives = 708/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 PYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     ++   + G   +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|325272775|ref|ZP_08139119.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas sp.
           TJI-51]
 gi|324102082|gb|EGB99584.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas sp.
           TJI-51]
          Length = 959

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/948 (58%), Positives = 707/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSQQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           ++S +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANSDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVAESATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+E+GV+  LL  ++  +DL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVEKGVEFELLDPALKGYDLERLGKAIDHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIN 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S+ AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 PYGSDAAVEFADKSMEAVSYFAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + +N    L W  +++RVK  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVNLEESLDWAPVRERVKK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     ++   + G   +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|254239526|ref|ZP_04932848.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa 2192]
 gi|126192904|gb|EAZ56967.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa 2192]
          Length = 963

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/952 (58%), Positives = 703/952 (73%), Gaps = 17/952 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSSQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE R+  R   
Sbjct: 76  RRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREARAAERKNA 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
             +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 GAASDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY
Sbjct: 196 VAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALGFL-GVAESATHHEMAELY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDRYFIHKDGI 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLA++E ++E R +EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQIFFMRVAMGLAIEEKDREARTIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  LWRKML+M
Sbjct: 495 VFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLVNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PIDS   L E 
Sbjct: 675 PYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPIDSEKKLIEE 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPV-------TDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
            EKST+    GKLNAV           P +      +P +C+ D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSAGGNDGLQATPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|104780528|ref|YP_607026.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           entomophila L48]
 gi|95109515|emb|CAK14216.1| ribonucleoside diphosphate reductase, alpha subunit [Pseudomonas
           entomophila L48]
          Length = 958

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/932 (59%), Positives = 703/932 (75%), Gaps = 10/932 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 31  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTVARLTEQVTATFKRRMP 90

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA ++++ +     P ++I 
Sbjct: 91  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATRANTDAVVEPHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+L   +  RL  I+ EAC GL +V  +++  ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSLAPLDMARLNTIISEACEGLAEVDGELIQRETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+E+GV+  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLYAKALPAYVEKGVEFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L  ++  +DL  +   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LDPALKGYDLERMGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQVFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 ALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGKWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+MLFETGHPW+TFKDPCN
Sbjct: 510 DLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSMLFETGHPWLTFKDPCN 569

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D  KL  T+ TA
Sbjct: 570 LRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTAKLQRTVNTA 629

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AVE AD+SME
Sbjct: 630 VRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHIPYGSDAAVEFADKSME 689

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R +  + ++ T  L W
Sbjct: 690 AVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEARGQKYIDVDLTESLDW 749

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             +++RVK  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +L
Sbjct: 750 APVRERVKK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYL 808

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK R LWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE++  W++++ASRRQKW
Sbjct: 809 VRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFEVETKWIVDAASRRQKW 868

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNAV
Sbjct: 869 IDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLNAV 926

Query: 927 PVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
                ++   + G   +P +C  D  +CE CQ
Sbjct: 927 SSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 958


>gi|331006662|ref|ZP_08329943.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC1989]
 gi|330419530|gb|EGG93915.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [gamma proteobacterium IMCC1989]
          Length = 963

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/932 (59%), Positives = 705/932 (75%), Gaps = 9/932 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ A+ KAF+AVEG  A+ S RV + +K  T+Q      +   
Sbjct: 35  LRVIKRNGTVMPYAEDKIAIAVTKAFLAVEGGTAAASSRVHETVKLFTQQISDTFNRRMP 94

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA--PKLK 146
           S   VHIEDIQDQVE +LM++G HK+ R+YVLYR ER+ VRA+ + + S   ++  PKL 
Sbjct: 95  SGGTVHIEDIQDQVELTLMRNGEHKVARDYVLYRAERARVRASATPAVSAEALSKYPKLN 154

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           + +++G     +  R+  IV EAC GL DVS   +L E  +N+YDG++ SD+ T+L+ ++
Sbjct: 155 VTLENGDTAPLDMARIHTIVTEACEGLSDVSVDAILDEAMRNLYDGVALSDINTSLVITA 214

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTL+EKEPNY+  TAR L +KLR E L  +    ++ATHHEM   Y +    YIE+G++ 
Sbjct: 215 RTLVEKEPNYSYATARLLQDKLRAEALGFL-GIAEQATHHEMAHYYAQALPAYIEKGIEL 273

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL  S+ +FD+  L   L + RD  F YLGLQ LYDRYF+H N  RIE+PQ FFMRVAM
Sbjct: 274 ELLAPSLRNFDIPALGKALDHTRDSQFTYLGLQTLYDRYFIHSNDVRIELPQIFFMRVAM 333

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLA++E +  +RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA
Sbjct: 334 GLAVEEDKPTERAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGA 393

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKG
Sbjct: 394 MQDNAMLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKG 453

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           A+CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV     WTLF+P E
Sbjct: 454 AMCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFDKKEWTLFTPSE 513

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDL G  FE  YE YER ADRGEIK F++I A +LWRKML MLFETGHPWITFKD 
Sbjct: 514 APDLHDLCGTAFETRYEEYERMADRGEIKHFKRIPAESLWRKMLGMLFETGHPWITFKDS 573

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSS-EETAVCNLGSINLLAHFANNQFDYDKLASTI 625
           CN+RSPQQHVGV+HSSNLCTEITLN+S+ +E AVCNLGS+NL  H  N + +  KL +T+
Sbjct: 574 CNLRSPQQHVGVIHSSNLCTEITLNTSAGDEIAVCNLGSVNLAQHIENGELNTTKLEATV 633

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
            TAVR+LDNVIDIN + +E A+ SN  HR IGLGLMGFQ AL+     Y+S +AVE AD 
Sbjct: 634 NTAVRMLDNVIDINYYAVEAARTSNMRHRPIGLGLMGFQDALYKQGFAYSSDQAVEFADR 693

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSR 743
           SME IS+ AI+AS  LA ERG Y +F+GSLW +G  PIDSI  L + R E  + M+R+  
Sbjct: 694 SMEAISYFAINASSNLAAERGQYPTFEGSLWSKGELPIDSIETLVKQRGEKYIEMDRSQT 753

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L W  L+ +V+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN
Sbjct: 754 LDWSSLRSKVQKQGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVN 813

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +L+++LK+RDLWD  M++DLKY++GS+  +ERIP DLK ++ATAFE++P W++ +ASRR
Sbjct: 814 PYLIHDLKKRDLWDAVMVNDLKYYEGSVQKVERIPADLKALYATAFEVEPRWIVSAASRR 873

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKW+DQAQSLNLY+   +GKKLD  YR AW  GLKTTYYLR+ SAT+ EKST+ G  G L
Sbjct: 874 QKWLDQAQSLNLYIAGANGKKLDVTYRMAWYSGLKTTYYLRALSATTTEKSTVSG--GTL 931

Query: 924 NAVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
           NAV     +++  +  +P +C+ D  +CE CQ
Sbjct: 932 NAVSSNAESAAPVAAAVPKACSIDEPDCEACQ 963


>gi|313200885|ref|YP_004039543.1| ribonucleoside-diphosphate reductase subunit alpha [Methylovorus
           sp. MP688]
 gi|312440201|gb|ADQ84307.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylovorus
           sp. MP688]
          Length = 937

 Score = 1163 bits (3008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/938 (60%), Positives = 706/938 (75%), Gaps = 24/938 (2%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
           +  +QVI+R+G    F   KIS A+ KAF+AV G+ ++ S  ++  ++ LT+  V  L++
Sbjct: 15  LPSLQVIRRDGAAVPFAADKISIALTKAFLAVAGEHSTISTHMRTEVQALTDTVVAALVR 74

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
              +   +HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ          P L
Sbjct: 75  RKPAGGSIHIEDIQDQVELALMRSGEHDVARAYVLYREKRAAERAAQQAPA------PTL 128

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIF 204
            ++ D G  +  + + L  +V EAC  L D V   +++ +  +++YDG+   ++  ALI 
Sbjct: 129 HVLQD-GKRVPLDQQLLLSMVTEACVNLGDAVQPAVIVEQAMRDLYDGMPFDEVRRALIL 187

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           S+R+LIE+EP Y  VTAR  L+ +R EVL       +  +H  M   Y EYF +YI+ G+
Sbjct: 188 SARSLIEREPAYNYVTARLQLDLVRAEVLG------EAVSHTAMAQRYAEYFPQYIKAGI 241

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
            A LL E +  FDL  LA+ L  +RD  F YLGLQ LYDRYFLHI   RIE+PQ FFMRV
Sbjct: 242 AAELLDERLAQFDLSRLASVLVADRDLQFGYLGLQTLYDRYFLHIEERRIELPQVFFMRV 301

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLA+ E ++E RA+EFY++LSSF FM STPTLFNSGTRH QLSSC+LTTV DDL GI+
Sbjct: 302 AMGLAINEIDRESRAIEFYHVLSSFDFMSSTPTLFNSGTRHSQLSSCYLTTVSDDLDGIY 361

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            A++ENA+L K++GGLGNDWTPVR LG+ I GTNGKSQGVIPFLKV NDTAVAVNQGGKR
Sbjct: 362 QAIKENALLQKFAGGLGNDWTPVRALGSRIKGTNGKSQGVIPFLKVVNDTAVAVNQGGKR 421

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVC YLE+WH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV  NA WTLFSP
Sbjct: 422 KGAVCGYLESWHLDLEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVQANADWTLFSP 481

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +V DLHDLYGK FE AY NYER+AD GEIK+F+++ AV LWRKML+MLFETGHPWITFK
Sbjct: 482 SDVPDLHDLYGKAFETAYTNYERRADHGEIKLFKRVPAVQLWRKMLSMLFETGHPWITFK 541

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ----FDYDK 620
           DPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH          D  K
Sbjct: 542 DPCNIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLMAHLKREGDSYVLDQTK 601

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           LA+TIR A+R+LDNV+DIN + + KA+ SN+ HR +GLG+MGFQ ALH + +PYAS  AV
Sbjct: 602 LAATIRVAMRMLDNVVDINFYAVGKARNSNYRHRPVGLGIMGFQDALHAMRVPYASAAAV 661

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMN 739
           E AD +ME + ++A  AS  LA+ERGAYSSF+GSLWDQG+ P+D++ LL+E R  ++ ++
Sbjct: 662 EFADRAMEAVCYNAYLASSYLAEERGAYSSFRGSLWDQGILPLDTLNLLSEARGGQVEVD 721

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
           R+  L WD L++R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG+F
Sbjct: 722 RSRTLDWDSLRQRIQRVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSGEF 781

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN  LV +LK R LWDE MI+D+KY+DGS+  IER+P DLK+++ATAFE+DP+WL+E+
Sbjct: 782 TVVNEQLVQDLKARGLWDEVMIADIKYYDGSLAAIERVPADLKQLYATAFEVDPVWLVEA 841

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           A+RRQKWIDQAQSLNLY   PSGKKL+ +Y  AWL GLKTTYYLRS  ATS EKST +G 
Sbjct: 842 AARRQKWIDQAQSLNLYFAAPSGKKLNDVYLLAWLRGLKTTYYLRSLGATSAEKSTGQG- 900

Query: 920 DGKLNAVPVTDP--NSSTHSLGIPSSC-TSDTECEVCQ 954
            G+LNAV    P   ++T++   P  C   D +CE CQ
Sbjct: 901 -GELNAVSSALPAVAAATNAEPEPKQCLIDDPDCEACQ 937


>gi|52842001|ref|YP_095800.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|296107365|ref|YP_003619065.1| ribonucleoside-diphosphate reductase alpha chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|52629112|gb|AAU27853.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|295649266|gb|ADG25113.1| ribonucleoside-diphosphate reductase alpha chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610474|emb|CBX00046.1| hypothetical protein LPW_18011 [Legionella pneumophila 130b]
          Length = 942

 Score = 1163 bits (3008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/928 (60%), Positives = 698/928 (75%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K     +  L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKD-SKHLLIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K + AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIKSE-ATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R++ L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIPD+LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKALNLWDEVMVNDLKYFNGSVQPISRIPDELKRRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           + D          P +C+ +D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|254483512|ref|ZP_05096739.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [marine gamma proteobacterium HTCC2148]
 gi|214036233|gb|EEB76913.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
           [marine gamma proteobacterium HTCC2148]
          Length = 958

 Score = 1162 bits (3006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/930 (59%), Positives = 697/930 (74%), Gaps = 11/930 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  F+ SKIS AI KAF+AVEG  A+ S R+ + +  LT+Q      +   
Sbjct: 36  LRVIKRNGTVVPFEESKISVAITKAFLAVEGGTAAASSRIHETVAKLTDQVAATFQRRMP 95

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ-SHSKSDAPIAPKLKI 147
           S   +HIED+QDQVE SLM++G HKI R+YV+YREE+S  RAA+ S S+     A  + +
Sbjct: 96  SGGTIHIEDVQDQVELSLMRAGEHKIARDYVIYREEQSRKRAAKASLSQETQDAANGINV 155

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +  DG+ ++ +  RL  +V EAC  L+DV    +L E  KN+YDG++  +L T+L+ ++R
Sbjct: 156 IQPDGSRVALDLDRLHTVVSEACFELEDVVESAILDEALKNLYDGVTAEELATSLVITAR 215

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IE++PNY+ V AR L + LR E L+ +      AT  +M  LY +    YI  G++  
Sbjct: 216 TMIEQDPNYSYVAARLLCDNLRAEALSFL-GVATNATQADMGQLYAKALPAYIARGIELE 274

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL  ++  +DL  L   L  ERD  F YLGLQ LYDRYF+H + +R E+PQ FFMRVAMG
Sbjct: 275 LLSPNLAGYDLQRLGEALLPERDLQFTYLGLQTLYDRYFIHSDETRFELPQVFFMRVAMG 334

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA +E  +  RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA+
Sbjct: 335 LAAEEANRNDRAIEFYELLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGAI 394

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           Q+NAML+K++GGLGNDWTPVR LGA+I GTNGKSQG++PFLKV NDTAVAVNQGGKRKGA
Sbjct: 395 QDNAMLSKFAGGLGNDWTPVRALGAYIKGTNGKSQGIVPFLKVVNDTAVAVNQGGKRKGA 454

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+DVEEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV     WTLFSP +V
Sbjct: 455 VCAYLETWHMDVEEFVELRKNTGDDRRRTHDMNTANWIPDLFMKRVFNGEDWTLFSPSDV 514

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYG  FE  Y +YE  A  GEIK+F+ + A  LWRKML MLFETGHPW+TFKDPC
Sbjct: 515 PDLHDLYGVAFEQRYAHYEAMAAAGEIKLFKTVKAENLWRKMLGMLFETGHPWMTFKDPC 574

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS+NL  H   N  + +KL +T+RT
Sbjct: 575 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSVNLPQHIDENGLNLEKLRNTVRT 634

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLGLMGFQ AL+  H+ Y S +AV  AD SM
Sbjct: 635 AVRMLDNVIDINYYSVPQAKNSNLMHRPVGLGLMGFQDALYKQHLAYGSEQAVSFADHSM 694

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLP 745
           E IS++AI AS ELA ERGAYSS++GSLW QGVFPIDS+  L + R  D + +++T  + 
Sbjct: 695 EAISYYAIEASSELAAERGAYSSYEGSLWSQGVFPIDSLQRLIDERGADYIQVDQTESMD 754

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  L+ +V+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +
Sbjct: 755 WQALRSQVQQNGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPY 814

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK+R LWD  M++DLKY+DGS+  I+RIP D+K I++TAFE++P WL+++ASRRQK
Sbjct: 815 LVRDLKERGLWDGVMVNDLKYYDGSVQAIDRIPADIKGIYSTAFEVEPRWLVDAASRRQK 874

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY++  +GKKLD  YR AW  GLKTTYYLRS +AT  EKST+    G LNA
Sbjct: 875 WIDQAQSLNLYINNANGKKLDITYRMAWYSGLKTTYYLRSLAATGTEKSTID--TGTLNA 932

Query: 926 VPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           V     N +     +P +C+  D +CE CQ
Sbjct: 933 V----SNEAAGPAPVPQACSLDDPDCEACQ 958


>gi|88705572|ref|ZP_01103282.1| ribonucleoside-diphosphate reductase, alpha subunit [Congregibacter
           litoralis KT71]
 gi|88700085|gb|EAQ97194.1| ribonucleoside-diphosphate reductase, alpha subunit [Congregibacter
           litoralis KT71]
          Length = 969

 Score = 1162 bits (3006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/930 (60%), Positives = 699/930 (75%), Gaps = 10/930 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  F+ SKIS AI KAF+AVEG  A+ S R+ + +  LTE       +   
Sbjct: 46  LRVIKRNGTVVPFEASKISVAITKAFLAVEGGTAAASSRIHETVAKLTEMVTATFKRRMP 105

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA-QSHSKSDAPIAPKLKI 147
           S   +HIED+QDQVE SLM++G HKI R+YV+YRE+++  RAA QS S      A ++ +
Sbjct: 106 SGGTIHIEDVQDQVELSLMRAGEHKIARDYVIYREQQASKRAARQSLSAETQEAADRINV 165

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +  DG+    + +RL +IV EAC+GL DVS   +L E  +N+YDG+S  +L T+L+ ++R
Sbjct: 166 VQLDGSKAPLDLERLHIIVSEACAGLDDVSETRILDEALRNLYDGVSMQELSTSLVITAR 225

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIE+EPNY   +AR L + LR E L+ +      AT  +M  LY +    YI  GV+  
Sbjct: 226 TLIEQEPNYTYASARLLCDNLRTEALSFL-GVADSATQGDMDRLYAKALPAYIARGVELE 284

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL  ++ ++DL  +   +  ERD  F YLGLQ LYDRYF+H +  R E+PQ FFMRVAMG
Sbjct: 285 LLDPTLAEYDLERMGKAILPERDLQFTYLGLQTLYDRYFIHSDEVRFELPQIFFMRVAMG 344

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++ET++E RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA+
Sbjct: 345 LAVEETDREARAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGAI 404

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 405 QDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 464

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC+YLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP++V
Sbjct: 465 VCSYLETWHMDIEEFVELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGDWTLFSPNDV 524

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYGK FE  Y  YE  A  GE+K  + + A  LWRKML MLFETGHPW+TFKDPC
Sbjct: 525 PDLHDLYGKAFEERYCAYEAMAATGELKYSKTVKAQNLWRKMLGMLFETGHPWMTFKDPC 584

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL  H   N  + +KLA T+RT
Sbjct: 585 NLRSPQQHAGVVHSSNLCTEITLNTSADEIAVCNLGSINLPQHVDENGLNLEKLAETVRT 644

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN ++++ A+ SN  HR +GLGLMGFQ AL+  HI Y S +AV  AD SM
Sbjct: 645 AVRMLDNVIDINYYSVDTARNSNFRHRPVGLGLMGFQDALYKQHIAYGSEDAVTFADRSM 704

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLP 745
           E IS++AI AS +LA+ERGAY S++GSLW QG+ PIDS+G L E R  D + ++ +  + 
Sbjct: 705 EAISYYAIDASSKLAEERGAYESYEGSLWSQGILPIDSLGKLVEERGSDYIKVDDSMTMD 764

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  L++ VK  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN +
Sbjct: 765 WTSLREAVKARGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPY 824

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LVN+LK R LWD  M++DLKY+DGS+  IERIP DL+ I++ AFE++P W++E ASRRQK
Sbjct: 825 LVNDLKVRGLWDSVMVNDLKYYDGSVQAIERIPADLRAIYSNAFEVEPRWIVECASRRQK 884

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY++  SGKKLD  YR AW  GLKTTYYLRS +AT  EKST+    G+LNA
Sbjct: 885 WIDQAQSLNLYINNASGKKLDITYRMAWYSGLKTTYYLRSLAATGTEKSTID--TGQLNA 942

Query: 926 VPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           V      S+     +P +C+  D +CE CQ
Sbjct: 943 V---SSESAPAPAPVPMACSLDDPDCEACQ 969


>gi|224825452|ref|ZP_03698557.1| ribonucleoside-diphosphate reductase, alpha subunit [Lutiella
           nitroferrum 2002]
 gi|224602373|gb|EEG08551.1| ribonucleoside-diphosphate reductase, alpha subunit [Lutiella
           nitroferrum 2002]
          Length = 949

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/934 (59%), Positives = 698/934 (74%), Gaps = 21/934 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           + I+RNG V  F+P KIS A+ KAF+A+ G   + S  ++D +  LTE  V+ L++    
Sbjct: 28  KTIRRNGAVVPFEPVKISIAMTKAFLAIMGHQGATSASIRDKVAQLTEMVVSALMRRKPE 87

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              +HIEDIQDQVE SLM++G H + R YVLYREERS  RAA+  + +   I     ++ 
Sbjct: 88  GGAIHIEDIQDQVELSLMRAGEHDVARAYVLYREERSRERAARGEALTQITI----NVVR 143

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            +G  +  +  +L   +E AC GL +     +L+ET KN+YDG+SE ++  + I ++R +
Sbjct: 144 KNGAKLPLDIAKLRATIESACVGLAETDVDAILTETLKNIYDGVSEEEVNKSAILAARAM 203

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE++P Y  VTAR LL  +R E+L       +  +  EM   Y  YF + I++G+ A LL
Sbjct: 204 IEQDPAYDYVTARLLLNNIRLEILG------EAVSQEEMGECYVSYFPQAIKKGIAAELL 257

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
            E + ++DL  L   L   RD  F YLGLQ LYDRYFLH+NG+RIEMPQAF+MRVAMGLA
Sbjct: 258 DERLGEYDLKKLGAALDASRDLQFGYLGLQTLYDRYFLHVNGTRIEMPQAFYMRVAMGLA 317

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L E E+E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTT+ DDL GI+  ++E
Sbjct: 318 LNEVEREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTIADDLDGIYEGIKE 377

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWTPVR +G+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVC
Sbjct: 378 NALLSKFAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVC 437

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV   A WTL SP E  D
Sbjct: 438 AYLETWHLDIEEFVELRKNTGDDRRRTHDMNTANWIPDLFMKRVMDGAEWTLLSPSECPD 497

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDL G  FE  Y+ YE  A RGEIKV ++I A++LWRKMLTMLFETGHPWITFKDPCNI
Sbjct: 498 LHDLVGAAFEKRYQEYEAMAARGEIKVSKRIPALSLWRKMLTMLFETGHPWITFKDPCNI 557

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQFDYDKLASTIRTA 628
           RSPQ H+GVVHSSNLCTEITLN++ +E AVCNLGS+NL  H  A+   D  KL  TIR A
Sbjct: 558 RSPQGHMGVVHSSNLCTEITLNTNDDEIAVCNLGSVNLARHMQADGTLDGAKLQRTIRIA 617

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH+  IPYAS EAVE ADESME
Sbjct: 618 MRMLDNVIDINFYPVKKARNSNLKHRPVGMGIMGFQDCLHMKRIPYASQEAVEFADESME 677

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            +++HA  AS ELAQERG Y S+KGSLWD+GV P DSI LLA  R   L ++RT RL W+
Sbjct: 678 LVAYHAYWASSELAQERGRYPSYKGSLWDRGVLPHDSINLLAAERGGYLDVDRTERLDWN 737

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
           +L++R+K  GMRNSNC+AIAPTATIANI GVS SI+P+YQNL+VKSN+SG+FTV N  LV
Sbjct: 738 KLRERIKEHGMRNSNCLAIAPTATIANIIGVSASIEPTYQNLFVKSNLSGEFTVTNEHLV 797

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK+  LWDE M+SDLKY DGS+G I+RIP +LK I+ATAFE+DP WL+++ASRRQKWI
Sbjct: 798 RDLKKLGLWDEVMVSDLKYFDGSLGRIDRIPAELKAIYATAFEMDPKWLVDAASRRQKWI 857

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY+   SGKKLD +Y+ AW+ GLKTTYYLR+ +ATS EKST +G  G+LNAV 
Sbjct: 858 DQAQSLNLYMAGASGKKLDELYKYAWVRGLKTTYYLRTLAATSAEKSTGRG--GELNAVS 915

Query: 928 VTDP--NSSTHSLGIPSS----CTSDT-ECEVCQ 954
            T P  +++      P++    C+ D  +CE CQ
Sbjct: 916 ATTPAVSAAPEVDNTPATDAKFCSIDNPDCEACQ 949


>gi|167035229|ref|YP_001670460.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida GB-1]
 gi|166861717|gb|ABZ00125.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida GB-1]
          Length = 959

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/948 (58%), Positives = 706/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANTDAVVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+ +G++  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVAKGIEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNLKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
            Y S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 AYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVDLNETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLG---IPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     ++   + G   +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPVQAAGPAPVPKACAIDEPDCEACQ 959


>gi|148359318|ref|YP_001250525.1| ribonucleoside-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Corby]
 gi|148281091|gb|ABQ55179.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           pneumophila str. Corby]
          Length = 917

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/928 (60%), Positives = 698/928 (75%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 2   LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 61

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K     +  L I 
Sbjct: 62  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKD-SKHLLIT 120

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 121 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 180

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K + AT  EM  +YP YF  YIE+G+   +
Sbjct: 181 LVEKEPNYTYVSARLLLDSLRSEALTKLNIKSE-ATFDEMAQIYPVYFKSYIEQGIAQGM 239

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 240 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 299

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 300 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 359

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 360 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 419

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 420 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 479

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 480 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 539

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 540 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 599

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 600 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 659

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R++ L  +R+ +L W+
Sbjct: 660 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 719

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 720 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 779

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIPD+LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 780 ADLKALNLWDEVMVNDLKYFNGSVQPISRIPDELKRRYATSFEIDPMWLVEAASRRQKWI 839

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 840 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 897

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           + D          P +C+ +D +CE CQ
Sbjct: 898 LIDTE--------PKACSITDPDCEACQ 917


>gi|90022103|ref|YP_527930.1| ribonucleotide-diphosphate reductase subunit alpha [Saccharophagus
           degradans 2-40]
 gi|89951703|gb|ABD81718.1| ribonucleoside-diphosphate reductase class Ia alpha subunit
           [Saccharophagus degradans 2-40]
          Length = 969

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/938 (59%), Positives = 713/938 (76%), Gaps = 15/938 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KIS A+ KAF+AVEG  A+ S R+ + ++ LT Q      +   
Sbjct: 35  LRVIKRNGTVVPYTDDKISVAMTKAFLAVEGGTAAASRRIHETVEGLTAQISATFKRRMP 94

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKI 147
           S   +HIE+IQDQVE +LM++G HK+ R+YV+YR +R++ R  A +    +    P++ +
Sbjct: 95  SGGTIHIEEIQDQVELTLMRAGEHKVARDYVIYRAKRAEQRTPAVNVEDVNFSDFPEINV 154

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +  +G     +  R++ +V EAC+GL+DV +  +L E  +++YDG+S +DL TAL+ S+R
Sbjct: 155 VDHNGDRHPLDIDRIKTVVAEACAGLKDVDADAILKEAMRSLYDGVSLTDLNTALVISAR 214

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TL+EKEPNY   T+R L++KLR E L+ +    ++AT  EM+ LY +    YIE+G++  
Sbjct: 215 TLVEKEPNYTYATSRLLMDKLRAEALSFL-GIAEEATQAEMETLYAKTLPAYIEKGIELD 273

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           L+   +  +DL  L N L  ERD  F YLGLQ LYDRYFLH N  RIE+PQ FFMRVAMG
Sbjct: 274 LISPDLASYDLNMLGNALIAERDLQFTYLGLQTLYDRYFLHSNDVRIELPQIFFMRVAMG 333

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA  E  K +RAVEFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA+
Sbjct: 334 LAANEENKNERAVEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGAM 393

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           Q+NAML+K++GGLGNDWTPVRGLGA+I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA
Sbjct: 394 QDNAMLSKWAGGLGNDWTPVRGLGAYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGA 453

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +   WTLFSP++V
Sbjct: 454 VCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFEEKEWTLFSPNDV 513

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL+G+ FE  YE YERQA  G+I+V +K+ A+ LWRKML MLFETGHPWITFKD C
Sbjct: 514 PDLHDLFGRAFEDRYEEYERQAAAGKIRVHKKVRALDLWRKMLGMLFETGHPWITFKDAC 573

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNS-SSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           N+RSPQQH GVVHSSNLCTEITLN+ ++EE AVCNLGSINL  H  + + D +KLA T++
Sbjct: 574 NLRSPQQHAGVVHSSNLCTEITLNTKANEEIAVCNLGSINLAQHIVDGKLDEEKLAQTVK 633

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TAVR+LDNVIDIN + +E A+ SN  HR +GLGLMGFQ AL+ ++I Y+S +AV  AD S
Sbjct: 634 TAVRMLDNVIDINYYAVESARTSNMRHRPVGLGLMGFQDALYKMNISYSSDDAVTFADRS 693

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME IS+HAI AS ELA+ERG+YS+F GSLW +G+ P+DS+ LL E R E  + ++++S  
Sbjct: 694 MEAISYHAIKASSELAKERGSYSTFDGSLWSKGILPLDSLDLLIENRGEKFIKVDKSSTH 753

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L++ VKT GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN 
Sbjct: 754 DWDTLRETVKTQGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNP 813

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV++LK+R LWD  M++DLKY++GS+  I+RIP+DLK +++TAFE++P W++E+ASRRQ
Sbjct: 814 YLVHDLKERGLWDSVMVNDLKYYEGSLQKIDRIPEDLKALYSTAFEVEPRWIVEAASRRQ 873

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLNLY+   +GKKLD  YR AW  GLKTTYYLR+ SAT+ EKST+    G LN
Sbjct: 874 KWIDQAQSLNLYIAGANGKKLDITYRMAWYSGLKTTYYLRALSATTTEKSTV--TSGTLN 931

Query: 925 AV-------PVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           AV             +      +P +C+  D +CE CQ
Sbjct: 932 AVSSGGGASQSAAAAAEPAPAAVPLACSLDDPDCEACQ 969


>gi|34497742|ref|NP_901957.1| ribonucleotide-diphosphate reductase subunit alpha [Chromobacterium
           violaceum ATCC 12472]
 gi|34103598|gb|AAQ59959.1| ribonucleoside-diphosphate reductase system [Chromobacterium
           violaceum ATCC 12472]
          Length = 972

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/935 (59%), Positives = 698/935 (74%), Gaps = 24/935 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           + I+RNG V  F+P KIS A+ KAF+AV G   + S  ++D +  LTEQ V  L++    
Sbjct: 52  KTIRRNGAVVPFEPVKISIAMTKAFLAVMGNQGATSASIRDKVAQLTEQVVNALMRRKPE 111

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              +HIEDIQDQVE SLM+ G H + R YVLYRE+RS  RAA    + +A  + ++ ++ 
Sbjct: 112 GGAIHIEDIQDQVELSLMRFGEHDVARAYVLYREQRSQERAA----RGEALTSVQINVLR 167

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG  +  +  RL   +E A   L  +    +L+ET KN+YDG+ E ++  + I ++R++
Sbjct: 168 KDGRKLPLDVPRLRASIEAASKNLAGIDVDAILAETLKNIYDGVPEEEVGKSAILAARSM 227

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE++P Y  VTAR L+  +R E+L       +  +  EM   Y  YF  YI++G+ A LL
Sbjct: 228 IEQDPAYDYVTARLLMGNIRLEILG------EAVSQDEMGKQYAPYFADYIKKGIAAELL 281

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
            E + ++DL  L   L  ERD  F YLGLQ LYDRYFLH++G+RIEMPQAF+MRVAMGLA
Sbjct: 282 DEKLAEYDLKKLGAALDAERDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFYMRVAMGLA 341

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L E  +E RA+EFY +LSSF FM STPTLFNSGTR  QLSSC+LTT+ DDL GI+  ++E
Sbjct: 342 LNEVNREDRAIEFYKVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTIADDLDGIYEGIKE 401

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWTPVR +G+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVC
Sbjct: 402 NALLSKFAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVC 461

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   W+LFSP E  D
Sbjct: 462 AYLETWHADIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWSLFSPSETPD 521

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDLYG+ FE AY  YE +  RGE+KV+++I A++LWRKMLTMLFETGHPW+TFKDPCNI
Sbjct: 522 LHDLYGQAFEKAYTAYEARGARGELKVYKRIPALSLWRKMLTMLFETGHPWVTFKDPCNI 581

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA-NNQFDYDKLASTIRTA 628
           RSPQQH+GVVHSSNLCTEITLN++ +E AVCNLGS+NL AH   +   D DKL  TIRTA
Sbjct: 582 RSPQQHMGVVHSSNLCTEITLNTNDDEIAVCNLGSVNLSAHLKEDGSLDADKLQRTIRTA 641

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH+  +PY S  AVE ADESME
Sbjct: 642 LRMLDNVIDINFYPVKKARNSNLKHRPVGMGIMGFQDCLHIKRVPYGSNAAVEFADESME 701

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            +++ A  AS ELA+ERG Y S+ GSLWD+GV P DSI LLA  R   L ++RT R+ W+
Sbjct: 702 MVAYFAYLASTELAEERGRYPSYSGSLWDRGVLPHDSINLLAAERGGYLEVDRTERMDWN 761

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
           +L++R+K  GMRNSNC+AIAPTATIANI GVS SI+P+YQNL+VKSN+SG+FTV N +LV
Sbjct: 762 KLRERIKQHGMRNSNCLAIAPTATIANIIGVSASIEPTYQNLFVKSNLSGEFTVTNEYLV 821

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK   LWDE M++DLKY DGS+G I+R+P +LK I+ATAFE+DP WL+E+ASRRQKWI
Sbjct: 822 RDLKAAGLWDEVMVADLKYFDGSLGQIDRVPAELKAIYATAFEVDPKWLVEAASRRQKWI 881

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY+   SGKKLD +Y+ AWL GLKTTYYLR+ +ATS EKST +G  G+LNAV 
Sbjct: 882 DQAQSLNLYMAGASGKKLDELYKHAWLRGLKTTYYLRTLAATSAEKSTGRG--GELNAVS 939

Query: 928 V---TDPNSSTHSLGIPSS----CTSDT-ECEVCQ 954
               T P ++  +   P++    C+ D  +CE CQ
Sbjct: 940 SQAQTAPAAAVDN--TPATDAKFCSIDNPDCESCQ 972


>gi|255019899|ref|ZP_05291974.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970679|gb|EET28166.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 945

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/945 (60%), Positives = 700/945 (74%), Gaps = 42/945 (4%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V  FD SKI  A+ KAF+AV+G   + S RV+D++  LT Q V  L +    
Sbjct: 23  RVIRRNGSVVPFDASKIQVAMTKAFLAVDGGTGAASARVRDLVGRLTAQVVETLERRQPG 82

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              +HIEDIQDQVE +LM++G H++ R YVLYREER+  RA Q    S A  AP L++  
Sbjct: 83  GGTLHIEDIQDQVELALMRAGEHEVARAYVLYREERARERA-QKREASPAS-APILRVRH 140

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
            DG+    + +RL  ++ EACSGL + VS   +L  T +N+YDG+SE +L  A I + R 
Sbjct: 141 ADGSEQPLDLERLRQVIGEACSGLGEAVSVDAILQATQRNLYDGISEEELFQAPILACRV 200

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIE++P YA  TAR LL+++RREVL       + ATH EM   YPEYF  Y+  G++  L
Sbjct: 201 LIEQDPAYAHATARLLLDRVRREVLG------EPATHAEMAQRYPEYFKDYLRTGIQHEL 254

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  +A  L+ ERD  F+YLGLQILYDRYFLH+   RIE+PQAF+MRVAMGL
Sbjct: 255 LDPRLAQFDLDRIAAALRPERDLDFQYLGLQILYDRYFLHVRERRIELPQAFWMRVAMGL 314

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E ++E++A+ FY +LS F F+ STPTLFN+GT  PQLSSCFLTTV DDL GI+ A++
Sbjct: 315 ALEEIDREEQAIAFYEVLSRFEFVSSTPTLFNAGTLRPQLSSCFLTTVADDLDGIYEAIK 374

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KYSGGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 375 DNALLSKYSGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 434

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV  N  WTLFSP+EV+
Sbjct: 435 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMERVEANGQWTLFSPNEVA 494

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G+ F+  YE+YER AD GEI +F+++ A+ LWRKMLTMLFETGHPWITFKDPCN
Sbjct: 495 DLHDLTGQAFKERYEHYERLADAGEITLFKRLPALQLWRKMLTMLFETGHPWITFKDPCN 554

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-------------- 614
           +RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL+AH                  
Sbjct: 555 LRSPQQHVGVVHSSNLCTEITLNTSDKEIAVCNLGSVNLVAHLRAGLPGQGLRTEASADE 614

Query: 615 ---QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
                D DKLA T+R A+R+LDNVID+N + + KA+ SN  HR +GLGLMGF  AL  L 
Sbjct: 615 LLALVDTDKLARTVRVAMRMLDNVIDMNYYAVAKARNSNLRHRPVGLGLMGFSDALLALR 674

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           IPYAS  AVE AD S E IS+HAI AS +LA+ERG+Y SF GSLW QG+ P+DSI LLA 
Sbjct: 675 IPYASQAAVEFADISQELISYHAIDASADLARERGSYRSFPGSLWSQGILPLDSIELLAR 734

Query: 732 VR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   + ++R+ RL W+ L+ +VK  GMRNSNC+AIAPTATI+NI GVSQ I+P YQNLY
Sbjct: 735 SRVAGVDVDRSQRLDWESLRTKVKG-GMRNSNCLAIAPTATISNIVGVSQGIEPIYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTVVN++LV +LK  DLWDE M++DLKY DGS+  I+RIP+ LK ++A AFE
Sbjct: 794 VKSNLSGEFTVVNAYLVRDLKAADLWDEVMVNDLKYFDGSVVPIDRIPEALKPLYANAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           IDP WL+E+A+RRQKW+DQ+QSLNLY  +PSGKK+D  YR AW  GLKTTYYLRS  AT+
Sbjct: 854 IDPQWLVEAAARRQKWLDQSQSLNLYFGQPSGKKIDETYRLAWRRGLKTTYYLRSLGATA 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
            EKST+    G LNAVP           G   +C   D  CE CQ
Sbjct: 914 AEKSTVS--KGVLNAVP-----------GQVKACAIEDPGCEACQ 945


>gi|295677727|ref|YP_003606251.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1002]
 gi|295437570|gb|ADG16740.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1002]
          Length = 1003

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/904 (61%), Positives = 686/904 (75%), Gaps = 18/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGTVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRSLLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  RA   H+  DA   P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRNQARAHDDHA--DAASTPGLNVT- 155

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E AC+ L D VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 156 DNGITRPLDMAALRGIIESACANLGDAVSAEPIVAETVKNLYDGVPMSQVYDSAILAART 215

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 216 MIEKDPAYSQVTARILLHTIRREILE------EEVTQAEMGERYAEYFPQFIKRGVQAEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +  RIEMPQAFFMRVAMGL
Sbjct: 270 LDDKLLQFDLKRLGAALDANRDLQFGYLGLQTLYDRYFLHHDNVRIEMPQAFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 330 SLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 450 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 509

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 510 DLHDKFGAEFETAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 569

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 570 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTVALDHDKLKR 629

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LH+L  PYASPEAVE A
Sbjct: 630 TISVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHVLRTPYASPEAVEFA 689

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 690 DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDSVALLAEARGGYVEVDSSE 749

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 750 SMDWPALRSRIATYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 809

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP+WL+ESASR
Sbjct: 810 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPVWLVESASR 869

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 870 RQKWIDQAQSLNIYMAGASGKKLDEIYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 927

Query: 923 LNAV 926
           LNAV
Sbjct: 928 LNAV 931


>gi|54297687|ref|YP_124056.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Paris]
 gi|53751472|emb|CAH12890.1| hypothetical protein lpp1738 [Legionella pneumophila str. Paris]
          Length = 942

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/928 (60%), Positives = 698/928 (75%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K     +  L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKD-SKHLLIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K + AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIKSE-ATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMADFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + ISAV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTISAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGS+NL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSVNLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 VRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R++ L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIP++LK+ +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKTLNLWDEVMVNDLKYFNGSVQPISRIPEELKRRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           + D          P +C+ +D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|253998798|ref|YP_003050861.1| ribonucleoside-diphosphate reductase subunit alpha [Methylovorus
           sp. SIP3-4]
 gi|253985477|gb|ACT50334.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylovorus
           sp. SIP3-4]
          Length = 937

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/940 (60%), Positives = 705/940 (75%), Gaps = 28/940 (2%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
           +  +QVI+R+G    F   KIS A+ KAF+AV G+ ++ S  ++  ++ LT+  V  L++
Sbjct: 15  LPSLQVIRRDGAAVPFAADKISIALTKAFLAVAGEHSTISSHMRTEVQALTDTVVAALVR 74

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
              +   +HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ          P L
Sbjct: 75  RKPAGGSIHIEDIQDQVELALMRSGEHDVARAYVLYREKRAAERAAQQAPA------PTL 128

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIF 204
            ++ D G  +  + + L  +V EAC  L D V   +++ +  +++YDG+   ++  ALI 
Sbjct: 129 HVLQD-GKRVPLDQQLLLSMVTEACVNLGDAVQPAVIVEQAIRDLYDGMPFDEVRRALIL 187

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           S+R+LIE+EP Y  VTAR  L+ +R EVL       +  +H  M   Y EYF +YI+ G+
Sbjct: 188 SARSLIEREPAYNYVTARLQLDLVRAEVLG------EAVSHTAMAQRYAEYFPQYIKTGI 241

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
            A LL E +  FDL  LA+ L  +RD  F YLGLQ LYDRYFLHI   RIE+PQ FFMRV
Sbjct: 242 AAELLDERLAQFDLSRLASVLVADRDLQFGYLGLQTLYDRYFLHIEERRIELPQVFFMRV 301

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLA+ E ++E RA+EFY++LSSF FM STPTLFNSGTRH QLSSC+LTTV DDL GI+
Sbjct: 302 AMGLAINEIDRESRAIEFYHVLSSFDFMSSTPTLFNSGTRHSQLSSCYLTTVSDDLDGIY 361

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            A++ENA+L K++GGLGNDWTPVR LG+ I GTNGKSQGVIPFLKV NDTAVAVNQGGKR
Sbjct: 362 QAIKENALLQKFAGGLGNDWTPVRALGSRIKGTNGKSQGVIPFLKVVNDTAVAVNQGGKR 421

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVC YLE+WH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV  NA WTLFSP
Sbjct: 422 KGAVCGYLESWHLDLEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVQANADWTLFSP 481

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +V DLHDLYGK FE AY NYER+AD GEIK+F+++ AV LWRKML+MLFETGHPWITFK
Sbjct: 482 SDVPDLHDLYGKAFETAYTNYERRADHGEIKLFKRVPAVQLWRKMLSMLFETGHPWITFK 541

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ----FDYDK 620
           DPCNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH          D  K
Sbjct: 542 DPCNIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLMAHLKREGDSYVLDQAK 601

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           LA+TIR A+R+LDNV+DIN + + KA+ SN+ HR +GLG+MGFQ ALH + +PYAS  AV
Sbjct: 602 LAATIRVAMRMLDNVVDINFYAVGKARNSNYRHRPVGLGIMGFQDALHAMRVPYASSAAV 661

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMN 739
           E AD +ME + ++A  AS  LA+ERGAYSSF+GSLWDQG+ P+D++ LL+E R  ++ ++
Sbjct: 662 EFADRAMEAVCYNAYLASSYLAEERGAYSSFRGSLWDQGILPLDTLNLLSEARGGQVEVD 721

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
           R+S L WD L++R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG+F
Sbjct: 722 RSSTLDWDSLRQRIQRVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSGEF 781

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN  LV +LK R LWDE MI+D+KY+DGS+  IER+P DLK+++ATAFE+DP+WL+E+
Sbjct: 782 TVVNEQLVQDLKARGLWDEVMIADIKYYDGSLAAIERVPADLKQLYATAFEVDPVWLVEA 841

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           A+RRQKWIDQAQSLNLY   PSGKKL+ +Y  AWL GLKTTYYLRS  ATS EKST +G 
Sbjct: 842 AARRQKWIDQAQSLNLYFAAPSGKKLNDVYLLAWLRGLKTTYYLRSLGATSAEKSTGQG- 900

Query: 920 DGKLNAV----PVTDPNSSTHSLGIPSSC-TSDTECEVCQ 954
            G+LNAV    PV+  + S      P  C   D  CE CQ
Sbjct: 901 -GELNAVSSGLPVSAASPSAEPE--PKQCLIDDPGCEACQ 937


>gi|256377254|ref|YP_003100914.1| ribonucleoside-diphosphate reductase, alpha subunit [Actinosynnema
           mirum DSM 43827]
 gi|255921557|gb|ACU37068.1| ribonucleoside-diphosphate reductase, alpha subunit [Actinosynnema
           mirum DSM 43827]
          Length = 950

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/958 (59%), Positives = 713/958 (74%), Gaps = 26/958 (2%)

Query: 15  FPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKN 74
            P+   P       V+V++R+G V++FD +K+S A+ KAF+AVEG GA  S R+  +++ 
Sbjct: 1   MPTTTTPAAVAKAPVRVVRRDGAVSAFDATKVSVAMTKAFLAVEGDGAVASSRLHPLVEE 60

Query: 75  LTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSH 134
           LT Q    LL+H +  + +H+E IQDQVE  LM+ GHH + R YVLYREER+ VRAA + 
Sbjct: 61  LTGQVEAALLKHVRPDVALHVEQIQDQVELVLMRGGHHAVARAYVLYREERAKVRAATAS 120

Query: 135 SKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLS 194
           + +       +++   DG +   +  R+  +V EAC+GL DVS+  VL+ET +N+YDG++
Sbjct: 121 APAP-----TIRVTHPDGQVTPLDWDRVAAVVAEACAGLTDVSADTVLAETRRNLYDGIT 175

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
             +L TA I ++RTL+E EP+Y+  +AR LL+KLRRE L+ V  +P +AT  +M   Y +
Sbjct: 176 VDELATAQIMAARTLVETEPDYSFASARLLLDKLRREALSHVAGEPVEATGEQMS--YVD 233

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF  Y+E GV    L   +  FDL  LA  ++ ERD AF++LG+Q LYDRYFLH +G R 
Sbjct: 234 YFPAYVELGVSVDRLDPELRTFDLPRLAAAIRPERDLAFDFLGMQTLYDRYFLHDDGVRY 293

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           E+PQAFFMRVAMGLAL+E ++E RA+EFY LLSSF FMCSTPTLFNSGT  PQLSSCFLT
Sbjct: 294 ELPQAFFMRVAMGLALREDDREARAIEFYGLLSSFDFMCSTPTLFNSGTTRPQLSSCFLT 353

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TV DDL  IF   + NA+LAKYSGGLGNDWTPVRG+GAHI GTNG+SQGV+PFLK+ANDT
Sbjct: 354 TVDDDLDAIFRGYRNNALLAKYSGGLGNDWTPVRGMGAHIKGTNGQSQGVVPFLKIANDT 413

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           AVAVNQGGKRKGA CAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PD F++RV 
Sbjct: 414 AVAVNQGGKRKGAACAYLETWHVDVEEFLELRKNTGDDRRRTHDMNTANWVPDEFLRRVE 473

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
            +A WTLFSPDE  DLH+LYG  F   Y  YE  ADRGEI+V R++ AV LWR+MLT+LF
Sbjct: 474 ADAEWTLFSPDETPDLHELYGTAFAQRYRAYEEAADRGEIRVHRRVRAVDLWRRMLTVLF 533

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
           ETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL  H    
Sbjct: 534 ETGHPWITFKDPCNVRSPQQHAGVVHSSNLCTEITLNTSADEVAVCNLGSINLANHVTPT 593

Query: 615 QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPY 674
             D D+LA T RTAVR+LDNVIDIN +TI +A++SN  HR +GLGLMGF  +L +  IPY
Sbjct: 594 GLDRDRLARTTRTAVRMLDNVIDINFYTIPEARRSNLRHRPVGLGLMGFADSLFVQRIPY 653

Query: 675 ASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR- 733
           AS EAVE AD SME ISFHA+ AS +LA ERG+Y SF+GSLW +GV PIDSI LLA+ R 
Sbjct: 654 ASSEAVEFADLSMELISFHALDASADLAAERGSYESFEGSLWSRGVLPIDSIALLADARG 713

Query: 734 DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             L M+ +S L W  ++ + +  GMRNSN MAIAPTATI+NICGV QSI+P Y+NL+VK+
Sbjct: 714 GALDMDTSSTLDWSSVRDKARR-GMRNSNVMAIAPTATISNICGVGQSIEPLYRNLFVKA 772

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           NMSGDFTV+N  LV +LK R LWD AM+SDLKY DG++  ++R+P +LK ++ATAFE+  
Sbjct: 773 NMSGDFTVLNRHLVADLKARGLWDAAMVSDLKYFDGALTAVDRVPAELKALYATAFELSS 832

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+ASRRQKWIDQAQSLNLYL  PSG+ LD +YR AW  GLKTTYYLRS SAT VEK
Sbjct: 833 DWLVEAASRRQKWIDQAQSLNLYLAAPSGRALDELYRLAWRKGLKTTYYLRSASATHVEK 892

Query: 914 STLKGVDGKLNAVPV-------------TDPNSSTHSLGIP---SSCT-SDTECEVCQ 954
           STL+G DGKL  V +             +   +    L +P   ++C+ +D +CE CQ
Sbjct: 893 STLRGTDGKLTGVTLPPAAAPAARPAASSPSPAPVPELVLPAEGAACSITDPDCEACQ 950


>gi|152988045|ref|YP_001349578.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PA7]
 gi|150963203|gb|ABR85228.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Pseudomonas aeruginosa PA7]
          Length = 963

 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/952 (58%), Positives = 703/952 (73%), Gaps = 17/952 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSSQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE R+  R   
Sbjct: 76  RRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREARAAERKNA 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
             +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 GATSDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY
Sbjct: 196 VAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALGFL-GVAESATHHEMAELY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDRYFIHKDGI 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQIFFMRVAMGLAIEEKDREARAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  LWRKML+M
Sbjct: 495 VFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLVNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PIDS   L E 
Sbjct: 675 PYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPIDSEKKLIEE 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNS-------STHSLGIPSSCTSDT-ECEVCQ 954
            EKST+    GKLNAV     +              +P +C+ D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSAGGNDGLQAAPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|254784924|ref|YP_003072352.1| ribonucleotide-diphosphate reductase subunit alpha [Teredinibacter
           turnerae T7901]
 gi|237686086|gb|ACR13350.1| ribonucleoside-diphosphate reductase alpha subunit, class I
           [Teredinibacter turnerae T7901]
          Length = 961

 Score = 1158 bits (2995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/958 (59%), Positives = 720/958 (75%), Gaps = 12/958 (1%)

Query: 3   PSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           P+  V + +  +  S+A   P +++   VIKRNG +  +   KI+ A+ KAF+AVEG  A
Sbjct: 10  PTSPVPQANPHSNSSIANAAPGQLR---VIKRNGTLVPYTDDKIAVAMTKAFLAVEGGTA 66

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S R+ + + NLT+Q      +   S   +HIE+IQDQVE +LM++G HK+ R+YVLYR
Sbjct: 67  AASSRIHETVANLTQQISATFKRRMPSGGTIHIEEIQDQVELTLMRTGEHKVARDYVLYR 126

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL 182
            ER+ +RA +          P++ ++  DG+L   +  RL  +V EAC+GL+DV  + +L
Sbjct: 127 AERAKLRAEKEKLSQANVDFPEINVLQPDGSLQPLDVMRLHTVVSEACAGLKDVDGEAIL 186

Query: 183 SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQK 242
            E  +N+Y+G+S  DL T+L+ S+RTL+EKEPNY   TAR L++KLR E L  +    Q 
Sbjct: 187 KEAMRNLYEGVSAEDLNTSLVISARTLVEKEPNYTYATARLLMDKLRAEALAFLDVATQ- 245

Query: 243 ATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILY 302
           AT  EM+  YP     YI  G++  LL  ++ DFDL  L   L  ERD  F YLGLQ LY
Sbjct: 246 ATSAEMEMFYPNALPAYISRGIELELLDPALADFDLQLLGAALIPERDQQFTYLGLQTLY 305

Query: 303 DRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSG 362
           DRYFLH +G+R E+PQ FFMRVAMGLA++E +K  RA+EFY LLSSF +M STPTLFN+G
Sbjct: 306 DRYFLHSDGTRFELPQIFFMRVAMGLAMREDDKNGRAIEFYRLLSSFDYMSSTPTLFNAG 365

Query: 363 TRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQ 422
           T  PQLSSC+LT+VPDDL+GI+GA+Q+NAML+K++GGLGNDWTPVR LG++I GTNGKSQ
Sbjct: 366 TLRPQLSSCYLTSVPDDLHGIYGAIQDNAMLSKWAGGLGNDWTPVRALGSYIKGTNGKSQ 425

Query: 423 GVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTA 482
           GV+PFLKVANDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTA
Sbjct: 426 GVVPFLKVANDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTA 485

Query: 483 NWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISA 542
           NW+PDLFMKRV ++  WTLF+P  V DLHDL+G  FE  YE+YER+A  G IK F+K+ A
Sbjct: 486 NWVPDLFMKRVFEDKEWTLFTPSTVPDLHDLFGLAFEERYEHYEREAAAGNIKPFKKVRA 545

Query: 543 VALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNS-SSEETAVCN 601
           V LWRKML MLFETGHPWITFKD CN+RSPQQH GVVHSSNLCTEITLN+ ++EE AVCN
Sbjct: 546 VDLWRKMLGMLFETGHPWITFKDACNLRSPQQHAGVVHSSNLCTEITLNTKANEEIAVCN 605

Query: 602 LGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLM 661
           LGSINL  H  + + D +KL  ++ TAVR+LDNVIDIN ++++ A+ SN  HR +GLG+M
Sbjct: 606 LGSINLAQHVVDGKLDQEKLQRSVDTAVRMLDNVIDINYYSVDTARNSNLRHRPVGLGIM 665

Query: 662 GFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVF 721
           GFQ AL+ + IPY+S  AVE AD SME +S++AISAS  LA ERG+YS+F+GSLW QGV 
Sbjct: 666 GFQDALYKMRIPYSSAAAVEFADRSMEAVSYYAISASSALASERGSYSTFEGSLWSQGVL 725

Query: 722 PIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
           PIDSI LLA+ R E  +  ++T+ L WD L+  VKT GMRNSN MAIAPTATIANI GVS
Sbjct: 726 PIDSIQLLAKNRGEQFIEQDQTTTLDWDTLRNTVKTQGMRNSNVMAIAPTATIANITGVS 785

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
           QSI+P+YQNLYVKSN+SG+FTVVN +LV++LK R LWD  M++DLKY++GS+  I+RIPD
Sbjct: 786 QSIEPTYQNLYVKSNLSGEFTVVNPYLVHDLKDRGLWDSVMVNDLKYYEGSVFKIDRIPD 845

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           DLK ++ATAFE++P W++++ASRRQKWIDQAQSLNLY+   +GKKLD  YR AW  GLKT
Sbjct: 846 DLKLLYATAFEVEPRWIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYRMAWYRGLKT 905

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDP--NSSTHSLGIPSSCT-SDTECEVCQ 954
           TYYLR+ +AT+ EKST+    G LNAV    P  N S     +P +C+  D +CE CQ
Sbjct: 906 TYYLRALAATTTEKSTID--TGSLNAVSSGAPAANISAGPADVPKACSLDDPDCEACQ 961


>gi|15596353|ref|NP_249847.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PAO1]
 gi|107100606|ref|ZP_01364524.1| hypothetical protein PaerPA_01001631 [Pseudomonas aeruginosa PACS2]
 gi|116049088|ref|YP_792110.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218892880|ref|YP_002441749.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa LESB58]
 gi|254234290|ref|ZP_04927613.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           C3719]
 gi|296390474|ref|ZP_06879949.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           aeruginosa PAb1]
 gi|313106127|ref|ZP_07792382.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           39016]
 gi|9947078|gb|AAG04545.1|AE004545_8 NrdA, catalytic component of class Ia ribonucleotide reductase
           [Pseudomonas aeruginosa PAO1]
 gi|115584309|gb|ABJ10324.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166221|gb|EAZ51732.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           C3719]
 gi|218773108|emb|CAW28920.1| NrdA, catalytic component of class Ia ribonucleotide reductase
           [Pseudomonas aeruginosa LESB58]
 gi|310878884|gb|EFQ37478.1| ribonucleoside reductase, large chain [Pseudomonas aeruginosa
           39016]
          Length = 963

 Score = 1158 bits (2995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/952 (58%), Positives = 703/952 (73%), Gaps = 17/952 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSSQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
           + LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE R+  R   
Sbjct: 76  RRLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREARAAERKNA 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
             +   A   P ++I   DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 GAASDVAQPHPSIRITRADGSLSPLDMGRLNTIISEACEGLAEVDGALIERETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY
Sbjct: 196 VAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALGFL-GVAESATHHEMAELY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    YIE+G +  L+   + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYIEKGAEFELVDAKLKEFDLEKLGKAIDHERDQQFTYLGLQTLYDRYFIHKDGI 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQIFFMRVAMGLAIEEKDREARAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP +V DLHDLYGK FE  YE YE  A  G++K+ + + A  LWRKML+M
Sbjct: 495 VFDDGSWTLFSPSDVPDLHDLYGKAFEERYEYYEALASYGKLKLHKVVQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLVNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLEKTVKTAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  A+  AD+SME IS++AI AS +LA ERGAY +F+GSLW QG+ PIDS   L E 
Sbjct: 675 PYGSDAAIAFADQSMEAISYYAIQASCDLADERGAYQTFQGSLWSQGILPIDSEKKLIEE 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R    + ++ +  L W  L++RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGAKYIEVDLSETLDWAPLRERVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++E+ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETRWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPVTDPNS-------STHSLGIPSSCTSDT-ECEVCQ 954
            EKST+    GKLNAV     +              +P +C+ D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSAGGNDGLQAAPAAEPKPAPVPQACSIDNPDCEACQ 963


>gi|170720378|ref|YP_001748066.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           putida W619]
 gi|169758381|gb|ACA71697.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           putida W619]
          Length = 959

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/948 (58%), Positives = 705/948 (74%), Gaps = 13/948 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR++R+  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDQRAKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           +++ +     P ++I + DG+L   +  RL  I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 ANTDAAVEPHPSIRITLADGSLAPLDMARLNTIISEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY
Sbjct: 196 VAIKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-NVADSATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    YI +GV+  LL+ ++ DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYIAKGVEFELLNPALADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLAL+E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQVFFMRVAMGLALEEKDKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IKVF+ I A  LWRKML+M
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKVFKTIQAKDLWRKMLSM 554

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  
Sbjct: 555 LFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIV 614

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           + + D  KL  T+ TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HI
Sbjct: 615 DGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQARNSNFKHRPVGLGIMGFQDALYLQHI 674

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PY S  AVE AD+SME +S+ AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E 
Sbjct: 675 PYGSDAAVEFADKSMEAVSYFAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEA 734

Query: 733 RDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
           R +  + +N    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLY
Sbjct: 735 RGQKYIDVNLEETLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLY 793

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK ++ATAFE
Sbjct: 794 VKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKDLYATAFE 853

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS
Sbjct: 854 VETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATS 913

Query: 911 VEKSTLKGVDGKLNAVPV---TDPNSSTHSLGIPSSCTSD-TECEVCQ 954
            EKST+    GKLNAV     + P  +     +P +C  D  +CE CQ
Sbjct: 914 TEKSTIN--TGKLNAVSSGGDSAPAQAAGPAPVPKACAIDEPDCEACQ 959


>gi|146308171|ref|YP_001188636.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina ymp]
 gi|145576372|gb|ABP85904.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           mendocina ymp]
          Length = 968

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/917 (60%), Positives = 701/917 (76%), Gaps = 11/917 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSSQDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE +++ R A 
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREAQANKRKAS 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           + S+   P  P ++I   DG+L   +  RL+ I+ EAC GL +V   ++  ET KN+YDG
Sbjct: 136 AGSEIAQP-HPSIRITAADGSLQPLDMGRLQTIIREACEGLAEVDGALIERETLKNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++E D+ TAL+ ++RTL+E+EPNY+ VTAR L++ +R E LT +    Q ATHHEM  LY
Sbjct: 195 VAEKDVNTALVMTARTLVEREPNYSYVTARLLMDNIRAEALTFL-GITQSATHHEMVDLY 253

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+++GV+  LL   + ++DL  L   L +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 254 AKALPAYVDKGVEFELLDPKLKEYDLEKLGKALNHERDQQFTYLGLQTLYDRYFIHKDGI 313

Query: 313 RIEMPQAFFMRVAMGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSC 371
           R E+PQ FFMRVAMGLA++E + +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC
Sbjct: 314 RFELPQVFFMRVAMGLAIEEPKNREDRAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSC 373

Query: 372 FLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVA 431
           +LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV 
Sbjct: 374 YLTTVPDDLSGIYSAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVV 433

Query: 432 NDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMK 491
           NDTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMK
Sbjct: 434 NDTAVAVNQGGKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMK 493

Query: 492 RVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLT 551
           RV ++  WTLFSP EV DLHDL GK FE  YE YE   + G+IK+++ I A  LWRKML+
Sbjct: 494 RVFEDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALIEYGKIKLYKTIQAKDLWRKMLS 553

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS+NL+ H 
Sbjct: 554 MLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSVNLVNHI 613

Query: 612 ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
            + + D +KL  T++TAVR+LDNVIDIN +++ +A+ SN  HR +GLGLMGFQ AL+L H
Sbjct: 614 VDGKLDIEKLGRTVKTAVRMLDNVIDINYYSVPQARNSNLKHRPVGLGLMGFQDALYLQH 673

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           I Y S  A+E AD SME IS++AI AS +LA+ERGAYS+F+GSLW +G+ P+DS  +L E
Sbjct: 674 IAYGSDAAIEFADRSMEAISYYAIQASCDLAEERGAYSTFEGSLWSKGILPLDSQQILIE 733

Query: 732 VRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNL 789
            R +  + ++ +  L W  L++RVK  G+RNSN MAIAPTATI+NI GVSQSI+P+YQNL
Sbjct: 734 ARGQKYIDVDLSESLDWAPLRERVKK-GIRNSNIMAIAPTATISNIIGVSQSIEPTYQNL 792

Query: 790 YVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAF 849
           YVKSN+SG+FTV+N +LV +LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAF
Sbjct: 793 YVKSNLSGEFTVINPYLVRDLKNRGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAF 852

Query: 850 EIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
           E++  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +AT
Sbjct: 853 EVETKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAAT 912

Query: 910 SVEKSTLKGVDGKLNAV 926
           S EKST+    GKLNAV
Sbjct: 913 STEKSTIN--TGKLNAV 927


>gi|54294661|ref|YP_127076.1| ribonucleotide-diphosphate reductase subunit alpha [Legionella
           pneumophila str. Lens]
 gi|53754493|emb|CAH15977.1| hypothetical protein lpl1738 [Legionella pneumophila str. Lens]
          Length = 942

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/928 (60%), Positives = 696/928 (75%), Gaps = 14/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V  +D +KI  AI KAF+A EG  A  S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVIYDDTKIKIAITKAFIADEGGTAPTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM+SGH+K+ R YVLYREER   R ++S  K     +  L I 
Sbjct: 87  SGGAIHIEEIQDQVELALMRSGHYKVARSYVLYREERRKARESESKQKQTKD-SKHLLIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M +G +   +  R+  IV+E+C  L +V ++ V+ +  +N+Y+     D+  ALI S+R 
Sbjct: 146 MPNGEVQPLDMDRVNTIVKESCRDLSNVKAEPVIKDALRNLYNQAKYEDVHKALIMSARA 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E LT +  K + AT  EM  +YP YF  YIE+G+   +
Sbjct: 206 LVEKEPNYTYVSARLLLDSLRSEALTKLNIKSE-ATFDEMAQIYPVYFKSYIEQGIAQGM 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   M DFDL  L+  L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 265 LDPKMTDFDLDKLSQALLPERDMKFTYLSLQTLYDRYFIHERGVRYELPQAFFMRVAMGL 324

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL+E  KE++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 325 ALREQHKEEKAIEFYQLLSSFDYMSSTPTLFNSGTVRPQLSSCYLTTVPDHLDGIYSAIK 384

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +GAHI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 385 DNALLSKYAGGLGNDWTPVRAMGAHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 444

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKRV ++  WTLFSPDEV 
Sbjct: 445 CAYLECWHRDVEEFLELRKNTGDDRRRTHDMNTALWVPDLFMKRVREDGNWTLFSPDEVP 504

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD YGK FE  Y  YE +A +G I+  + I AV LWR+ML+MLFETGHPW+TFKDPCN
Sbjct: 505 DLHDQYGKAFEALYVEYEEKARQGIIRNTKTIPAVKLWRRMLSMLFETGHPWLTFKDPCN 564

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GV+HSSNLCTEITLN+S EE AVCNLGSINL AH  N + D  KL  TI TA
Sbjct: 565 LRSPQQHAGVIHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDEQKLKRTISTA 624

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN +++ +A+ SN  HR IGLG+MGFQ AL+ L + YAS EA+E AD SME
Sbjct: 625 IRMLDNVIDINYYSVPQARNSNLQHRPIGLGIMGFQDALYELKMDYASKEAIEFADSSME 684

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YS+++GSLW +G+ PIDSI LL + R++ L  +R+ +L W+
Sbjct: 685 LISYYAIEASCDLAKERGSYSTYEGSLWSKGILPIDSINLLQQSRNKYLEQDRSQKLDWE 744

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGVSQSI+P+YQNLYVKSN+SG+FTVVN +LV
Sbjct: 745 PLRVKVRTQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLYVKSNLSGEFTVVNPYLV 804

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIP++LK  +AT+FEIDPMWL+E+ASRRQKWI
Sbjct: 805 ADLKTLNLWDEVMVNDLKYFNGSVQPISRIPEELKSRYATSFEIDPMWLVEAASRRQKWI 864

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ +PSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   DG LNAV 
Sbjct: 865 DQAQSLNIYMAQPSGKKLDQLYMHAWIRGLKTTYYLRSLGASNAEKSTV--TDGALNAVK 922

Query: 928 VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           + D          P +C+ +D +CE CQ
Sbjct: 923 LIDTE--------PKACSITDPDCEACQ 942


>gi|307731038|ref|YP_003908262.1| ribonucleoside-diphosphate reductase subunit alpha [Burkholderia
           sp. CCGE1003]
 gi|307585573|gb|ADN58971.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1003]
          Length = 1000

 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/904 (61%), Positives = 686/904 (75%), Gaps = 19/904 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  RA   H +  A   P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARA---HDEQAAGSTPGLSVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E AC+ L D VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVTRPLDMAALRGIIESACANLGDAVSAEPIVAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREIL------EEEVTQAEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDANRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLALDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV+ A
Sbjct: 629 TISVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVKFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDSVKLLAEARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL++R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWSELRQRIATYGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|74317994|ref|YP_315734.1| ribonucleotide-diphosphate reductase subunit alpha [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057489|gb|AAZ97929.1| ribonucleoside-diphosphate reductase alpha chain [Thiobacillus
           denitrificans ATCC 25259]
          Length = 974

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 713/944 (75%), Gaps = 32/944 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F P+KI+ A+ KAF+AV+G  A+ S R++++++ +T Q    LL+ N +
Sbjct: 44  KIIRRNGAVVGFAPNKIAVAVTKAFIAVQGGQAAASARIRELVEAITSQVTAALLRRNPA 103

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIED+QDQVE +LM+SG H++ R YVLYRE+R+  RAAQ      A   P++++ +
Sbjct: 104 GGTFHIEDVQDQVELALMRSGEHEVARAYVLYREKRAQERAAQK-----AAGVPEVQLHV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           ++DG     ++ RL  ++ +ACS L + V ++ ++    +++YDG+  +++E AL+ ++R
Sbjct: 159 IEDGVRKPLDTARLAGLLADACSDLGESVKAEPIMHTVLRDLYDGVPMAEVEKALVLAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           ++IE++P Y+ VTAR LL  +R EVL       +  T  +M   Y EYF  +I++G+ A 
Sbjct: 219 SMIEQDPAYSLVTARLLLNSIRHEVLG------EAVTQAQMSERYAEYFPAFIKKGIAAE 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL E +  FDL  LA  L   RD+ F YLGLQ LYDRYFLHI  +RIE+PQAFFMRVAMG
Sbjct: 273 LLDEKLGQFDLARLARVLDAGRDYQFGYLGLQTLYDRYFLHIEENRIELPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E ++E RA+EFY +LSSF FM STPTLFNSGTRH QLSSC+LTTV DDL GI+ A+
Sbjct: 333 LAINEIDRESRAIEFYQVLSSFDFMSSTPTLFNSGTRHSQLSSCYLTTVTDDLDGIYQAI 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENAML KY+GGLGNDWTPVR +GA I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENAMLQKYAGGLGNDWTPVRAMGARIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP++V
Sbjct: 453 VCAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMQRVMEGGDWTLFSPNDV 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDLYG++F  AY  YER+ADRGE+K++++I A+ LWRKML+MLFETGHPWITFKDPC
Sbjct: 513 PDLHDLYGRKFAEAYTEYERKADRGELKLYKRIPALQLWRKMLSMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+ H  + + D DKL +TI T
Sbjct: 573 NIRSPQQHVGVVHSSNLCTEITLNTNDHEVAVCNLGSVNLVNHLKDGKLDLDKLKNTIHT 632

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNV+D+N + + KA+ SN  HR +GLG+MGFQ AL  L + YAS +AVE AD SM
Sbjct: 633 AMRMLDNVVDVNYYAVGKARNSNLKHRPVGLGIMGFQDALQELRVAYASNDAVEFADRSM 692

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E ++++A  AS ELAQERG YSS++GSLW +G+ P DS  LL E R   L ++ ++ L W
Sbjct: 693 EAVAYYAYWASTELAQERGRYSSYEGSLWSKGILPHDSNRLLLEERGGYLEVDSSATLDW 752

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L++R+   GMRNSNC+AIAPTATIANI GVS SI+P+YQNLYVKSN+SG+FTV N +L
Sbjct: 753 DSLRQRIAQYGMRNSNCLAIAPTATIANIVGVSASIEPTYQNLYVKSNLSGEFTVANKYL 812

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK+  +WDE M++D+KY DGS+  I+RIP +L+ ++ATAFE++P WL+E ASRRQKW
Sbjct: 813 VADLKKLGMWDEVMVADIKYFDGSLARIDRIPAELRALYATAFEMEPSWLVECASRRQKW 872

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLN+Y+   SGKKLD IY+ AWL GLKTTYYLR+  ATS EKST KG  G+LNAV
Sbjct: 873 IDQAQSLNIYMAGASGKKLDDIYKLAWLRGLKTTYYLRTLGATSAEKSTGKG--GELNAV 930

Query: 927 P------VTDPNSSTHSLGIP----SSCTSDT------ECEVCQ 954
                  ++  +++  +L +P      CT         ECE CQ
Sbjct: 931 SAHVGGGMSAMDAAAANLPVPEIEGKVCTMRPGDPGFEECEACQ 974


>gi|253997286|ref|YP_003049350.1| ribonucleoside-diphosphate reductase subunit alpha [Methylotenera
           mobilis JLW8]
 gi|253983965|gb|ACT48823.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylotenera
           mobilis JLW8]
          Length = 938

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/933 (60%), Positives = 699/933 (74%), Gaps = 22/933 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVI+RNG   +F+  KIS AI KAF+AVEG  ++ S RV+D + +L++     L++   
Sbjct: 21  LQVIRRNGAAVTFNLDKISIAITKAFLAVEGNHSAASQRVRDQVTSLSQIVNHALIRRLP 80

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           +   +HIEDIQDQVE +LM++G+H + R YVLYRE+R+  RAA+  + S+   A  + I 
Sbjct: 81  TGGSIHIEDIQDQVELALMRNGNHDVARAYVLYREKRNAERAAEKATTSEPSHALNVNI- 139

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
             DG L+  N K+L  +V EAC  L  +V   +V+ +  +++YDG+  +++  ALI S+R
Sbjct: 140 --DGKLVPLNIKQLNEMVAEACLNLGNEVDVNLVVEQAVRDLYDGIPFTEVYKALILSAR 197

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           +LIE EP Y  VTAR  L+ +R EVL       ++ +H EM   Y EYF RYI+ G+ A 
Sbjct: 198 SLIETEPAYNYVTARLQLDLVRAEVLG------ERVSHAEMDAHYAEYFPRYIKIGIDAD 251

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  LAN L  ERDF F YLG+Q LYDRYFLHI   RIE+PQ FFMRVAMG
Sbjct: 252 LLDPRLAQFDLDKLANALVKERDFQFGYLGIQTLYDRYFLHIEERRIELPQIFFMRVAMG 311

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E ++E RA+EFYN+LS+F FM STPTLFN+GT H QLSSC+LTTV DDL GI+  +
Sbjct: 312 LAINEIDREARAIEFYNVLSTFDFMSSTPTLFNAGTLHSQLSSCYLTTVSDDLDGIYQGI 371

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L KY+GGLGNDWTPVR LGA I GTNGKSQGVIPFLKV NDTAVAVNQGGKRKGA
Sbjct: 372 KENALLQKYAGGLGNDWTPVRSLGARIKGTNGKSQGVIPFLKVVNDTAVAVNQGGKRKGA 431

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC YLETWH+D+EEFLDLRKNTGDDRRRTHDMNTA+WIPDLFM+RVT+   WTLFSP +V
Sbjct: 432 VCGYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTAHWIPDLFMRRVTEQGEWTLFSPSDV 491

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD YGK FE AY  YER+AD GEIK+F+++ A+ +WRKML+MLFETGHPWITFKDPC
Sbjct: 492 PDLHDKYGKAFEKAYVEYERRADTGEIKLFKRVPAIQMWRKMLSMLFETGHPWITFKDPC 551

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF----ANNQFDYDKLAS 623
           NIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NLL H      N + D DKL +
Sbjct: 552 NIRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLLQHLKEVNGNLELDNDKLQA 611

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI+  +R+LDNV+DIN + + KA+ SN  HR +G+G+MGFQ+ LH + IPYAS +AVE A
Sbjct: 612 TIKVGMRMLDNVVDINFYPVGKARNSNTRHRPVGMGIMGFQNCLHAMRIPYASMDAVEFA 671

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL-AEVRDELAMNRTS 742
           D +ME + ++A  AS  LA+ERG YSSFKGSLWDQG+ P+D++ LL AE    + ++R+ 
Sbjct: 672 DRAMEMVCYNAYWASTVLAEERGPYSSFKGSLWDQGILPLDTLNLLEAERGGNVEVDRSK 731

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L WD L+ R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG+FT+V
Sbjct: 732 TLDWDALRNRIQKVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSGEFTIV 791

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N  LVN+LK R LWD  M+SDLKY DGS+  IER+P DLK+++ATAF++DP WLIE+A+R
Sbjct: 792 NEQLVNDLKARGLWDTVMVSDLKYFDGSLAPIERVPADLKQLYATAFDVDPSWLIEAAAR 851

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLNLY   PSGKKL+  Y  AW  GLKTTYYLRS  AT+ EKST  G  G+
Sbjct: 852 RQKWIDQAQSLNLYFAVPSGKKLNDTYLLAWQRGLKTTYYLRSLGATAAEKST--GSGGE 909

Query: 923 LNAVPVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           LNAV       +T     P  C+ D  +CE CQ
Sbjct: 910 LNAVSA----HTTAPEPAPKMCSIDNPDCESCQ 938


>gi|119478321|ref|ZP_01618352.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119448661|gb|EAW29906.1| ribonucleotide-diphosphate reductase alpha subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 962

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/931 (59%), Positives = 701/931 (75%), Gaps = 9/931 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           V+VIKRNG V S+D SKI+ AI KAF+AVEG  A+ S R+ + ++ L+ Q      +   
Sbjct: 36  VRVIKRNGTVVSYDDSKIAVAITKAFLAVEGGSAAASSRIHETVEKLSLQVSAIFKRRMP 95

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIEDIQDQVE +LM+SG HK+ R+YVLYREER   R  +  S+      P +++ 
Sbjct: 96  SGGTIHIEDIQDQVELALMRSGEHKVARDYVLYREERRLQREEKKASEP-TKAHPTIRVT 154

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+ +  +  R+E++V EAC GL DV +++++ E  KN+YDG+  +D+ T+L+ +SRT
Sbjct: 155 LSDGSQVPLDLGRMEVVVSEACDGLADVKAQVIIDEALKNLYDGVPIADVNTSLVITSRT 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY+ VTAR LL+ LR E L  +      AT  EM  LY +    YI +G++  L
Sbjct: 215 LVEKEPNYSYVTARLLLDNLRAEALPFL-GIANSATQSEMASLYAKALPAYINKGIELEL 273

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L  +++D+DL  L   L   RD  F YLGLQ LYDRYF+H N  RIE+PQ FFMRVAMGL
Sbjct: 274 LAPNLLDYDLDKLGQALDANRDQLFNYLGLQTLYDRYFIHSNDIRIELPQIFFMRVAMGL 333

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A +E  +E RA+EFY LLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL+GI+GA+Q
Sbjct: 334 AYREENREDRAIEFYRLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLHGIYGAIQ 393

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LGA+I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 394 DNAMLSKWAGGLGNDWTPVRALGAYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 453

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANW+PDLFMKRV  +  WTLFSP++V 
Sbjct: 454 CAYLETWHMDIEEFVELRKNTGDDRRRTHDMNTANWVPDLFMKRVFDDGEWTLFSPNDVP 513

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG+ FE  Y  YE Q   G++K+F+ + A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 514 DLHDLYGEAFETRYTEYEAQCKSGDMKLFKTVRAQELWRKMLGMLFETGHPWITFKDPCN 573

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           IRSPQQHVGVVHSSNLCTEITLN+S EE AVCNLGS+NL  H + N  D  KL  TI TA
Sbjct: 574 IRSPQQHVGVVHSSNLCTEITLNTSKEEIAVCNLGSVNLAQHVSENGLDLSKLEKTITTA 633

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR +GLGLMGFQ AL+  H+ Y S +AVE AD SME
Sbjct: 634 VRMLDNVIDINYYSVGQAETSNMRHRPVGLGLMGFQDALYNQHMAYGSDQAVEFADRSME 693

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLPW 746
            IS+ AI AS  LA+ERG+YS+F+GSLW QG+ PIDS+  L   R  D + ++++  L W
Sbjct: 694 AISYFAIQASSALAEERGSYSTFEGSLWSQGILPIDSVKTLIAERGNDYIDVDQSQTLDW 753

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             L+ RV+  GMRNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTVVN  L
Sbjct: 754 SSLRTRVQQKGMRNSNVMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVVNPHL 813

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK R LWD  M++DLKY++GS+ NI+R+P ++K+++ATAFE++P W++++ASRRQKW
Sbjct: 814 VKDLKARGLWDNVMVNDLKYYEGSLQNIDRVPVEVKQLYATAFEVEPRWIVDAASRRQKW 873

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +AT  EKST+    G LNAV
Sbjct: 874 IDQAQSLNLYISGASGKKLDITYRMAWYKGLKTTYYLRALAATGTEKSTID--TGSLNAV 931

Query: 927 P--VTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
                 P ++     +P +C+  D +CE CQ
Sbjct: 932 SSKTEAPVAAAGPAPVPEACSLDDPDCEACQ 962


>gi|330811234|ref|YP_004355696.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379342|gb|AEA70692.1| Ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 963

 Score = 1155 bits (2987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/954 (58%), Positives = 710/954 (74%), Gaps = 21/954 (2%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+ P L+   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNPDLSATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA  
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERA-- 133

Query: 133 SHSKSDAPIA--PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMY 190
           + S +DAP+   P ++I   DG+L   +  RL  IV EAC GL++V   ++  ET KN+Y
Sbjct: 134 TRSPADAPVQAHPSIRIARADGSLAPLDMGRLNTIVTEACEGLEEVDGDLIQRETLKNLY 193

Query: 191 DGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQC 250
           DG++  D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L+ + +  + ATHHEM  
Sbjct: 194 DGVALKDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLSFL-EVAESATHHEMVD 252

Query: 251 LYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHIN 310
           LY +    Y+ +G++  LL+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +
Sbjct: 253 LYAKALPAYVAKGIEFELLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKD 312

Query: 311 GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
           G R E+PQ FFMRVAMGLA++E ++E RA+EFYNLLSSF +M STPTLFN+GT  PQLSS
Sbjct: 313 GVRFELPQIFFMRVAMGLAIEEKQREDRAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSS 372

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           C+LTTVPDDL GI+GA+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV
Sbjct: 373 CYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKV 432

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
            NDTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFM
Sbjct: 433 VNDTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFM 492

Query: 491 KRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKML 550
           KRV  +  WTLFSP EV DLHDL GK FE  YE YE   +  +IK+F+ + A  LWRKML
Sbjct: 493 KRVFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYNKIKLFKVVQAKDLWRKML 552

Query: 551 TMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH 610
           +MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H
Sbjct: 553 SMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNH 612

Query: 611 FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
             + + D  KL  T+ TAVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L 
Sbjct: 613 IVDGKLDTAKLQRTVNTAVRMLDNVIDINYYSVPQAKNSNFKHRPVGLGIMGFQDALYLQ 672

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
           HIPY S  AVE AD+SME +S++AI AS +LA ERGAY +F+GSLW QG+ P+DS  +L 
Sbjct: 673 HIPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGAYETFQGSLWSQGILPLDSQQILI 732

Query: 731 EVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
             R +  + ++    L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQN
Sbjct: 733 AQRGQKYIDVDLNESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQN 791

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           LYVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK+++ATA
Sbjct: 792 LYVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKELYATA 851

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FE+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +A
Sbjct: 852 FEVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAA 911

Query: 909 TSVEKSTLKGVDGKLNAVPVTDPNSSTHSL-------GIPSSCTSD-TECEVCQ 954
           TS EKST+    GKLNAV     +     L        +P +C  D  +CE CQ
Sbjct: 912 TSTEKSTIN--TGKLNAVSSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 963


>gi|323527396|ref|YP_004229549.1| ribonucleoside-diphosphate reductase subunit alpha [Burkholderia
           sp. CCGE1001]
 gi|323384398|gb|ADX56489.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. CCGE1001]
          Length = 1006

 Score = 1155 bits (2987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/904 (61%), Positives = 684/904 (75%), Gaps = 19/904 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  R    H +  A   P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARG---HDEQAAASTPGLSVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E AC+ L D VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVTRPLDMAALRGIIESACANLGDAVSAEPIVAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREIL------EEEVTQAEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDANRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLALDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV+ A
Sbjct: 629 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVKFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELAQERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRGILPQDSVKLLAEARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWTELRSRIATYGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|270156778|ref|ZP_06185435.1| ribonucleotide-diphosphate reductase alpha subunit [Legionella
           longbeachae D-4968]
 gi|289164773|ref|YP_003454911.1| ribonucleoside-diphosphate reductase, alpha subunit [Legionella
           longbeachae NSW150]
 gi|269988803|gb|EEZ95057.1| ribonucleotide-diphosphate reductase alpha subunit [Legionella
           longbeachae D-4968]
 gi|288857946|emb|CBJ11806.1| putative ribonucleoside-diphosphate reductase, alpha subunit
           [Legionella longbeachae NSW150]
          Length = 941

 Score = 1154 bits (2985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/928 (60%), Positives = 697/928 (75%), Gaps = 15/928 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++ IKRNG V ++D +KI  AI KAF+A EG  AS S R+   I+ LT Q      +   
Sbjct: 27  LKTIKRNGKVVNYDDTKIKIAITKAFIADEGGTASTSDRIHQQIEELTRQITQVFKRRLP 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   VHIEDIQDQVE +LM+SGH+K+ R YVLYREE    R  ++  K  A     L I 
Sbjct: 87  SGGAVHIEDIQDQVELALMRSGHYKVARAYVLYREEHRKAR--ENELKKQASDQKLLLIT 144

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           M DG L   +++R++ IV EAC  L+ V ++ V+ +  +N+Y+    +D+  ALI ++RT
Sbjct: 145 MPDGELKPLDTERMDTIVHEACRNLEHVDAEPVIKDALRNLYNEAKFADVHKALIMAART 204

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EKEPNY  V+AR LL+ LR E L  +  +   AT  EM  LYP YF  Y+  G+K  +
Sbjct: 205 LVEKEPNYTYVSARLLLDCLRIEALHKLGIEAD-ATFDEMSQLYPAYFKIYVAHGIKQGM 263

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E M DFDL  L   L  ERD  F YL LQ LYDRYF+H  G R E+PQAFFMRVAMGL
Sbjct: 264 LDEKMADFDLEKLGKALLPERDMKFTYLSLQTLYDRYFIHDQGIRYELPQAFFMRVAMGL 323

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E +K ++A+EFY LLSSF +M STPTLFNSGT  PQLSSC+LTTVPD L GI+ A++
Sbjct: 324 AIREKDKNEKAIEFYQLLSSFDYMSSTPTLFNSGTIRPQLSSCYLTTVPDHLDGIYSAIK 383

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR +G+HI GTNGKSQGV+PFL VA+ TAVAVNQGGKRKGAV
Sbjct: 384 DNALLSKYAGGLGNDWTPVRAMGSHIKGTNGKSQGVVPFLNVADATAVAVNQGGKRKGAV 443

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH DVEEFL+LRKNTGDDRRRTHDMNTA WIPDLFM RV ++A WTLFSPDEV 
Sbjct: 444 CAYLECWHKDVEEFLELRKNTGDDRRRTHDMNTALWIPDLFMMRVREDADWTLFSPDEVP 503

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           +LHD +GK FE  Y  YE +A +G +K  + +SAV LWRKML+MLFETGHPW+TFKDPCN
Sbjct: 504 ELHDQFGKAFEALYNKYEEKAHQGLMKNVKTVSAVKLWRKMLSMLFETGHPWMTFKDPCN 563

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S EE AVCNLGSINL AH  N + D +KL  TI+TA
Sbjct: 564 LRSPQQHCGVVHSSNLCTEITLNTSEEEIAVCNLGSINLPAHIKNGKLDIEKLKQTIKTA 623

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +A+ SN  HR +GLGLMGFQ AL+ L I YAS EAVE AD SME
Sbjct: 624 VRMLDNVIDINYYSVPQARNSNLKHRPVGLGLMGFQDALYELKIDYASEEAVEFADSSME 683

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++AI AS +LA+ERG+YSS++GSLW +G+ PIDSI LL + R++ L  +R+ RL W+
Sbjct: 684 LISYYAIEASCDLAKERGSYSSYEGSLWSKGILPIDSINLLQQARNKYLEQDRSQRLDWE 743

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ +V+T GMRNSN MAIAPTATI+NICGV+QSI+P+YQNLYVKSN+SG+FTV+N +LV
Sbjct: 744 SLRIKVRTQGMRNSNVMAIAPTATISNICGVAQSIEPTYQNLYVKSNLSGEFTVINPYLV 803

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK  +LWDE M++DLKY +GS+  I RIP DLKK +AT+FEIDP+WL+++ASRRQKWI
Sbjct: 804 ADLKALELWDEVMVNDLKYFNGSVQPISRIPADLKKRYATSFEIDPIWLVDAASRRQKWI 863

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+ EPSGKKLD +Y  AW+ GLKTTYYLRS  A++ EKST+   D  LNAV 
Sbjct: 864 DQAQSLNIYMAEPSGKKLDQLYMHAWIRGLKTTYYLRSMGASNAEKSTV--TDSALNAVK 921

Query: 928 VTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           +            P +C+  D +CE CQ
Sbjct: 922 IMTE--------APKACSILDPDCEACQ 941


>gi|194290771|ref|YP_002006678.1| ribonucleotide-diphosphate reductase subunit alpha [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224606|emb|CAQ70617.1| Ribonucleoside-diphosphate reductase alpha subunit [Cupriavidus
           taiwanensis LMG 19424]
          Length = 979

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/905 (60%), Positives = 686/905 (75%), Gaps = 16/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++   S
Sbjct: 39  KIIRRNGAVVAFEPSKIAVAMTKAFLAVNGGQGAASARVREIVEQLTDNVVRALVRSRPS 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
              +HIED+QDQVE SLM+SG H++ R YVLYRE+R   RA+ S           + I +
Sbjct: 99  GGAIHIEDVQDQVELSLMRSGEHEVARAYVLYREKRKAERASASAQAVARVQEAGISINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D G     +   L  +++ ACSGL D VS++ +L ET KN+Y+G+  + +  + I ++R
Sbjct: 159 TDAGVTKPLDIVALHALIDNACSGLGDAVSAEPILKETLKNLYEGVPMTQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIEK+P+Y++VTAR LL  +R+E+L T      + T  EM   Y EYF ++I  G+ A 
Sbjct: 219 TLIEKDPDYSQVTARILLHTIRKEILGT------EVTQAEMATRYAEYFPKFIARGIAAE 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL E +  FDL  L   L   RDF F YLGLQ LYDRYFLHI+ +RIEMPQAFFMRVAMG
Sbjct: 273 LLDEKLATFDLARLGAALDAGRDFQFNYLGLQTLYDRYFLHIDETRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFY LLSSF FM STPTLFNSGT+  QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LALNEKDREARAIEFYQLLSSFDFMSSTPTLFNSGTQRSQLSSCYLTTVSDDLEGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +NA WTLFSP   
Sbjct: 453 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENAEWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD  GK FE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKVGKAFEKAYLGYEAKAANGELKLFKKVPAMQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           NIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH A         D+ KL 
Sbjct: 573 NIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLAKQADGSYALDHAKLQ 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TIRTA+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  LH+L  PY+S  AV+ 
Sbjct: 633 KTIRTAMRMLDNVIDINYYAVEKARNSNLRHRPVGMGIMGFQDCLHVLRTPYSSDAAVKF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG Y ++ GSLWD+G+ P DS+ LLAE R   L ++ +
Sbjct: 693 ADTSMEAVCYYAYQASTELAEERGRYETYTGSLWDRGILPQDSLKLLAEERGGYLDVDMS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           S + W  L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 SSMDWTSLRARIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E+AS
Sbjct: 813 VNDYLVRDLKERGLWDEVMVADLKYFDGSLSRIDRIPQDLRDIYATAFEVEPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTVS--RG 930

Query: 922 KLNAV 926
            LNAV
Sbjct: 931 SLNAV 935


>gi|209521090|ref|ZP_03269820.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. H160]
 gi|209498473|gb|EDZ98598.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. H160]
          Length = 1003

 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/904 (60%), Positives = 683/904 (75%), Gaps = 18/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  RA   H+  +A   P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRNQARAHDEHA--EAASTPGLNVT- 155

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E AC+ L D VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 156 DNGITRPLDMAALRSIIESACANLGDAVSAEPIVAETVKNLYDGVPMSQVYDSAILAART 215

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ G+ A L
Sbjct: 216 MIEKDPAYSQVTARILLHTIRREILE------EEVTQAEMGERYAEYFPQFIKRGIGAGL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 270 LDDKLQQFDLKRLGAALDANRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 330 SLNEIDREARAIEFYNILSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVDDDLDGIYEALK 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 450 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 509

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+K+ A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 510 DLHDKFGAEFEAAYTAYEDKVARGEIKLFKKLPAAQLWRKMLGMLFETGHPWITFKDPCN 569

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 570 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLALDHDKLKR 629

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LH+L  PYAS EAVE A
Sbjct: 630 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHMLRTPYASQEAVEFA 689

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 690 DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDSVALLAEARGGYVEVDSSE 749

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 750 SMDWPALRSRIATYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 809

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP+WL+ESASR
Sbjct: 810 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPVWLVESASR 869

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 870 RQKWIDQAQSLNIYMAGASGKKLDEIYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 927

Query: 923 LNAV 926
           LNAV
Sbjct: 928 LNAV 931


>gi|300309721|ref|YP_003773813.1| ribonucleoside reductase large subunit [Herbaspirillum seropedicae
           SmR1]
 gi|300072506|gb|ADJ61905.1| ribonucleoside reductase (large chain) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 994

 Score = 1150 bits (2976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/901 (60%), Positives = 684/901 (75%), Gaps = 11/901 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKIS A+ KAF+AV G   + S RV+++++ LT   V+ L++   +
Sbjct: 41  RIIRRNGAVVGFEPSKISIAVTKAFLAVNGGQGAASARVREMVEQLTTNVVSALVRRQPT 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q  +     +AP+L +  
Sbjct: 101 GGTFHIEDIQDQVELALMRSGEHDVARAYVLYRAKRMEERAQQGAATKTEVVAPQLHVT- 159

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           +DG     +   +  ++  AC GL++ V  + +L+ET KN+YDG+   +L  + I ++R 
Sbjct: 160 EDGQSRPLDINEVRSLIAAACVGLEEHVDGEAILAETVKNLYDGVPVEELYKSAILAARA 219

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EK+P Y++VT+R L+  +R+EV        ++    +    Y EYF +Y+++G++A L
Sbjct: 220 LMEKDPAYSQVTSRLLMHTIRKEVFG------KEVAQADAPAEYLEYFPQYVKKGIEAEL 273

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  LA  LK ERD  F Y+GLQ LYDRYFLHI G+RIEMPQAF+MRVAMGL
Sbjct: 274 LDTKLAQFDLAKLAAALKPERDLQFGYIGLQTLYDRYFLHIGGTRIEMPQAFYMRVAMGL 333

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY+LLSSF FM STPTLFNSGT+  QLSSC+LTTV DDL GI+ A++
Sbjct: 334 ALNEIDRETRAIEFYDLLSSFDFMSSTPTLFNSGTQRSQLSSCYLTTVADDLDGIYEAIK 393

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+LAK++GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 394 ENALLAKFAGGLGNDWTPVRALGAHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 453

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +  
Sbjct: 454 CAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGEWTLFSPSDTP 513

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G+ FE AY  YE +A RGE+K+F+K+ A  LWRKML+MLFETGHPWITFKDPCN
Sbjct: 514 DLHDKFGRAFEEAYTAYEAKAARGELKLFKKVQANDLWRKMLSMLFETGHPWITFKDPCN 573

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL AH  N + D+ KL  TIRTA
Sbjct: 574 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLPAHLVNGELDHAKLQKTIRTA 633

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH+  +PYAS +AVE AD SME
Sbjct: 634 MRMLDNVIDINYYAVKKARDSNLRHRPVGMGIMGFQDCLHIKRVPYASMDAVEFADRSME 693

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            + ++A  AS ELA+ERG Y+S++GSLWD+G+ P DS+ LLA+ R   L  + T  L W 
Sbjct: 694 AVCYYAYMASTELAEERGRYASYRGSLWDRGILPQDSLKLLAQERGGYLETDSTETLDWA 753

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FT +N +LV
Sbjct: 754 ALRARIAEHGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTEINEYLV 813

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE+DP WL+E+ASRRQKWI
Sbjct: 814 RDLKARGLWDEVMVADLKYFDGSLAKIDRIPQDLRDIYATAFEVDPSWLVEAASRRQKWI 873

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+   SGK+LD  Y+ AWL GLKTTYYLR+  AT  EKST +   G LNAV 
Sbjct: 874 DQAQSLNIYMAGASGKRLDETYKLAWLRGLKTTYYLRTIGATHTEKSTSRA--GALNAVA 931

Query: 928 V 928
           V
Sbjct: 932 V 932


>gi|171057073|ref|YP_001789422.1| ribonucleotide-diphosphate reductase subunit alpha [Leptothrix
           cholodnii SP-6]
 gi|170774518|gb|ACB32657.1| ribonucleoside-diphosphate reductase, alpha subunit [Leptothrix
           cholodnii SP-6]
          Length = 958

 Score = 1150 bits (2976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/939 (58%), Positives = 693/939 (73%), Gaps = 24/939 (2%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
           G Q+I+RNG V +F+P KI+ A+MKAF+AV G   + S  V++ +  LTE  V  L++  
Sbjct: 32  GYQIIRRNGAVVAFEPHKITVALMKAFLAVHGTHGAASASVRETVDGLTEAVVRALMRSR 91

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
            S    HIEDIQDQVE  LM+ GHH + R YVLYRE R+  RA+Q      AP+A +  +
Sbjct: 92  PSGGSFHIEDIQDQVELGLMRGGHHDVARAYVLYRERRTQERASQGR----APVAAEPAV 147

Query: 148 MMDD-GTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFS 205
           M+ D G  +  +  RL  ++E AC+ L  +     VL+ET +N+YDG+S  ++  A I +
Sbjct: 148 MVTDRGQRVPLDMARLAGLIEAACADLGPEAIGAPVLAETRRNLYDGVSIDEVYKASILA 207

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +RTLIEK+P+Y++VTAR L+  +RR+VL       ++ T  EM   Y +YF  +I++GV 
Sbjct: 208 ARTLIEKDPSYSRVTARLLMHTIRRDVLG------EEVTQAEMAARYADYFPAFIKKGVD 261

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
           A LL E M  FDL  L   LK ERD  F+YLGLQ LYDRYFLHI   RIEMPQAFFMRVA
Sbjct: 262 AELLDERMAQFDLARLGAALKAERDLNFDYLGLQTLYDRYFLHIRKQRIEMPQAFFMRVA 321

Query: 326 MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
           MGLAL E ++E RA+EFY +LS+F FM STPTLFN+GTR  QLSSC+LTTVPDDL GI+ 
Sbjct: 322 MGLALNEIDREARAIEFYEVLSAFDFMSSTPTLFNAGTRRSQLSSCYLTTVPDDLEGIYD 381

Query: 386 ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
           A+++NA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRK
Sbjct: 382 AIKDNALLSKFAGGLGNDWTPVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRK 441

Query: 446 GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
           GAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP 
Sbjct: 442 GAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPA 501

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
              DLHDL+G  FE AY  YE +ADRGEI  F+++ AV LWRK+L+MLFETGHPWITFKD
Sbjct: 502 NCPDLHDLFGTAFEAAYTAYEARADRGEITFFKRVRAVDLWRKILSMLFETGHPWITFKD 561

Query: 566 PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTI 625
            CN+RSPQQHVGVVHSSNLCTEITLN+++ E AVCNLGS+NL  H  + + D  KL  T+
Sbjct: 562 ACNVRSPQQHVGVVHSSNLCTEITLNTNAGEIAVCNLGSVNLAQHVKDGEVDQAKLCRTV 621

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
            TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ AL+ L +PYAS EAVE AD 
Sbjct: 622 TTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDALYQLRVPYASNEAVEFADR 681

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRL 744
           SME + +HA  AS ELA ERG Y++++GSLWD+G+ PIDSI LLAE R   L ++  + L
Sbjct: 682 SMEAVCYHAYWASTELAAERGRYATYRGSLWDRGILPIDSIALLAEQRGGYLDVDTRTTL 741

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L+ R+   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTVVN 
Sbjct: 742 DWDALRARIAQYGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVVNE 801

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV +LK   LWD+ M+ DLK+ DGS+  I+R+P++LK+++ATAFE++  WL+E+A+RRQ
Sbjct: 802 YLVRDLKALGLWDDVMVMDLKHFDGSLRRIDRVPEELKRLYATAFEVETQWLVEAAARRQ 861

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST+K   G +N
Sbjct: 862 KWIDQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTMGATHAEKSTVKA--GSMN 919

Query: 925 AVPVTDPNSSTHSLGIPSS---------CTSDTECEVCQ 954
           AV      S++    + S+            D  CE CQ
Sbjct: 920 AVSNGAHGSASEPAAVSSNEPATDVKFCAIDDPSCEACQ 958


>gi|70731822|ref|YP_261564.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens Pf-5]
 gi|68346121|gb|AAY93727.1| ribonucleoside-diphosphate reductase, alpha chain [Pseudomonas
           fluorescens Pf-5]
          Length = 963

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/936 (58%), Positives = 698/936 (74%), Gaps = 14/936 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTVARLTEQVTATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA +S S+      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERATRSTSEEPVQAHPSIRIT 151

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL++V   ++  ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 152 RTDGSFAPLDMGRLNTIVSEACEGLEEVDGDLIQRETLKNLYDGVALKDVNTALVMTART 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  + +  + ATHHEM  LY +    Y+ +G++  L
Sbjct: 212 LVEREPNYSFVTARLLMDTLRAEGLGFL-EVAESATHHEMAELYAKALPAYVAKGIEFEL 270

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 271 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 330

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E ++E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+GA+ 
Sbjct: 331 AIEEKQREDRAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAIH 390

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 391 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 450

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 451 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGKWTLFSPSEVP 510

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL GK FE  YE YE   +  +IK+F+ + A  LWRKML+MLFETGHPW+TFKDPCN
Sbjct: 511 DLHDLTGKAFEERYEYYEALTEYNKIKLFKTVQAKDLWRKMLSMLFETGHPWLTFKDPCN 570

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D  KL  T+ TA
Sbjct: 571 LRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTAKLQRTVNTA 630

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HI Y S  AVE AD+SME
Sbjct: 631 VRMLDNVIDINYYSVPQAKNSNFKHRPVGLGIMGFQDALYLQHIAYGSDAAVEFADKSME 690

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R +  + ++    L W
Sbjct: 691 AVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEARGQKYIDVDLNESLDW 750

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +L
Sbjct: 751 APVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYL 809

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK R LWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE++  W++++ASRRQKW
Sbjct: 810 VRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVETKWIVDAASRRQKW 869

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNAV
Sbjct: 870 IDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLNAV 927

Query: 927 PVTDPNSSTHSL-------GIPSSCTSD-TECEVCQ 954
                +     L        +P +C  D  +CE CQ
Sbjct: 928 SSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 963


>gi|170695323|ref|ZP_02886469.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           graminis C4D1M]
 gi|170139723|gb|EDT07905.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           graminis C4D1M]
          Length = 1001

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/903 (60%), Positives = 684/903 (75%), Gaps = 19/903 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  R    H +  A   P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARG---HDEQVAGSTPGLTVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E AC+ L D VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVSRPLDMAALRGIIESACANLGDAVSAEPIVAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREIL------EEEVTQAEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+K+ A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKFGAEFEAAYTAYEDKVARGEIKLFKKVPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLVLDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV+ A
Sbjct: 629 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVKFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELAQERG YSS++GSLWD+G+ P DS+ LLA+ R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRGILPQDSVKLLADARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL++R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWTELRQRIATYGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LNA 925
           LNA
Sbjct: 927 LNA 929


>gi|83719828|ref|YP_441700.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis E264]
 gi|257137869|ref|ZP_05586131.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis E264]
 gi|83653653|gb|ABC37716.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           thailandensis E264]
          Length = 995

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/908 (60%), Positives = 689/908 (75%), Gaps = 17/908 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKIM 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R  A   +  ++P    + + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAAAVESPTGGSINVT 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G + + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 159 -DNGVMRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSAILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+++KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLYKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVPVT 929
            LNAVP +
Sbjct: 930 ALNAVPTS 937


>gi|330504345|ref|YP_004381214.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina NK-01]
 gi|328918631|gb|AEB59462.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           mendocina NK-01]
          Length = 968

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/901 (60%), Positives = 692/901 (76%), Gaps = 8/901 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTVARLTEQVTATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE ++  R A + S+   P  P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREAQASKRKASAGSEIAQP-HPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G +   +  RL+ I+ EAC GL +V   ++  ET KN+YDG++E D+ TAL+ ++RT
Sbjct: 151 NAAGEVQPLDMGRLQTIIREACEGLAEVDGSLIERETLKNLYDGVAEKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ +R E L+ +      ATHHEM  LY +    Y+E+GV+  L
Sbjct: 211 LVEREPNYSYVTARLLMDNIRAEALSFL-SIAASATHHEMADLYAKALPAYVEKGVEFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +  FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LDAKLKTFDLEKLGAAINHERDQQFTYLGLQTLYDRYFIHKDGIRFELPQVFFMRVAMGL 329

Query: 329 ALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           A++E + +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+GA+
Sbjct: 330 AIEEPKNREDRAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAI 389

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
            +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 390 HDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 449

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSP EV
Sbjct: 450 VCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGKWTLFSPSEV 509

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHDL GK FE  YE YE   + G+IK+++ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 PDLHDLTGKAFEERYEYYEALIEYGKIKLYKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGS+NL+ H  + + D +KL  T++T
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSVNLVNHIVDGKLDIEKLGRTVKT 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++++A+ SN  HR +GLGLMGFQ AL+L HI Y S  A+E AD+SM
Sbjct: 630 AVRMLDNVIDINYYSVDQARNSNLKHRPVGLGLMGFQDALYLQHIAYGSDAAIEFADKSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E IS++AI AS +LA ERG+YS+F+GSLW +G+ P+DS  LL E R +  + ++ +  L 
Sbjct: 690 EAISYYAIQASCDLADERGSYSTFEGSLWSKGILPLDSQQLLIEARGQKYIDVDLSESLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  +++RVK  G+RNSN MAIAPTATI+NI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPIRERVKK-GIRNSNIMAIAPTATISNIIGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE++  W++++ASRRQK
Sbjct: 809 LVRDLKNRGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFEVETKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLNA 926

Query: 926 V 926
           V
Sbjct: 927 V 927


>gi|167618619|ref|ZP_02387250.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis Bt4]
          Length = 953

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/906 (60%), Positives = 688/906 (75%), Gaps = 17/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKIM 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R  A   +  ++P    + + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAAAVESPTGGSINVT 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G + + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 159 -DNGVMRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSAILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+++KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLYKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 930 ALNAVP 935


>gi|77460467|ref|YP_349974.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens Pf0-1]
 gi|77384470|gb|ABA75983.1| ribonucleoside-diphosphate reductase alpha chain [Pseudomonas
           fluorescens Pf0-1]
          Length = 964

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/953 (58%), Positives = 705/953 (73%), Gaps = 18/953 (1%)

Query: 13  DAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDII 72
           D+   LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +
Sbjct: 19  DSNSDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTV 75

Query: 73  KNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ 132
             LTEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ RS  RA +
Sbjct: 76  ARLTEQVTATFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDARSKERATR 135

Query: 133 SHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDG 192
           + +++     P ++I   DG+L   +  RL  IV EAC GL +V   ++  ET KN+YDG
Sbjct: 136 TTAEAPVQAHPSIRITRADGSLAPLDMGRLNTIVTEACEGLAEVDGDLIQRETLKNLYDG 195

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           ++ +D+ TAL+ ++RTL+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY
Sbjct: 196 VALNDVNTALVMTARTLVEREPNYSFVTARLLMDTLRAEGLGFL-GVAESATHHEMADLY 254

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            +    Y+ +G++  LL+  +  FDL  L   + +ERD  F YLGLQ LYDRYF+H +G 
Sbjct: 255 AKALPAYVAKGIEFELLNPVLASFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGV 314

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           R E+PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+
Sbjct: 315 RFELPQIFFMRVAMGLAIEEKQKEDRAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCY 374

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPDDL GI+ A+ +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV N
Sbjct: 375 LTTVPDDLSGIYHAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVN 434

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 435 DTAVAVNQGGKRKGAVCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKR 494

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLT 551
           V  +  WTLFSP EV DLHDL GK FE  YE YE   +  G+IK+F+ I A  LWRKML+
Sbjct: 495 VFDDGKWTLFSPSEVPDLHDLTGKAFEERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLS 554

Query: 552 MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF 611
           MLFETGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H 
Sbjct: 555 MLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHI 614

Query: 612 ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
            + + D  KL  TI  AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L H
Sbjct: 615 VDGKLDTAKLKRTIDVAVRMLDNVIDINYYSVPQAKNSNFRHRPVGLGIMGFQDALYLQH 674

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           IPY S  AVE AD+SME +S++AI AS +LA ERG+Y +F+GSLW +GV P+DS  +L E
Sbjct: 675 IPYGSDAAVEFADKSMEAVSYYAIQASCDLADERGSYETFQGSLWSKGVLPLDSQQILIE 734

Query: 732 VRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNL 789
            R +  + ++ T  L W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNL
Sbjct: 735 ARGQKYIDVDLTESLDWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNL 793

Query: 790 YVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAF 849
           YVKSN+SG+FTV+N +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK+++ATAF
Sbjct: 794 YVKSNLSGEFTVINPYLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKELYATAF 853

Query: 850 EIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
           E+D  W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +AT
Sbjct: 854 EVDTKWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAAT 913

Query: 910 SVEKSTLKGVDGKLNAVPVTDPNSSTHSL-------GIPSSCTSD-TECEVCQ 954
           S EKST+    GKLNAV     +     L        +P +C  D  +CE CQ
Sbjct: 914 STEKSTIN--TGKLNAVSSGGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 964


>gi|167895963|ref|ZP_02483365.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 7894]
          Length = 995

 Score = 1148 bits (2970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/909 (60%), Positives = 690/909 (75%), Gaps = 19/909 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREER--SDVRAAQSHSKSDAPIAPKLKI 147
               HIEDIQDQVE +LM+ G H + R YVLYRE+R    V A ++ +   +P A  + +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGETEAAEASP-AGGINV 157

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++
Sbjct: 158 T-DNGVTRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAA 216

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RT+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A
Sbjct: 217 RTMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEA 270

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAM
Sbjct: 271 ELLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAM 330

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ A
Sbjct: 331 GLALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEA 390

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 391 LKDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKG 450

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP  
Sbjct: 451 AVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPST 510

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDP
Sbjct: 511 CPDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDP 570

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKL 621
           CN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL
Sbjct: 571 CNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKL 630

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE
Sbjct: 631 KRTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVE 690

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ 
Sbjct: 691 FADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDT 750

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           ++ L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FT
Sbjct: 751 SATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT 810

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+A
Sbjct: 811 VVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAA 870

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           SRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    
Sbjct: 871 SRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AH 928

Query: 921 GKLNAVPVT 929
           G LNAVP +
Sbjct: 929 GALNAVPTS 937


>gi|167580511|ref|ZP_02373385.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis TXDOH]
          Length = 950

 Score = 1148 bits (2970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/906 (60%), Positives = 688/906 (75%), Gaps = 17/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKIM 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R  A   +  ++P    + + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAAAVESPTGGSINVT 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G + + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 159 -DNGVMRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSAILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+++KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLYKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  P+AS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPFASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 930 ALNAVP 935


>gi|312795098|ref|YP_004028020.1| ribonucleoside-diphosphate reductase alpha chain [Burkholderia
            rhizoxinica HKI 454]
 gi|312166873|emb|CBW73876.1| Ribonucleoside-diphosphate reductase alpha chain (EC 1.17.4.1)
            [Burkholderia rhizoxinica HKI 454]
          Length = 1046

 Score = 1148 bits (2969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/926 (59%), Positives = 694/926 (74%), Gaps = 21/926 (2%)

Query: 30   QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
            +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT+  V  L++   +
Sbjct: 95   KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRESVETLTQAVVRALVRSRPN 154

Query: 90   ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
                HIEDIQDQVE +LM++G H + R YVLYRE+R+  RA   H  +  P    L +  
Sbjct: 155  GGTFHIEDIQDQVELALMRAGEHNVARAYVLYREKRAAERA---HEVAQQPAQGGLNVN- 210

Query: 150  DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
            D+G +   +   L  ++  AC GL + VS++ +++ET KN+YDG+  S +  + I ++RT
Sbjct: 211  DNGIVRPLDLAALRNVITAACDGLGEAVSAEPIVAETVKNLYDGVPLSQVYDSAILAART 270

Query: 209  LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            +IEKEP Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV+A L
Sbjct: 271  MIEKEPAYSQVTARLLLHTIRREILG------EEVLQSEMGARYAEYFPQFLKRGVEAEL 324

Query: 269  LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
            L E ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G RIEMPQAFFMRVAMGL
Sbjct: 325  LDEKLLQFDLKKLGDALDASRDLKFGYLGLQTLYDRYFLHVDGQRIEMPQAFFMRVAMGL 384

Query: 329  ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
            AL E ++E RA+EFYN+LS+F FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 385  ALNEIDREARAIEFYNVLSTFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLEGIYEALK 444

Query: 389  ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
            ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 445  ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 504

Query: 449  CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
            CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 505  CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVIEGGDWTLFSPSSCP 564

Query: 509  DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
            DLHD +G EFE AY  YE +A RGE+K+F+KI A  LWRKML MLFETGHPWITFKDPC 
Sbjct: 565  DLHDKFGAEFEQAYVAYEEKAARGELKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCX 624

Query: 569  IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
            +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 625  VRSPQQHVGVVHSSNLCTEITLNTSDNEIAVCNLGSVNLVAHMKQGADXGYVLDHDKLKR 684

Query: 624  TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS +AVE A
Sbjct: 685  TISVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASQQAVEFA 744

Query: 684  DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
            D SME I ++A  AS ELA ERG YSS++GSLWD+G+ P D++ LLA+ R   + ++ + 
Sbjct: 745  DRSMEAICYYAYWASTELASERGRYSSYRGSLWDRGILPQDTLKLLADSRGGYVEVDSSE 804

Query: 743  RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
             + W  L++R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 805  TMDWAALRERIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 864

Query: 803  NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
            N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL++ +ATAFE+DP WL+E+A+R
Sbjct: 865  NEYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPADLRETYATAFEVDPKWLVEAAAR 924

Query: 863  RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
            RQKWIDQAQSLN+Y+   SGKKLD IY+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 925  RQKWIDQAQSLNIYMAGASGKKLDEIYKLAWLRGLKTTYYLRTIAATHVEKSTV--AHGA 982

Query: 923  LNAVPVTDPN-SSTHSL-GIPSSCTS 946
            LNAVP +D    + H   G+  S T+
Sbjct: 983  LNAVPSSDGGVGAMHGAGGVSGSATA 1008


>gi|186477387|ref|YP_001858857.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           phymatum STM815]
 gi|184193846|gb|ACC71811.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           phymatum STM815]
          Length = 997

 Score = 1148 bits (2969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/936 (58%), Positives = 695/936 (74%), Gaps = 26/936 (2%)

Query: 2   HPSKDVNKGDEDAFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG 61
            P + + +G +   P   Y         +VI+RNG V SF+PSKI+ A+ KAF+AV G  
Sbjct: 18  RPVEGLAQGADALAPQTGY------ADYKVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQ 71

Query: 62  ASRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLY 121
            + S RV+++++ LT+  V  L++   +    HIEDIQDQVE +LM++G H + R YVLY
Sbjct: 72  GAASARVRELVEQLTQNVVRALVRSRPNGGTFHIEDIQDQVELALMRTGEHNVARAYVLY 131

Query: 122 REERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKI 180
           RE+R+  R  +     DAP+A  L +  D+G     +   L  ++E AC+ L D V+++ 
Sbjct: 132 REKRTQERGHEV----DAPVASGLNVT-DNGVTRPLDMAALRGLIESACANLGDAVNAEP 186

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +++ET KN+YDG+  S +  + I ++RT+IEK+P Y++VT+R LL  +RRE+L       
Sbjct: 187 IVAETVKNLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTSRILLHTIRREILE------ 240

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           ++ T  EM   Y EYF  +I+ GV A LL + ++ FDL  L   L   RD  F YLGLQ 
Sbjct: 241 EEVTQAEMAGRYAEYFPLFIKRGVNAELLDDKLLQFDLKRLGAALDANRDLQFGYLGLQT 300

Query: 301 LYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFN 360
           LYDRYFLHI+G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFN
Sbjct: 301 LYDRYFLHIDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFN 360

Query: 361 SGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGK 420
           SGTR  QLSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGK
Sbjct: 361 SGTRRSQLSSCYLTTVDDDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGK 420

Query: 421 SQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMN 480
           SQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMN
Sbjct: 421 SQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMN 480

Query: 481 TANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKI 540
           TANWIPDLFMKRV +   WTLFSP    DLHD +G EFE AY  YE +  RGEIK+F+KI
Sbjct: 481 TANWIPDLFMKRVLEGGDWTLFSPSTCPDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKI 540

Query: 541 SAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVC 600
            A  LWRKML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVC
Sbjct: 541 PAAQLWRKMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVC 600

Query: 601 NLGSINLLAHFANN-----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           NLGS+NL+AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR 
Sbjct: 601 NLGSVNLVAHLKEQADGTLALDHDKLKRTISVAMRMLDNVIDINYYAVAKARNSNLKHRP 660

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +G+G+MGFQ  LH+L  PYAS EAVE AD SME + ++A  AS ELA+ERG YS+++GSL
Sbjct: 661 VGMGIMGFQDCLHVLRTPYASQEAVEFADRSMEAVCYYAYWASTELAEERGRYSTYRGSL 720

Query: 716 WDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++ LLA+ R   + ++ +  + W  L+ R+ T GMRNSNC+AIAPTATI+N
Sbjct: 721 WDRGILPQDTLKLLADARGGYVEVDSSESMDWASLRSRIATHGMRNSNCVAIAPTATISN 780

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I GVS  I+P++QNLYVKSN+SG+FTVVN +LV +LK R LWDE M++DLKY DGS+  I
Sbjct: 781 IIGVSACIEPTFQNLYVKSNLSGEFTVVNEYLVRDLKARGLWDEVMVADLKYFDGSLSRI 840

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           +R+P DL+ I+ATAFE+D  WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL
Sbjct: 841 DRVPADLRAIYATAFEVDATWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWL 900

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTD 930
            GLKTTYYLR+ +AT VEKST+    G LNAVP  D
Sbjct: 901 RGLKTTYYLRTMAATHVEKSTV--AHGALNAVPSGD 934


>gi|187925408|ref|YP_001897050.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           phytofirmans PsJN]
 gi|187716602|gb|ACD17826.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           phytofirmans PsJN]
          Length = 1001

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/904 (60%), Positives = 682/904 (75%), Gaps = 19/904 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  R    H        P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARG---HDDQIVANTPGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E ACS L D VS+  +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREILK------EEVTQTEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G +FE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDLFGADFEKAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLVLDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV+ A
Sbjct: 629 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVKFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELAQERG YSS++GSLWD+G+ P DS+ LLA+ R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRGILPQDSVKLLADARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWTELRSRIATYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|167574514|ref|ZP_02367388.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           oklahomensis C6786]
          Length = 944

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/912 (59%), Positives = 684/912 (75%), Gaps = 15/912 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQSVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R     +      A     + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAADVETSAAGGINVT 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  ++  AC GL D VS + ++SET KN+YDG+  + +  + I ++RT
Sbjct: 159 DNGVTRPLDMSALHALIVSACEGLGDAVSPEPIVSETVKNLYDGVPMTQVYDSAILAART 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A L
Sbjct: 219 MIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSMRYAEYFPQFLKRGVEAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 DNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP    
Sbjct: 453 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL  
Sbjct: 573 VRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDQEKLKR 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS  AVE A
Sbjct: 633 TVGVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASEAAVEFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ ++
Sbjct: 693 DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTSA 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 753 TLDWPVLRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+R+P DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 813 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRVPADLRAIYATAFEVDPKWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 930

Query: 923 LNAVPVTDPNSS 934
           LNAVP +  +S 
Sbjct: 931 LNAVPTSGGSSG 942


>gi|113869189|ref|YP_727678.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           eutropha H16]
 gi|113527965|emb|CAJ94310.1| Ribonucleoside-diphosphate reductase alpha subunit [Ralstonia
           eutropha H16]
          Length = 977

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/906 (60%), Positives = 696/906 (76%), Gaps = 18/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++   +
Sbjct: 37  KIIRRNGAVVAFEPSKIAVAMTKAFLAVNGGQGAASARVREIVEQLTDNVVRALVRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK-LKIM 148
              +HIED+QD VE +LM+SG H++ R YVLYRE+R D RA Q+++++ A +    + + 
Sbjct: 97  GGAIHIEDVQDHVELALMRSGEHEVARAYVLYREKRKDERA-QANAQAVARVQEGGISVN 155

Query: 149 MDDGTLIS-FNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           + DG +    +   L  +++ ACSGL + VS++ +L ET KN+YDG+  + +  + I ++
Sbjct: 156 VTDGGVTHVLDIAALHDLIDNACSGLGNAVSAEPILKETLKNLYDGVPMTQVYDSAILAA 215

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTLIEK+P+Y++VTAR LL  +R+E+L T      + T  EM   Y EYF ++I  G++A
Sbjct: 216 RTLIEKDPDYSQVTARILLHTIRKEILGT------EVTQAEMSTRYAEYFPKFIARGIEA 269

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL E +  FDL  L   L   RDF F YLGLQ LYDRYFLHI+ +RIEMPQAFFMRVAM
Sbjct: 270 ELLDEQLATFDLARLGAALDAGRDFQFNYLGLQTLYDRYFLHIDETRIEMPQAFFMRVAM 329

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ A
Sbjct: 330 GLALNEKDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIYEA 389

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 390 LKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKG 449

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP  
Sbjct: 450 AVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPAT 509

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD  GKEFE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITFKDP
Sbjct: 510 CPDLHDKVGKEFEKAYLGYEAKAASGELKLFKKLPALQLWRKMLGMLFETGHPWITFKDP 569

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKL 621
           CNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH A         D+ KL
Sbjct: 570 CNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMAKQADGTYALDHAKL 629

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             T+RTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH+L  PY+S  AV+
Sbjct: 630 QKTVRTAMRMLDNVIDINYYAVDKARNSNLRHRPVGMGIMGFQDCLHVLRTPYSSDAAVK 689

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P DS+ LLAE R   L ++ 
Sbjct: 690 FADTSMEAVCYYAYHASTELAEERGRYSSYEGSLWDRGILPQDSLKLLAEERGGYLDVDM 749

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           ++ + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FT
Sbjct: 750 SATMDWDALRARIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT 809

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E+A
Sbjct: 810 VVNDYLVRDLKERGLWDEVMVADLKYFDGSLSRIDRIPQDLRDIYATAFEVEPTWLVEAA 869

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           SRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR+ +AT VEKST+    
Sbjct: 870 SRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWVRGLKTTYYLRTMAATHVEKSTVS--R 927

Query: 921 GKLNAV 926
           G LNAV
Sbjct: 928 GSLNAV 933


>gi|329902474|ref|ZP_08273119.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548766|gb|EGF33403.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 969

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/943 (58%), Positives = 694/943 (73%), Gaps = 30/943 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++++RNG V +F+PSKIS A+ KAF+AV G   + S RV+++++ LT   V  L++   +
Sbjct: 39  RILRRNGAVVAFEPSKISIAVTKAFLAVNGGQGAASARVRELVEQLTATVVAALVRRQPA 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q  ++   P A  +++ +
Sbjct: 99  GGTFHIEDIQDQVELALMRSGEHDVARAYVLYRAKRMEERALQQAAR---PAAASVQLHV 155

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            +DG     + +++  +++ AC GL+  V +  + +ET KN+YDG+   +L  + I ++R
Sbjct: 156 TEDGQRRLLDMQQVHKLIDAACIGLEKHVDANAIFAETVKNLYDGVPVEELHKSAILAAR 215

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
            L+EK+P Y  VTAR L+  +R+EV        ++    + Q  Y EYF ++I  G+ A 
Sbjct: 216 ALMEKDPAYTTVTARILMHVIRKEVFG------KEVAQADAQAHYLEYFPQFIHNGIAAE 269

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  LA  L  +RD  F Y+GLQ LYDRYFLHI   RIEMPQAF+MRVAMG
Sbjct: 270 LLDAKLAGFDLDRLAKALVPDRDLQFGYIGLQTLYDRYFLHIRDIRIEMPQAFYMRVAMG 329

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E+RA+EFYNLLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ A+
Sbjct: 330 LALNEAKREERAIEFYNLLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVADDLEGIYDAI 389

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+LAKY+GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 390 KDNALLAKYAGGLGNDWTPVRSLGAHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 449

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV +   W LFSP EV
Sbjct: 450 VCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGSWMLFSPSEV 509

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD  G+ FE AY  YE  A RGE+++F+K+ A+ LWRKML+MLFETGHPWITFKDPC
Sbjct: 510 PDLHDKVGRAFEAAYTGYEAAAARGELRMFKKVEALDLWRKMLSMLFETGHPWITFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL AH  + Q D+ KL  TIR 
Sbjct: 570 NIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLPAHMKDGQLDHVKLQKTIRI 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ  LH++ +PYAS EAV  AD+SM
Sbjct: 630 AMRMLDNVIDINYYAVQKARDSNMRHRPVGLGIMGFQDCLHIMRVPYASAEAVSFADKSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E + ++A +AS ELA+ERGAYSS+KGSLWD+G+ P DS+ LL E R   L  + +  + W
Sbjct: 690 EAVCYYAYTASTELAEERGAYSSYKGSLWDRGILPQDSLKLLMEERGGYLETDLSEAMDW 749

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             L+ R+K  GMRNSNC+AIAPTATI+NI GV+  I+P+YQNLYVKSN+SG+FT +N +L
Sbjct: 750 TPLRARIKQFGMRNSNCVAIAPTATISNIIGVAACIEPTYQNLYVKSNLSGEFTEINEYL 809

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK RDLWDE MISDLKY DGS+  I+R+P +L+ I+ATAFEI+P WL+E+ASRRQKW
Sbjct: 810 VRDLKARDLWDEVMISDLKYFDGSLARIDRVPQELRAIYATAFEIEPSWLVEAASRRQKW 869

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST K   G LNAV
Sbjct: 870 IDQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTIGATHTEKSTSK--TGSLNAV 927

Query: 927 PVTDPNSSTHSLGIPSSCTSDT---------------ECEVCQ 954
              D  SS  +L   ++  +D                ECE CQ
Sbjct: 928 S-ADGVSSGVALSAYTTAGADVDGPSCVLRPGDDGFEECEACQ 969


>gi|167564162|ref|ZP_02357078.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           oklahomensis EO147]
          Length = 953

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/905 (60%), Positives = 681/905 (75%), Gaps = 15/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQSVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R     +      A     + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAADVETSAAGGINVT 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  ++  AC GL D VS + ++SET KN+YDG+  + +  + I ++RT
Sbjct: 159 DNGVTRPLDMSALHALIVSACEGLGDAVSPEPIVSETVKNLYDGVPMTQVYDSAILAART 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A L
Sbjct: 219 MIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSMRYAEYFPQFLKRGVEAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 DNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP    
Sbjct: 453 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL  
Sbjct: 573 VRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDQEKLKR 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS  AVE A
Sbjct: 633 TVGVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASEAAVEFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ ++
Sbjct: 693 DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTSA 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 753 TLDWPVLRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+R+P DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 813 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRVPADLRAIYATAFEVDPKWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 930

Query: 923 LNAVP 927
           LNAVP
Sbjct: 931 LNAVP 935


>gi|309783063|ref|ZP_07677782.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308918171|gb|EFP63849.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 994

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/904 (61%), Positives = 678/904 (75%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++++   T+  V  LL+   +
Sbjct: 41  KIIRRNGAVVSFEPSKIAVAMTKAFLAVNGGQGAASARVRELVDQQTQNVVRALLRSRPN 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE R+  RA Q+      P    L +  
Sbjct: 101 GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERA-QAGETQQQPAFIGLNVT- 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC GL + V  + +L ET KN+Y+G+  + +  + I +SRT
Sbjct: 159 DGGISRPLDMAALRNVIVSACEGLGEAVDPEPILKETVKNLYEGVPMTQVYDSAILASRT 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y +YF ++IE G+ A L
Sbjct: 219 LIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYVDYFPQFIERGINAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L   L   RDF F YLGLQ LYDRYFLHIN +RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLAQFDLARLGAALDASRDFQFNYLGLQTLYDRYFLHINETRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 453 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKVGKAFEQAYLAYEDKVARGEIKLFKKMPALQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D++KL  
Sbjct: 573 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVKQPDGSVVLDHEKLKK 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ ALH+L +PYAS  AV+ A
Sbjct: 633 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGMGIMGFQDALHVLRVPYASEAAVQFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS+KGSLWD+G+ P DS+ LLAE R   L  + +S
Sbjct: 693 DTSMEAVCYYAYWASTELAEERGRYSSYKGSLWDRGILPQDSLKLLAEERGGYLEADMSS 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 753 TMDWDSLRGRIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 813 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 930

Query: 923 LNAV 926
           LNAV
Sbjct: 931 LNAV 934


>gi|167920555|ref|ZP_02507646.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei BCC215]
          Length = 952

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/906 (60%), Positives = 686/906 (75%), Gaps = 17/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + +HA  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYHAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 930 ALNAVP 935


>gi|312962585|ref|ZP_07777075.1| ribonucleoside-diphosphate reductase [Pseudomonas fluorescens WH6]
 gi|311283165|gb|EFQ61756.1| ribonucleoside-diphosphate reductase [Pseudomonas fluorescens WH6]
          Length = 963

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/936 (58%), Positives = 695/936 (74%), Gaps = 14/936 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVTATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA  + +       P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVHAPAAEAVQAHPSIRIT 151

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  I+ EAC GL++V   ++  ET KN+YDG++ +D+ TAL+ ++RT
Sbjct: 152 LADGSFAPLDLGRLNTIITEACEGLEEVDGDLIQRETLKNLYDGVALTDVNTALVMTART 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    YI +G++  L
Sbjct: 212 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYIAKGIEFEL 270

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  +  FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 271 LNPVLATFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGIRFELPQVFFMRVAMGL 330

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 331 AIEEKHKEDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 390

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 391 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 450

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 451 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGQWTLFSPSEVP 510

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK FE  YE YE  A   G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 511 DLHDLTGKAFEERYEYYEALAQYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 570

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D  KL  T+ T
Sbjct: 571 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTAKLERTVNT 630

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AVE AD+SM
Sbjct: 631 AVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQDALYLQHIPYGSDAAVEFADKSM 690

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R +  + ++    L 
Sbjct: 691 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGQKYIDVDLNETLD 750

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 751 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 809

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 810 LVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 869

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 870 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLNA 927

Query: 926 VPVTDPNSST------HSLGIPSSCTSD-TECEVCQ 954
           V   +    +          +P +C  D  +CE CQ
Sbjct: 928 VSSGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 963


>gi|229592128|ref|YP_002874247.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           fluorescens SBW25]
 gi|229363994|emb|CAY51541.1| ribonucleoside-diphosphate reductase alpha chain [Pseudomonas
           fluorescens SBW25]
          Length = 964

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/937 (59%), Positives = 699/937 (74%), Gaps = 15/937 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGTAAASSRIHDTVARLTEQVTATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA-PKLKI 147
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++ ++  A  A P ++I
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRTPAEEAAVQAHPSIRI 151

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            + DGT    +  RL  I+ EAC GL++V   ++  ET KN+YDG++ +D+ TAL+ ++R
Sbjct: 152 TLADGTFAPLDLGRLNTIITEACEGLEEVDGDLIQRETLKNLYDGVALTDVNTALVMTAR 211

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TL+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    YI +G++  
Sbjct: 212 TLVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYIAKGIEFE 270

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL+  +  FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMG
Sbjct: 271 LLNPILATFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGIRFELPQVFFMRVAMG 330

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++E  KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+
Sbjct: 331 LAIEEKHKEDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAI 390

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
            +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 391 HDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 450

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV
Sbjct: 451 VCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEV 510

Query: 508 SDLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
            DLHDL GK FE  YE YE  +   G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDP
Sbjct: 511 PDLHDLTGKAFEERYEYYEALSQYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDP 570

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D  KL  T+ 
Sbjct: 571 CNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTAKLERTVN 630

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TAVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AVE AD+S
Sbjct: 631 TAVRMLDNVIDINYYSVPQAQNSNFKHRPVGLGIMGFQDALYLQHIPYGSDAAVEFADKS 690

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R +  + ++    L
Sbjct: 691 MEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGQKYIDVDLNESL 750

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N 
Sbjct: 751 DWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINP 809

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV +LK R LWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQ
Sbjct: 810 YLVRDLKARGLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQ 869

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLN
Sbjct: 870 KWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLN 927

Query: 925 AVPVTDPNSST------HSLGIPSSCTSD-TECEVCQ 954
           AV   +    +          +P +C  D  +CE CQ
Sbjct: 928 AVSSGNHGDDSVLAAPAGPAPVPKACAIDEPDCEACQ 964


>gi|241664220|ref|YP_002982580.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           pickettii 12D]
 gi|240866247|gb|ACS63908.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
          Length = 994

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/904 (61%), Positives = 678/904 (75%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++++   T+  V  LL+   +
Sbjct: 41  KIIRRNGAVVSFEPSKIAVAMTKAFLAVNGGQGAASARVRELVDQQTQNVVRALLRSRPN 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE R+  RA Q+      P    L +  
Sbjct: 101 GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERA-QAGETQQQPAFIGLNVT- 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC GL D V  + +L ET KN+Y+G+  + +  + I +SRT
Sbjct: 159 DGGISRPLDMVALRNVIVSACEGLGDAVDPEPILKETVKNLYEGVPMTQVYDSAILASRT 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 219 LIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYVDYFPQFIKRGINAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L   L   RDF F YLGLQ LYDRYFLHIN +RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLAQFDLARLGAALDASRDFQFNYLGLQTLYDRYFLHINETRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 453 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKVGKAFEQAYLAYEDKVARGEIKLFKKMPALQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D++KL  
Sbjct: 573 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVKQADGSVVLDHEKLKK 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ ALH+L +PYAS  AV+ A
Sbjct: 633 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGMGIMGFQDALHVLRVPYASEAAVQFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS+KGSLWD+G+ P DS+ LLAE R   L  + +S
Sbjct: 693 DTSMEAVCYYAYWASTELAEERGRYSSYKGSLWDRGILPQDSLKLLAEERGGYLEADMSS 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 753 TMDWDSLRGRIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 813 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 930

Query: 923 LNAV 926
           LNAV
Sbjct: 931 LNAV 934


>gi|330960619|gb|EGH60879.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 970

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 697/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++ ++      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAGRA-TEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +    + ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVAESATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + DFDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLADFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|94312019|ref|YP_585229.1| ribonucleotide-diphosphate reductase subunit alpha [Cupriavidus
           metallidurans CH34]
 gi|93355871|gb|ABF09960.1| Ribonucleoside-diphosphate reductase alpha subunit [Cupriavidus
           metallidurans CH34]
          Length = 979

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/906 (60%), Positives = 692/906 (76%), Gaps = 18/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V SF+P+KI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++   +
Sbjct: 39  KLIRRNGAVVSFEPNKIAVAMTKAFLAVNGGQGAGSARVREIVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPI--APKLKI 147
               HIED+QD VE +LM+SG H++ R YVLYRE+R+  RA Q+++++ A +  A     
Sbjct: 99  GGTFHIEDVQDHVELALMRSGEHEVARAYVLYREKRTQERA-QANAQAVARVQEAGVSFN 157

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           + D+G     +   L  +++ ACSGL + VS++ +L ET KN+YDG+  + +  + I ++
Sbjct: 158 VTDNGVTYQLDLVALHALIDNACSGLGKAVSAEPILKETLKNLYDGVPMTQVYDSAILAA 217

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTLIEK+P Y++VTAR LL  +R+E+L        + T  EM   Y EYF ++I  G++A
Sbjct: 218 RTLIEKDPAYSQVTARILLHTIRKEILGA------EVTQTEMATKYAEYFPKFIARGIEA 271

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL E +  +DL  L   L   RDF F YLGLQ LYDRYFLH++  RIEMPQAFFMRVAM
Sbjct: 272 ELLDEKLATYDLARLGAALDASRDFQFNYLGLQTLYDRYFLHVDEVRIEMPQAFFMRVAM 331

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL+E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ A
Sbjct: 332 GLALEEKDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIYEA 391

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 392 LKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKG 451

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP  
Sbjct: 452 AVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPAS 511

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD  GK FE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITFKDP
Sbjct: 512 CPDLHDKVGKAFEQAYLGYEAKAANGELKLFKKVPAMQLWRKMLGMLFETGHPWITFKDP 571

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKL 621
           CNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+ KL
Sbjct: 572 CNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLMQQADGTYVLDHAKL 631

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             TIRTA+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  LH+L  PYAS  AV+
Sbjct: 632 QKTIRTAMRMLDNVIDINYYAVEKARNSNLRHRPVGMGIMGFQDCLHVLRTPYASDAAVK 691

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            AD SME + ++A  AS ELA+ERG YS+++GSLWD+G+ P DS+ LLAE R   L ++ 
Sbjct: 692 FADTSMEAVCYYAYQASTELAEERGRYSTYEGSLWDRGILPQDSLKLLAEERGGYLDVDL 751

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           +S + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FT
Sbjct: 752 SSTMDWDSLRGRIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT 811

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E+A
Sbjct: 812 VVNDYLVRDLKERGLWDEVMVADLKYFDGSLARIDRIPQDLRDIYATAFEVEPTWLVEAA 871

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           SRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST++   
Sbjct: 872 SRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTVQ--R 929

Query: 921 GKLNAV 926
           G LNAV
Sbjct: 930 GSLNAV 935


>gi|330880141|gb|EGH14290.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330966560|gb|EGH66820.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 970

 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  TI  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTIDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADSSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW QG+ P+DS  +L E R +  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSQGILPLDSQQILIEQRGQKYIDVDLKESLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|296160507|ref|ZP_06843323.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. Ch1-1]
 gi|295889256|gb|EFG69058.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           sp. Ch1-1]
          Length = 1001

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/902 (60%), Positives = 679/902 (75%), Gaps = 19/902 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  R    H        P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARG---HDDQIVANTPGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E ACS L D VS+  +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREIL------EEEVTQTEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LS+F FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSTFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKFGAEFEKAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLVLDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV+ A
Sbjct: 629 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVKFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELAQERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRGILPQDSVKLLAEARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWTELRSRIATYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LN 924
           LN
Sbjct: 927 LN 928


>gi|167904348|ref|ZP_02491553.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei NCTC 13177]
          Length = 956

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/908 (60%), Positives = 687/908 (75%), Gaps = 17/908 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRTLDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVPVT 929
            LNAVP +
Sbjct: 930 ALNAVPTS 937


>gi|28868877|ref|NP_791496.1| ribonucleoside-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28852116|gb|AAO55191.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|331016766|gb|EGH96822.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 970

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAGRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  TI  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTIDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADSSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW QG+ P+DS  +L E R +  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSQGILPLDSQQILIEQRGQKYIDVDLKESLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|53720600|ref|YP_109586.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei K96243]
 gi|53726101|ref|YP_104056.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei ATCC 23344]
 gi|67643594|ref|ZP_00442339.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Burkholderia mallei GB8 horse 4]
 gi|76810342|ref|YP_334882.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 1710b]
 gi|121601276|ref|YP_991781.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei SAVP1]
 gi|124384186|ref|YP_001027274.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei NCTC 10229]
 gi|126439753|ref|YP_001060485.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 668]
 gi|126448585|ref|YP_001082789.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           mallei NCTC 10247]
 gi|126454560|ref|YP_001067749.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 1106a]
 gi|134280283|ref|ZP_01766994.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 305]
 gi|166998594|ref|ZP_02264452.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei PRL-20]
 gi|167825889|ref|ZP_02457360.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 9]
 gi|217420768|ref|ZP_03452273.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 576]
 gi|226196789|ref|ZP_03792368.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813880|ref|YP_002898331.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide
           reductase) [Burkholderia pseudomallei MSHR346]
 gi|242315545|ref|ZP_04814561.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106b]
 gi|254178878|ref|ZP_04885532.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 10399]
 gi|254180585|ref|ZP_04887183.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1655]
 gi|254190978|ref|ZP_04897484.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254199123|ref|ZP_04905538.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei S13]
 gi|254202775|ref|ZP_04909138.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei FMH]
 gi|254208117|ref|ZP_04914467.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei JHU]
 gi|254257988|ref|ZP_04949042.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710a]
 gi|254299328|ref|ZP_04966778.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 406e]
 gi|52211014|emb|CAH37002.1| putative ribonucleoside reductase [Burkholderia pseudomallei
           K96243]
 gi|52429524|gb|AAU50117.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 23344]
 gi|76579795|gb|ABA49270.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710b]
 gi|121230086|gb|ABM52604.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei SAVP1]
 gi|124292206|gb|ABN01475.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei NCTC 10229]
 gi|126219246|gb|ABN82752.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 668]
 gi|126228202|gb|ABN91742.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106a]
 gi|126241455|gb|ABO04548.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei NCTC 10247]
 gi|134248290|gb|EBA48373.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 305]
 gi|147747022|gb|EDK54099.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei FMH]
 gi|147752011|gb|EDK59078.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei JHU]
 gi|157809187|gb|EDO86357.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 406e]
 gi|157938652|gb|EDO94322.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160694792|gb|EDP84800.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei ATCC 10399]
 gi|169656953|gb|EDS88350.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei S13]
 gi|184211124|gb|EDU08167.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1655]
 gi|217396180|gb|EEC36197.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 576]
 gi|225931049|gb|EEH27057.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237505593|gb|ACQ97911.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide
           reductase) [Burkholderia pseudomallei MSHR346]
 gi|238524966|gb|EEP88396.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Burkholderia mallei GB8 horse 4]
 gi|242138784|gb|EES25186.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1106b]
 gi|243065277|gb|EES47463.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           mallei PRL-20]
 gi|254216677|gb|EET06061.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           pseudomallei 1710a]
          Length = 995

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/908 (60%), Positives = 687/908 (75%), Gaps = 17/908 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVPVT 929
            LNAVP +
Sbjct: 930 ALNAVPTS 937


>gi|152979866|ref|YP_001354669.1| ribonucleotide-diphosphate reductase subunit alpha
           [Janthinobacterium sp. Marseille]
 gi|151279943|gb|ABR88353.1| ribonucleoside-diphosphate reductase alpha chain [Janthinobacterium
           sp. Marseille]
          Length = 963

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/900 (60%), Positives = 681/900 (75%), Gaps = 14/900 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKIS A+ KAF+AV G   + S RV+++++ LT   V  L++   +
Sbjct: 39  RIIRRNGAVVGFEPSKISIAVTKAFLAVNGGQGAASARVRELVEQLTSNVVNALVRRQPA 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q  +K   P+A   ++ +
Sbjct: 99  GGTFHIEDIQDQVELALMRSGEHDVARAYVLYRAKRMEERAQQQAAK---PVAETHQLHV 155

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            +DG     +  ++  ++  AC GL+  V ++ +L ET KN+YDG+   +L  + I ++R
Sbjct: 156 TEDGQRRPLDMNQVRDLINAACIGLEKHVDAEAILHETVKNLYDGVPVEELHKSAILAAR 215

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
            L+EK+P Y+ VTAR L+  +R+EV         +    +    Y EYF ++I++G++A 
Sbjct: 216 ALMEKDPAYSTVTARLLMHTIRKEVFGL------EVAQADAPAQYLEYFPKFIKKGIEAE 269

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  L + L  ERD  F YLGLQ LYDRYFLHI  +RIEMPQAF+MRVAMG
Sbjct: 270 LLDAKLGQFDLKKLGDALVPERDLQFGYLGLQTLYDRYFLHIRDTRIEMPQAFYMRVAMG 329

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E  +E+RA+EFYNLLSSF FM STPTLFNSGT+  QLSSC+LTTV DDL GI+ A+
Sbjct: 330 LALNEINREERAIEFYNLLSSFDFMSSTPTLFNSGTQRSQLSSCYLTTVADDLDGIYEAI 389

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+LAKY+GGLGNDWTPVR LGAHI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 390 KENALLAKYAGGLGNDWTPVRSLGAHIKGTNGRSQGVVPFLKVVNDTAVAVNQGGKRKGA 449

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP + 
Sbjct: 450 VCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGEWTLFSPSDA 509

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD  GK FE AY  YE +A RGE+K+F+KI A+ LWRKML+MLFETGHPWITFKDPC
Sbjct: 510 PDLHDKVGKAFEAAYTGYEAKAARGELKLFKKIQALDLWRKMLSMLFETGHPWITFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+N+ AH  + Q D+ KL  T+RT
Sbjct: 570 NIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNMPAHMKDGQLDHVKLQKTVRT 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ  LH++ IPYAS EAV+ AD SM
Sbjct: 630 AMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDCLHMMRIPYASDEAVQFADRSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E + ++A  AS ELA+ERG YSS++GSLWD+G+ P DS+ LL E R   L  + T  L W
Sbjct: 690 EAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDSLKLLQEERGGYLEADLTETLDW 749

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             L++R+K  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FT +N +L
Sbjct: 750 TPLRERIKQFGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTEINEYL 809

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK R LWDE MISDLKY DGS+  I+RIP DL+ I++TAFE++P WL+E+ASRRQKW
Sbjct: 810 VRDLKARGLWDEVMISDLKYFDGSLAKIDRIPQDLRDIYSTAFEVEPKWLVEAASRRQKW 869

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST K   G LNAV
Sbjct: 870 IDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMGATHTEKSTSK--TGALNAV 927


>gi|145588392|ref|YP_001154989.1| ribonucleotide-diphosphate reductase subunit alpha
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145046798|gb|ABP33425.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 993

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/952 (58%), Positives = 703/952 (73%), Gaps = 36/952 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  LL+   +
Sbjct: 51  KIIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRALLRSRPN 110

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK----- 144
               HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ     ++  A +     
Sbjct: 111 GGTFHIEDIQDQVELALMRSGEHNVARAYVLYREKRNQERAAQQEVAQESQSAGQATESG 170

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALI 203
           +K+  D+G     +   L  ++E AC GL + + +  +++ET KN+YDG+  + +  + I
Sbjct: 171 IKVT-DNGVEKWLDMAALRTVIEAACEGLGNHIDATPIITETIKNLYDGVPMAQVYDSAI 229

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            +SRTLIEK+P +++VTAR L+  +R+E+L       ++    +MQ  Y  YF +YI EG
Sbjct: 230 LASRTLIEKDPAFSQVTARILMHVIRKEILG------KEVLQGDMQSEYGTYFAKYINEG 283

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           + A LL   M +FDL  LA  L   RD  F YLGLQ LYDRYFLHI   RIEMPQAFFMR
Sbjct: 284 ISAELLDPRMREFDLPRLAAALNASRDLQFNYLGLQTLYDRYFLHIEDRRIEMPQAFFMR 343

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGL+L E ++E+RA+EFY +LS+F FM STPTLFNS T  PQLSSC+LTTV DDL GI
Sbjct: 344 VAMGLSLNELDRERRAIEFYEILSTFDFMSSTPTLFNSATTRPQLSSCYLTTVEDDLDGI 403

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           + AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGK
Sbjct: 404 YEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGK 463

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIPDLFMKRV +N  WTLFS
Sbjct: 464 RKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMKRVMENGDWTLFS 523

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P    DLHD YGK FE AY  YE++ADRGE+K FR+I A  LWRKML MLFETGHPWITF
Sbjct: 524 PSNTPDLHDKYGKAFEEAYVAYEQKADRGELKPFRRIPAQQLWRKMLGMLFETGHPWITF 583

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---ANNQ--FDY 618
           KDPCNIRSPQQH+GVVHSSNLCTEITLN++  E AVCNLGS+NL AH    AN +   D+
Sbjct: 584 KDPCNIRSPQQHIGVVHSSNLCTEITLNTNETEIAVCNLGSVNLTAHMTTDANGKLVLDH 643

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           +KL  T+RTA+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH+  IPYAS E
Sbjct: 644 EKLQRTVRTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHMQRIPYASEE 703

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LA 737
           AV+ AD SME + ++A  AS ELA+ERG YS++ GSLWD+G+ P DS+ LLA+ R   L 
Sbjct: 704 AVKFADSSMEAVCYYAYQASNELAEERGVYSTYTGSLWDRGILPQDSVALLAQERGGYLE 763

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++ +S + W  L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNL+VKSN+SG
Sbjct: 764 VDNSSTMDWSGLRARIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLFVKSNLSG 823

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTVVN +LV +LK R LWDE MI+DLKY DG++  I+RIP DL+ ++ATAFE++P WL+
Sbjct: 824 EFTVVNEYLVRDLKDRGLWDEVMIADLKYFDGTLSKIDRIPQDLRDLYATAFEVEPSWLV 883

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST+ 
Sbjct: 884 EAASRRQKWIDQAQSLNIYMGGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTV- 942

Query: 918 GVDGKLNAVPV------TDPNSSTHSLGIPSS---CTSDT------ECEVCQ 954
              G+LN+V        TD  +++ + G+ +    CT         ECE CQ
Sbjct: 943 -ASGQLNSVSSGGGVNGTDATAASAAGGVEADGPVCTMRPGDAGFEECEACQ 993


>gi|167912608|ref|ZP_02499699.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 112]
          Length = 953

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/906 (60%), Positives = 686/906 (75%), Gaps = 17/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 930 ALNAVP 935


>gi|167740268|ref|ZP_02413042.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 14]
 gi|167817488|ref|ZP_02449168.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei 91]
 gi|167847375|ref|ZP_02472883.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei B7210]
          Length = 954

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/906 (60%), Positives = 686/906 (75%), Gaps = 17/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL D VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRALDLNALRALIVSACEGLGDAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 930 ALNAVP 935


>gi|298487944|ref|ZP_07005983.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298157495|gb|EFH98576.1| Ribonucleotide reductase of class Ia (aerobic), alpha subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330986741|gb|EGH84844.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 970

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|167721299|ref|ZP_02404535.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           pseudomallei DM98]
          Length = 942

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/913 (59%), Positives = 688/913 (75%), Gaps = 17/913 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R   +     A  +P   I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERV-HAGEAEAAEASPAGGINV 157

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G   + +   L  ++  AC GL + VS + +++ET KN+YDG+  + +  + I ++R
Sbjct: 158 TDNGVTRALDLNALRALIVSACEGLGNAVSPEPIVAETVKNLYDGVPMTQVYDSSILAAR 217

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A 
Sbjct: 218 TMIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMTTRYAEYFPQFLKRGVEAE 271

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 272 LLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 331

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 332 LALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEAL 391

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 392 KDNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 451

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 452 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 511

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 512 PDLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 571

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL 
Sbjct: 572 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLAKQADGSYALDEEKLK 631

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE 
Sbjct: 632 RTVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASDEAVEF 691

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 692 ADRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 751

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           + L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 752 ATLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 811

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 812 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAAS 871

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 872 RRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 929

Query: 922 KLNAVPVTDPNSS 934
            LNAVP +   S 
Sbjct: 930 ALNAVPTSGGTSG 942


>gi|213969510|ref|ZP_03397646.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301385966|ref|ZP_07234384.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058709|ref|ZP_07250250.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato K40]
 gi|302134400|ref|ZP_07260390.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213925606|gb|EEB59165.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. tomato T1]
          Length = 970

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAGRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGRAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  TI  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTIDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +A+ SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQARNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADSSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW QG+ P+DS  +L E R +  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSQGILPLDSQQILIEQRGQKYIDVDLKESLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|320323422|gb|EFW79510.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327619|gb|EFW83631.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330876274|gb|EGH10423.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 970

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|66046946|ref|YP_236787.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. syringae B728a]
 gi|63257653|gb|AAY38749.1| Ribonucleoside-diphosphate reductase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 970

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 696/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRT-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVTAGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE+YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEHYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|91785258|ref|YP_560464.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           xenovorans LB400]
 gi|91689212|gb|ABE32412.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans
           LB400]
          Length = 1001

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/902 (60%), Positives = 677/902 (75%), Gaps = 19/902 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R+  R    H        P L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRTQARG---HDDQIVANTPGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  I+E ACS L D VS+  +++ET KN+YDG+  S +  + I ++RT
Sbjct: 155 DNGVTRPLDMAALRGIIELACSNLGDAVSADPIIAETVKNLYDGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++I+ GV+A L
Sbjct: 215 MIEKDPAYSQVTARILLHTIRREIL------EEEVTQTEMGERYAEYFPQFIKRGVQAEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH +G RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLLQFDLKRLGAALDNNRDLQFGYLGLQTLYDRYFLHHDGVRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LS+F FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYNVLSTFDFMSSTPTLFNSGTRRSQLSSCYLTTVDDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKFGAEFETAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLKEQADGTLVLDHDKLKR 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAV  A
Sbjct: 629 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEEAVRFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELAQERG YSS++GSLWD+G+ P DS+ LLAE R   + ++ + 
Sbjct: 689 DTSMEAVCYYAYYASTELAQERGRYSSYRGSLWDRGILPQDSVKLLAEARGGYVEVDSSE 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + W EL+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 749 SMDWTELRSRIAQYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DG++  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGTLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMGGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 926

Query: 923 LN 924
           LN
Sbjct: 927 LN 928


>gi|330949819|gb|EGH50079.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae Cit 7]
          Length = 970

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/944 (58%), Positives = 694/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|330974388|gb|EGH74454.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 953

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/901 (60%), Positives = 684/901 (75%), Gaps = 8/901 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRT-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVAAGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 V 926
           V
Sbjct: 927 V 927


>gi|82703583|ref|YP_413149.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosospira
           multiformis ATCC 25196]
 gi|82411648|gb|ABB75757.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 956

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/960 (57%), Positives = 705/960 (73%), Gaps = 25/960 (2%)

Query: 11  DEDAFPSLA-YPFPEKIKG-------VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGA 62
           D+   P++A Y F     G        ++I+RNG V  F+P+KIS A+ KAF+AVEG   
Sbjct: 6   DQTPRPAMAGYEFSSNPSGHDPRYSQYKIIRRNGSVAGFEPNKISIAMTKAFLAVEGSQG 65

Query: 63  SRSIRVQDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYR 122
           + S RV++++  LTE  V  L++   S    HIEDIQDQVE +LM+SG H + R YVLYR
Sbjct: 66  AASARVREVVARLTEDVVNALMRRQPSGGTFHIEDIQDQVELALMRSGEHDVARAYVLYR 125

Query: 123 EERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIV 181
           E+R+  RA Q  + +       L ++ +DG  +  ++ RL  ++   C GL + V   ++
Sbjct: 126 EDRARKRAQQKEAGAAEAAGSVLNVL-EDGRRVPLDTARLLALIGSCCEGLGEGVDPALI 184

Query: 182 LSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQ 241
           L  T K++YDG+   ++  ++I S+R L+EKEP Y+ VTAR LL  LR EVL       +
Sbjct: 185 LKATLKDLYDGVPMEEVRKSVILSARALLEKEPAYSYVTARLLLHSLRFEVLG------E 238

Query: 242 KATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQIL 301
           +    EM   Y EYF  +I+ G++A LL E +  FDL  LA  L  ERD  F YLGLQ L
Sbjct: 239 EIVQREMAGRYMEYFPAFIKRGIEAELLDERLAQFDLPRLAQALHAERDLKFGYLGLQTL 298

Query: 302 YDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNS 361
           YDRYFLHI   RIE+PQAFFMRVAMGLAL E ++E RA+EFY++LS+F FM STPTLFNS
Sbjct: 299 YDRYFLHIQERRIELPQAFFMRVAMGLALNEIDREARAIEFYHVLSNFDFMSSTPTLFNS 358

Query: 362 GTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKS 421
           GTR  QLSSC+LTTVPDDL GI+  ++ENA+LAKY+GGLGNDWT VR +G+HI GTNGKS
Sbjct: 359 GTRRSQLSSCYLTTVPDDLDGIYEGIKENALLAKYAGGLGNDWTRVRAMGSHIKGTNGKS 418

Query: 422 QGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNT 481
           QGV+PFLKV +DTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNT
Sbjct: 419 QGVVPFLKVVSDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNT 478

Query: 482 ANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKIS 541
           A W+PDLFMKRV +   WTLFSP +V DLH+ YGK FE AY  YE +  RGE+ +++ I 
Sbjct: 479 ATWVPDLFMKRVMEGGEWTLFSPSDVPDLHEKYGKAFEQAYLAYEDKVARGELDLYKTIP 538

Query: 542 AVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCN 601
           AV LWRKML+MLFETGHPWITFKD CNIRSPQ H+GVVHSSNLCTEITLN++ +E AVCN
Sbjct: 539 AVQLWRKMLSMLFETGHPWITFKDACNIRSPQNHIGVVHSSNLCTEITLNTNDQEIAVCN 598

Query: 602 LGSINLLAHFAN-NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGL 660
           LGSINL AH  +  + D DKL  T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+
Sbjct: 599 LGSINLAAHIDDGGKLDADKLKRTVSLAMRMLDNVIDINFYAVAKARNSNLRHRPVGLGI 658

Query: 661 MGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGV 720
           MGFQ  LH + IPYAS EAVE AD +ME +++HA  AS ELA+ERG Y+S++GSLWD+G+
Sbjct: 659 MGFQDCLHRMRIPYASDEAVEFADRTMEAMAYHAYWASTELAEERGRYASYRGSLWDRGI 718

Query: 721 FPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVS 779
            P D++ LL E R   +  +R+S L W+ L++R++  GMRNSNC+AIAPTATI+NI GVS
Sbjct: 719 LPQDTLDLLQEERGGYIEADRSSTLDWEALRERIRNHGMRNSNCLAIAPTATISNIVGVS 778

Query: 780 QSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPD 839
            SI+P+++NLYVKSN+SG+FT+ N +LV++LK+  LWDE MISD+KY DG++G I+R+P 
Sbjct: 779 ASIEPTFKNLYVKSNLSGEFTIANQYLVSDLKKLGLWDEVMISDIKYFDGALGKIDRVPT 838

Query: 840 DLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKT 899
           +L+K++ATAFE++P WLIE+A+RRQKWIDQ+QSLN+Y+   SGKKLD  Y+ AW+ GLKT
Sbjct: 839 ELRKLYATAFEVEPQWLIEAAARRQKWIDQSQSLNIYIASVSGKKLDETYKLAWVRGLKT 898

Query: 900 TYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTS-----DTECEVCQ 954
           TYYLRS  ATS EKST++   G LNAVP      +  +  +P++  S     D ECE CQ
Sbjct: 899 TYYLRSLGATSAEKSTVQA--GSLNAVPAEGSLPAMGAAAVPATDVSFCSVDDPECESCQ 956


>gi|73542625|ref|YP_297145.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           eutropha JMP134]
 gi|72120038|gb|AAZ62301.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134]
          Length = 979

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/905 (60%), Positives = 684/905 (75%), Gaps = 16/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++I++ LT+  V  L++   S
Sbjct: 39  KIIRRNGAVVAFEPSKINVAMTKAFLAVNGGQGAASARVREIVEQLTQNVVRALVRSRPS 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
              +HIED+QD VE +LM+SG H++ R YVLYRE+R+  RA+ S           ++  +
Sbjct: 99  GGAIHIEDVQDHVELALMRSGEHEVARSYVLYREKRAQERASASAQAVARVQESGIQFNV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D G     +   L  +++ AC+GL + VS++ +L ET KN+Y+G+  + +  + I ++R
Sbjct: 159 TDAGVTKPLDIVALHDLLDTACAGLGKAVSAEPILKETLKNLYEGVPMTQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIEK+P+Y++VTAR LL  +R+E+L        + T  EM   Y EYF ++I  G+ A 
Sbjct: 219 TLIEKDPDYSQVTARILLHTIRKEILGA------EVTQAEMTTRYAEYFPKFIARGIAAE 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL E +  FDL  L   L   RDF F YLGLQ LYDRYFLHI+ +RIEMPQAFFMRVAMG
Sbjct: 273 LLDEKLATFDLARLGAALDAGRDFQFNYLGLQTLYDRYFLHIDETRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LALNEADREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP   
Sbjct: 453 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD  GK FE AY  YE +A  GE+K+F+K+ A+ LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKVGKAFEQAYLGYEAKAASGELKLFKKVPAMQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLA 622
           NIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+ KL 
Sbjct: 573 NIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLTKQADGSYVLDHAKLQ 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TIRTA+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  LH+L  PYAS  AV+ 
Sbjct: 633 KTIRTAMRMLDNVIDINYYAVEKARNSNLRHRPVGMGIMGFQDCLHVLRTPYASDAAVKF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG Y ++ GSLWD+G+ P DS+ LLAE R   L ++ +
Sbjct: 693 ADTSMEAVCYYAYQASTELAEERGRYETYAGSLWDRGILPQDSLKLLAEERGGYLEVDHS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           S + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 SSMDWDSLRGRIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E+AS
Sbjct: 813 VNDYLVRDLKERGLWDEVMVADLKYFDGSLSRIDRIPQDLRDIYATAFEVEPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTVS--RG 930

Query: 922 KLNAV 926
            LNAV
Sbjct: 931 SLNAV 935


>gi|302184854|ref|ZP_07261527.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. syringae 642]
          Length = 970

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMAELYAKALPAYVTAGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|187930115|ref|YP_001900602.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           pickettii 12J]
 gi|187727005|gb|ACD28170.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12J]
          Length = 994

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/904 (60%), Positives = 679/904 (75%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++++   T+  V  LL+   +
Sbjct: 41  KIIRRNGAVVSFEPSKIAVAMTKAFLAVNGGQGAASARVRELVDQQTQNVVRALLRSRPN 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE R+  RA Q+      P    L +  
Sbjct: 101 GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERA-QAGETQQQPAFIGLNVT- 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC GL + V  + +L ET KN+Y+G+  + +  + I +SRT
Sbjct: 159 DGGITRPLDMAALRNVIVSACEGLGEAVDPEPILKETVKNLYEGVPMTQVYDSAILASRT 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 219 LIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMSTRYVDYFPQFIKRGINAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L   L   RDF F YLGLQ LYDRYFLHI+ +RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLAQFDLARLGAALDASRDFQFNYLGLQTLYDRYFLHISETRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 453 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKVGKAFEQAYLAYEDKVARGEIKLFKKMPALQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ-----FDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D++KL  
Sbjct: 573 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVKQADGSVVLDHEKLKK 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ ALH+L +PYAS  AV+ A
Sbjct: 633 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGMGIMGFQDALHVLRVPYASDAAVQFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS+KGSLWD+G+ P DS+ LLAE R   L  + +S
Sbjct: 693 DTSMEAVCYYAYWASTELAEERGRYSSYKGSLWDRGILPQDSLKLLAEERGGYLEADMSS 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 753 TMDWDSLRGRIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P+WL+E+ASR
Sbjct: 813 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPLWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 930

Query: 923 LNAV 926
           LNAV
Sbjct: 931 LNAV 934


>gi|257485934|ref|ZP_05639975.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|331010342|gb|EGH90398.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 970

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/944 (58%), Positives = 695/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRT-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|289648391|ref|ZP_06479734.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. 2250]
          Length = 970

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/944 (58%), Positives = 694/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQH GVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHAGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTIN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|289628679|ref|ZP_06461633.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|330866024|gb|EGH00733.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 970

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/944 (58%), Positives = 694/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQH GVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHAGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|146282011|ref|YP_001172164.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           stutzeri A1501]
 gi|145570216|gb|ABP79322.1| ribonucleoside reductase, large chain [Pseudomonas stutzeri A1501]
          Length = 961

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/953 (58%), Positives = 705/953 (73%), Gaps = 21/953 (2%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           P LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  L
Sbjct: 16  PDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARL 72

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE ++  R + S S
Sbjct: 73  TEQVTATFRRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREAQAVKRKSASGS 132

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
              A   P +++   DG+    +  RL+ I+ EAC GL +V   ++  ET KN+YDG++E
Sbjct: 133 SDIAQPHPSIRVTRADGSQQPLDMGRLQTIITEACEGLAEVDGALIERETLKNLYDGVAE 192

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            D+ TAL+ ++RTL+E+EPNY++VTAR L++ LR E L  +    + ATHHEM  LY + 
Sbjct: 193 KDVNTALVMTARTLVEREPNYSQVTARLLMDTLRAEALGFL-GVAESATHHEMADLYAKA 251

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
              YIE+GV+  LL   +  +DL  L   L +ERD  F YLGLQ LYDRYF+H +  R E
Sbjct: 252 LPAYIEKGVEFELLDSKLKSYDLAKLGAALNHERDQQFTYLGLQTLYDRYFIHKDNVRFE 311

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTT
Sbjct: 312 LPQIFFMRVAMGLAIEEEQKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCYLTT 371

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL GI+ ++++NA+L+K++GGLGNDWTPVR LGA+I GTNGKSQGV+PFLKV NDTA
Sbjct: 372 VPDDLGGIYDSIRDNALLSKFAGGLGNDWTPVRALGAYIKGTNGKSQGVVPFLKVVNDTA 431

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV  
Sbjct: 432 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFD 491

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSP +V DLHDL G+ FE  YE YE     G+IK+F+ + A  LWRKML+MLFE
Sbjct: 492 DGPWTLFSPSDVPDLHDLTGRAFEERYEYYEELTKYGKIKLFKTLPAKDLWRKMLSMLFE 551

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H  + +
Sbjct: 552 TGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLVNHIVDGK 611

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D  KL  T+RTAVR+LDNVIDIN +++ +A+ +N  HR +GLG+MGFQ AL+L HI Y 
Sbjct: 612 LDAAKLERTVRTAVRMLDNVIDINYYSVPQAQNANFKHRPVGLGIMGFQDALYLQHIAYG 671

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S  A++ AD+SME IS+ AI AS +LA ERGAYSSF+GSLW +G+ P+DS  +L E R +
Sbjct: 672 SDAAIDFADKSMEAISYFAIQASCDLADERGAYSSFEGSLWSKGILPLDSQQILIEARGQ 731

Query: 736 --LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             + ++ +  L W  +++RVK  G+RNSN MAIAPTATI+NI GVSQSI+P+YQNLYVKS
Sbjct: 732 KYIDVDLSESLDWAPVRERVKK-GIRNSNIMAIAPTATISNIVGVSQSIEPTYQNLYVKS 790

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTV+N +LV++LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE++ 
Sbjct: 791 NLSGEFTVINPYLVHDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFEVET 850

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EK
Sbjct: 851 KWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEK 910

Query: 914 STLKGVDGKLNAVP-----------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           ST+    GKLNAV                 +      +P +C+ D  +CE CQ
Sbjct: 911 STIN--TGKLNAVSSGGSEAANSASAAPAAAEPKPAPVPLACSIDNPDCEACQ 961


>gi|167837967|ref|ZP_02464826.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           thailandensis MSMB43]
          Length = 956

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/907 (59%), Positives = 684/907 (75%), Gaps = 15/907 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQTVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R     + +    A     + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERVHAGEAAAVESSAAGGINVT 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G   + +   L  ++  AC GL D V+ + +++ET KN+YDG+  + +  + I ++RT
Sbjct: 159 DNGVTRALDLNALRALIVSACEGLGDAVNPEPIVAETVKNLYDGVPMTQVYDSSILAART 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y EYF ++++ GV+A L
Sbjct: 219 MIEKDPAYSQVTARVLLHTIRREILG------EEVTQAEMATRYAEYFPQFLKRGVEAEL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 ALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 DNALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 453 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKFGAEFEAAYVGYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D +KL  
Sbjct: 573 VRSPQQHVGVVHSSNLCTEITLNTSDAEIAVCNLGSVNLVAHLAKQADGTYALDEEKLKR 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  PYAS EAVE A
Sbjct: 633 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASGEAVEFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ ++
Sbjct: 693 DRSMEAVCYYAYWASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTSA 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L+ R+ + GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 753 TLDWPALRARIDSFGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 813 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 930

Query: 923 LNAVPVT 929
           LNAVP +
Sbjct: 931 LNAVPTS 937


>gi|212212092|ref|YP_002303028.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii CbuG_Q212]
 gi|212010502|gb|ACJ17883.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           CbuG_Q212]
          Length = 941

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/929 (60%), Positives = 698/929 (75%), Gaps = 20/929 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +   
Sbjct: 30  LRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRWP 89

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S  +VHIE IQD+VE +LM +G HK  R YVLYREER   R  Q  S+++  I     I 
Sbjct: 90  SGGVVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAENTI----HIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++RT
Sbjct: 146 LDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTART 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++   
Sbjct: 206 LVENEPNYTYVTARLLLHDLYREVLNGL-NLPQDLMHEDIAHYYPEAFKNFIRHGIETEH 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMGL
Sbjct: 265 LHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMGL 324

Query: 329 ALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           A  E E + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GAL
Sbjct: 325 AQSEGEARNERAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGAL 384

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKGA
Sbjct: 385 KDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKGA 444

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDEV
Sbjct: 445 VCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDEV 504

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD C
Sbjct: 505 PDLHDKFGEAFEIAYVAYEEKAHRGEIRS-KTISALSLWRKILSMLFETGHPWVTFKDAC 563

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +T
Sbjct: 564 NIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTKT 623

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+SM
Sbjct: 624 AIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQSM 683

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R +    N    L W
Sbjct: 684 ETISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLDW 743

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           + L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +L
Sbjct: 744 NALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPYL 803

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQKW
Sbjct: 804 VRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQKW 863

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA 
Sbjct: 864 IDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA- 920

Query: 927 PVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
            VT  N+       P++C   D +CE CQ
Sbjct: 921 -VTGQNN-------PNACAIDDPDCEACQ 941


>gi|124268398|ref|YP_001022402.1| ribonucleotide-diphosphate reductase subunit alpha [Methylibium
           petroleiphilum PM1]
 gi|124261173|gb|ABM96167.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum
           PM1]
          Length = 971

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/960 (57%), Positives = 701/960 (73%), Gaps = 34/960 (3%)

Query: 17  SLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLT 76
           S A P      G Q+I+RNG V +F+P+KI+ A+MKAF+AV G   + S  V++++  LT
Sbjct: 24  SRAAPGSSAYAGYQIIRRNGAVVAFEPNKIAVALMKAFLAVHGTQGAASASVREMVDGLT 83

Query: 77  EQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK 136
           E  V  LL+        HIED+QD VE  LM+ GHH+I R YVLYRE R+  RA Q    
Sbjct: 84  ESVVRALLRSRPGGGTFHIEDVQDAVELGLMRGGHHEIARAYVLYRERRAQERAKQGA-- 141

Query: 137 SDAPIAPKLKI-MMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLS 194
             AP+ P + + ++D G  +  ++ RL+ +VE AC+ L  +V +  +L+ET +N+YDG+ 
Sbjct: 142 --APVTPAVALHVIDRGQRVPLDTGRLQALVESACANLGSEVQAAPILAETQRNLYDGVP 199

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPE 254
             ++  A I ++RTLIEK+P Y + TAR LL  +RRE+L        +  H EMQ  Y +
Sbjct: 200 IDEVYKAAILAARTLIEKDPAYTRATARLLLHTIRREILGG------EVLHEEMQQRYAD 253

Query: 255 YFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRI 314
           YF  +I++GV+A LL E +M +DL  L   LK +RD  F+YLGLQ LYDRYFLH+  +RI
Sbjct: 254 YFPGFIKQGVEAELLDERLMQYDLRRLGEALKADRDLQFDYLGLQTLYDRYFLHVRKARI 313

Query: 315 EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
           E+PQAFFMRVAMGLAL E ++E RA+EFY +LSSF FM STPTLFNSGTR  QLSSC+LT
Sbjct: 314 ELPQAFFMRVAMGLALNEVDREARAIEFYEVLSSFDFMSSTPTLFNSGTRRSQLSSCYLT 373

Query: 375 TVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDT 434
           TV DDL GI+ A++ENA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDT
Sbjct: 374 TVADDLDGIYEAIKENALLSKFAGGLGNDWTPVRALGSHIKGTNGESQGVVPFLKVVNDT 433

Query: 435 AVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVT 494
           AVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV 
Sbjct: 434 AVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVI 493

Query: 495 QNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLF 554
           +   WTLFSP    DLHD +G  FE AY  YE++ADRGE+K+++++ A  LWRKML+MLF
Sbjct: 494 EGGDWTLFSPSTCPDLHDKFGIAFEQAYTAYEQKADRGELKLYKRVPAKDLWRKMLSMLF 553

Query: 555 ETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN 614
           ETGHPWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL  H  + 
Sbjct: 554 ETGHPWITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNGSEIAVCNLGSVNLAQHLMHG 613

Query: 615 ----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
               + D+ KL  T+ TA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ +L+ L
Sbjct: 614 AEGLEIDHAKLRKTVSTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDSLYQL 673

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
            I YAS +AVE AD SME + +HA  AS ELA+ERG YSS+KGSLWD+G+ PIDS+ LLA
Sbjct: 674 RIAYASQQAVEYADRSMEAVCYHAYWASTELAEERGRYSSYKGSLWDRGILPIDSLDLLA 733

Query: 731 EVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNL 789
           E R   + ++R++ L WD L+ R++  GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL
Sbjct: 734 EQRGGYVDVDRSTSLDWDALRARIQQHGMRNSNCVAIAPTATISNIIGVDASIEPSFSNL 793

Query: 790 YVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAF 849
            VKSN+SG+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P++LK ++ATAF
Sbjct: 794 SVKSNLSGEFTVINEYLVRDLKKLGLWDDVMVMDLKHFDGSLRRIDRVPEELKSLYATAF 853

Query: 850 EIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSAT 909
           E++P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  AT
Sbjct: 854 EVEPTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWQRGLKTTYYLRTVGAT 913

Query: 910 SVEKSTLKGVDGKLNAVPVTDPN---------------SSTHSLGIPSSCTSDTECEVCQ 954
             EKST+K   G LNAV                     SS  +  +      D  CE CQ
Sbjct: 914 HAEKSTVKA--GHLNAVSSGSGGVDAVAAAAQAQFDAASSVPATDMKFCAIDDPTCEACQ 971


>gi|71734708|ref|YP_275880.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|71555261|gb|AAZ34472.1| ribonucleoside-diphosphate reductase, alpha subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 970

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/944 (58%), Positives = 694/944 (73%), Gaps = 23/944 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC  L +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACESLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  + ++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYIDVDLKETLD 749

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +
Sbjct: 750 WAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPY 808

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQK
Sbjct: 809 LVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQK 868

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNA
Sbjct: 869 WIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNA 926

Query: 926 VPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           V          ++  P               +C  D  +CE CQ
Sbjct: 927 VSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 970


>gi|29654844|ref|NP_820536.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii RSA 493]
 gi|161831609|ref|YP_001597388.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii RSA 331]
 gi|29542112|gb|AAO91050.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           RSA 493]
 gi|161763476|gb|ABX79118.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 331]
          Length = 941

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/929 (60%), Positives = 697/929 (75%), Gaps = 20/929 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +   
Sbjct: 30  LRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRWP 89

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   VHIE IQD+VE +LM +G HK  R YVLYREER   R  Q  S+++  I     I 
Sbjct: 90  SGGAVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAENTI----HIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++RT
Sbjct: 146 LDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTART 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++   
Sbjct: 206 LVENEPNYTYVTARLLLHDLYREVLNGL-NLPQDLMHEDIAHYYPEAFKNFIRHGIETEH 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMGL
Sbjct: 265 LHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMGL 324

Query: 329 ALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           A  E E + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GAL
Sbjct: 325 AQSEGEARNQRAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGAL 384

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKGA
Sbjct: 385 KDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKGA 444

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDEV
Sbjct: 445 VCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDEV 504

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD C
Sbjct: 505 PDLHDKFGEAFEIAYVAYEEKAHRGEIRS-KTISALSLWRKILSMLFETGHPWVTFKDAC 563

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +T
Sbjct: 564 NIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTKT 623

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+SM
Sbjct: 624 AIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQSM 683

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R +    N    L W
Sbjct: 684 ETISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLDW 743

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           + L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +L
Sbjct: 744 NALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPYL 803

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQKW
Sbjct: 804 VRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQKW 863

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA 
Sbjct: 864 IDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA- 920

Query: 927 PVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
            VT  N+       P++C   D +CE CQ
Sbjct: 921 -VTGQNN-------PNACAIDDPDCEACQ 941


>gi|327480259|gb|AEA83569.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           stutzeri DSM 4166]
          Length = 960

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/913 (59%), Positives = 694/913 (76%), Gaps = 9/913 (0%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           P LA   P +++   VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  L
Sbjct: 16  PDLAATAPGQLR---VIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARL 72

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TEQ      +   S   +HIE+IQDQVE +LM++G  K+ R+YV+YRE ++  R + S S
Sbjct: 73  TEQVTATFRRRMPSGGTIHIEEIQDQVELALMRAGEQKVARDYVIYREAQAVKRKSASGS 132

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
              A   P +++   DG+    +  RL+ I+ EAC GL +V   ++  ET KN+YDG++E
Sbjct: 133 SDIAQPHPSIRVTRADGSQQPLDMGRLQTIITEACEGLAEVDGALIERETLKNLYDGVAE 192

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
            D+ TAL+ ++RTL+E+EPNY++VTAR L++ LR E L  +    + ATHHEM  LY + 
Sbjct: 193 KDVNTALVMTARTLVEREPNYSQVTARLLMDTLRAEALGFL-GVAESATHHEMADLYAKA 251

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
              YIE+GV+  LL   +  +DL  L   L +ERD  F YLGLQ LYDRYF+H +  R E
Sbjct: 252 LPAYIEKGVEFELLDSKLKSYDLAKLGAALNHERDQQFTYLGLQTLYDRYFIHKDNVRFE 311

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQ FFMRVAMGLA++E +KE RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTT
Sbjct: 312 LPQIFFMRVAMGLAIEEEQKEARAIEFYNLLSSFDYMASTPTLFNAGTLRPQLSSCYLTT 371

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL GI+ ++++NA+L+K++GGLGNDWTPVR LGA+I GTNGKSQGV+PFLKV NDTA
Sbjct: 372 VPDDLGGIYDSIRDNALLSKFAGGLGNDWTPVRALGAYIKGTNGKSQGVVPFLKVVNDTA 431

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV  
Sbjct: 432 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFD 491

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSP +V DLHDL G+ FE  YE YE     G+IK+F+ + A  LWRKML+MLFE
Sbjct: 492 DGPWTLFSPSDVPDLHDLTGRAFEERYEYYEELTKYGKIKLFKTLPAKDLWRKMLSMLFE 551

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPW+TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H  + +
Sbjct: 552 TGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLVNHIKDGK 611

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D  KL  T+RTAVR+LDNVIDIN +++ +A+ +N  HR +GLG+MGFQ AL+L HI Y 
Sbjct: 612 LDAAKLERTVRTAVRMLDNVIDINYYSVPQAQNANFKHRPVGLGIMGFQDALYLQHIAYG 671

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S  A++ AD+SME IS++AI AS +LA ERGAYSSF+GSLW +G+ P+DS  +L E R +
Sbjct: 672 SDAAIDFADKSMEAISYYAIQASCDLADERGAYSSFEGSLWSKGILPLDSQQILIEARGQ 731

Query: 736 --LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             + ++ +  L W  +++RVK  G+RNSN MAIAPTATI+NI GVSQSI+P+YQNLYVKS
Sbjct: 732 KYIDVDLSESLDWAPIRERVKK-GIRNSNIMAIAPTATISNIVGVSQSIEPTYQNLYVKS 790

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTV+N +LV++LK R LWD  M++DLKY+DGS+  IERIP DLK ++ATAFE++ 
Sbjct: 791 NLSGEFTVINPYLVHDLKARGLWDPVMVNDLKYYDGSVQQIERIPQDLKDLYATAFEVET 850

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            W++++ASRRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EK
Sbjct: 851 KWIVDAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEK 910

Query: 914 STLKGVDGKLNAV 926
           ST+    GKLNAV
Sbjct: 911 STIN--TGKLNAV 921


>gi|153208311|ref|ZP_01946690.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154706203|ref|YP_001423854.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii Dugway 5J108-111]
 gi|165919213|ref|ZP_02219299.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 334]
 gi|212219267|ref|YP_002306054.1| ribonucleotide-diphosphate reductase subunit alpha [Coxiella
           burnetii CbuK_Q154]
 gi|120576095|gb|EAX32719.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154355489|gb|ABS76951.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           Dugway 5J108-111]
 gi|165917074|gb|EDR35678.1| ribonucleoside-diphosphate reductase, alpha subunit [Coxiella
           burnetii RSA 334]
 gi|212013529|gb|ACJ20909.1| ribonucleoside-diphosphate reductase alpha chain [Coxiella burnetii
           CbuK_Q154]
          Length = 941

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/929 (60%), Positives = 697/929 (75%), Gaps = 20/929 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++V+KR+G V  +D ++I+ A+ KAF+AVEG+ A+ S RVQ+I+  LT+Q      +   
Sbjct: 30  LRVVKRDGRVVKYDANRITIAMKKAFLAVEGETAAESGRVQEIVSRLTDQITDLFHKRWP 89

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   VHIE IQD+VE +LM +G HK  R YVLYREER   R  Q  S+++  I     I 
Sbjct: 90  SGGAVHIETIQDKVELALMYAGLHKAARAYVLYREERRKQREEQKASEAENTI----HIT 145

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           +DDG  I  +   L  +V  ACS L+ V +  +L ET  N++DG++  D+   L+ ++RT
Sbjct: 146 LDDGATILLDQSWLARMVHSACSDLEGVDAVKILEETKNNLFDGVALKDVYKGLVMTART 205

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E EPNY  VTAR LL  L REVL  +   PQ   H ++   YPE F  +I  G++   
Sbjct: 206 LVENEPNYTYVTARLLLHDLYREVLNGL-NLPQDLMHEDIAHYYPEAFKNFIRHGIETEH 264

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           LH ++  FDL YLA  LK ERD  F YL LQ LYDRY +H    RIE+PQ FFMRVAMGL
Sbjct: 265 LHPNLQTFDLNYLAQALKPERDQQFTYLSLQTLYDRYLIHHQQVRIELPQVFFMRVAMGL 324

Query: 329 ALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           A  E E + +RAVEFYN+LSSF FM STPTLFNSGT  PQLSSCFLTTVPD L GI+GAL
Sbjct: 325 AQSEGEARNERAVEFYNVLSSFDFMSSTPTLFNSGTVFPQLSSCFLTTVPDSLDGIYGAL 384

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+KY+GGLGNDWTPVR +GA+I GTNGKS GV+PFL VA+ TA+AVNQGGKRKGA
Sbjct: 385 KDNALLSKYAGGLGNDWTPVRAMGAYIKGTNGKSLGVVPFLNVADATAIAVNQGGKRKGA 444

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV ++  WTLFSPDEV
Sbjct: 445 VCAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPDEV 504

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G+ FEIAY  YE +A RGEI+  + ISA++LWRK+L+MLFETGHPW+TFKD C
Sbjct: 505 PDLHDKFGEAFEIAYVAYEEKAHRGEIRS-KTISALSLWRKILSMLFETGHPWVTFKDAC 563

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           NIRSPQQHVGV+HSSNLCTEITLN+S EE AVCNLGSINL+ H  + + D +KLA T +T
Sbjct: 564 NIRSPQQHVGVIHSSNLCTEITLNTSREEIAVCNLGSINLVNHMKDGKLDTEKLARTTKT 623

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN +++ +A+ SN  HR IGLGLMGFQ AL+L +IPYAS  AV+ AD+SM
Sbjct: 624 AIRMLDNVIDINYYSVPQARTSNLKHRPIGLGLMGFQDALYLQNIPYASEAAVQFADQSM 683

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPW 746
           E IS++AI AS+ELA+ERG Y +F  SLW QG+ PIDSI LL + R +    N    L W
Sbjct: 684 ETISYYAIQASMELAKERGPYETFNNSLWSQGILPIDSIQLLKKSRGKYFEQNTDQTLDW 743

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           + L+K+V   GMRNSN MAIAPTATI+NICG+SQSI+P+YQNL+VKSN+SG+FTV+N +L
Sbjct: 744 NALRKQVVAHGMRNSNVMAIAPTATISNICGISQSIEPTYQNLFVKSNLSGEFTVINPYL 803

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V ELK R LWD  M+ DLKY++GS+  I+RIP +LKK++ATAFE++P WL+E+ASRRQKW
Sbjct: 804 VRELKSRQLWDNVMVHDLKYYNGSVQKIDRIPAELKKLYATAFEVEPRWLVEAASRRQKW 863

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+ EPSGKKLD +YR AWL GLKTTYYLRS  AT  EK+T+   D  LNA 
Sbjct: 864 IDQAQSLNLYMAEPSGKKLDVLYRMAWLRGLKTTYYLRSMGATGTEKATIH--DTTLNA- 920

Query: 927 PVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
            VT  N+       P++C   D +CE CQ
Sbjct: 921 -VTGQNN-------PNACAIDDPDCEACQ 941


>gi|134095933|ref|YP_001101008.1| ribonucleotide-diphosphate reductase subunit alpha [Herminiimonas
           arsenicoxydans]
 gi|133739836|emb|CAL62887.1| Ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Herminiimonas arsenicoxydans]
          Length = 966

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/941 (58%), Positives = 685/941 (72%), Gaps = 29/941 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++++RNG V  F+PSKIS A+ KAF+AV G   + S RV+++++ LT   V  L++   +
Sbjct: 39  RILRRNGAVVGFEPSKISIAVTKAFLAVNGGQGAASARVRELVEQLTTNVVNALMRRQPA 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+SG H + R YVLYR +R + RA Q  +K       +L +  
Sbjct: 99  GGTFHIEDIQDQVELALMRSGEHDVARAYVLYRFKRMEERAQQQAAKPVVETEHQLHVT- 157

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           ++G     +  ++  ++  AC GL+  V +  +L ET KN+YDG+   +L  + I ++R 
Sbjct: 158 ENGQRRPLDMNQVRDLITAACIGLEKHVDADAILRETVKNLYDGVPVEELHKSAILAARA 217

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+EK+P Y+ VTAR L+  +R+EV        ++         Y  YF  +I++G+ A L
Sbjct: 218 LMEKDPAYSTVTARLLMHTIRKEVFG------REVAQANAPAEYLVYFAEFIKKGIAAEL 271

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   + +FDL  LA+ LK ERD  F YLGLQ LYDRYFLHI   RIEMPQAF+MRVAMGL
Sbjct: 272 LDAKLGEFDLKKLADALKPERDLQFGYLGLQTLYDRYFLHIADQRIEMPQAFYMRVAMGL 331

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E  +E+RA+EFYNLLSSF FM STPTLFNSGT+  QLSSC+LTTV DDL GI+ A++
Sbjct: 332 ALNEANREERAIEFYNLLSSFDFMSSTPTLFNSGTQRSQLSSCYLTTVADDLGGIYDAIK 391

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+LAKY+GGLGNDWTPVR LGAHI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 392 ENALLAKYAGGLGNDWTPVRSLGAHIKGTNGRSQGVVPFLKVVNDTAVAVNQGGKRKGAV 451

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +  
Sbjct: 452 CAYLETWHMDIEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGEWTLFSPSDAP 511

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +A RGE+K+F+KI A+ LWRKML+MLFETGHPWITFKDPCN
Sbjct: 512 DLHDKVGKAFEEAYTGYEAKAARGELKLFKKIQALDLWRKMLSMLFETGHPWITFKDPCN 571

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+N+ AH  + + D+ KL  TIRTA
Sbjct: 572 IRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNMPAHMKDGKLDHVKLQKTIRTA 631

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH++ IPYAS +AV+ AD SME
Sbjct: 632 MRMLDNVIDINYYAVNKARDSNLRHRPVGMGIMGFQDCLHMMRIPYASNDAVQFADNSME 691

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            + ++A  AS ELA+ERG YSS+KGSLWD+G+ P DS+ LLA+ R    L  + +    W
Sbjct: 692 AVCYYAYYASTELAEERGRYSSYKGSLWDRGILPQDSLKLLADERGAKYLEADYSETFDW 751

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FT +N +L
Sbjct: 752 TPLRARIKEFGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTEINEYL 811

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK R LWDE MISDLKY DGS+  I+RIP DL+ I+ATAFE++P WL+E+ASRRQKW
Sbjct: 812 VRDLKARGLWDEVMISDLKYFDGSLAKIDRIPQDLRDIYATAFEVEPSWLVEAASRRQKW 871

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST K   G LNAV
Sbjct: 872 IDQAQSLNIYMSGASGKKLDDTYKLAWLRGLKTTYYLRTMGATHTEKSTSK--TGALNAV 929

Query: 927 PVTDPNSSTHSLGIPSSCTSD-------------TECEVCQ 954
                +    S    S+  +D              ECE CQ
Sbjct: 930 ----DSGGGSSTAAQSAAETDGPACILRPGDAGFEECEACQ 966


>gi|171463020|ref|YP_001797133.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192558|gb|ACB43519.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 990

 Score = 1138 bits (2943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/949 (58%), Positives = 696/949 (73%), Gaps = 33/949 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  LL+   +
Sbjct: 51  KIIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRALLRSRPN 110

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK----- 144
               HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAAQ     +   A +     
Sbjct: 111 GGTFHIEDIQDQVELALMRSGEHNVARAYVLYREKRNQERAAQQEVSQEVQTANQAGESG 170

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALI 203
           +K+  D+G     +   L  ++E AC GL   + +  +++ET KN+YDG+  + +  + I
Sbjct: 171 IKVT-DNGVEKWLDMAALRTVMEAACEGLGTHIDASPIVTETIKNLYDGVPMAQVYDSAI 229

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            +SRTLIEK+P Y++VTAR L+  + +E+L       ++    +MQ  Y  YF +YI EG
Sbjct: 230 LASRTLIEKDPAYSQVTARILMHVIHKEILG------KEVLQGDMQAEYSTYFAKYINEG 283

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           + A LL   M +FDL  LA  L   RD  F YLGLQ LYDRYFLHI   RIEMPQAFFMR
Sbjct: 284 ISAELLDPRMREFDLPRLAAALNASRDLQFNYLGLQTLYDRYFLHIEDRRIEMPQAFFMR 343

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGL+L E ++E+RA+EFY +LS+F FM STPTLFNS T  PQLSSC+LTTV DDL GI
Sbjct: 344 VAMGLSLNELDRERRAIEFYEILSTFDFMSSTPTLFNSATTRPQLSSCYLTTVEDDLDGI 403

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           + AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGK
Sbjct: 404 YEALKENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGK 463

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM+T+NWIPDLFMKRV +N  WTLFS
Sbjct: 464 RKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMSTSNWIPDLFMKRVMENGEWTLFS 523

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P    DLH  +GK FE AY  YE++ADRGE+K FR+I A  LWRKML MLFETGHPWITF
Sbjct: 524 PSNTPDLHGKFGKAFEEAYVAYEQKADRGELKPFRRIPAQQLWRKMLGMLFETGHPWITF 583

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---ANNQ--FDY 618
           KDPCNIRSPQQH+GVVHSSNLCTEITLN++ +E AVCNLGS+NL AH    AN +   D+
Sbjct: 584 KDPCNIRSPQQHIGVVHSSNLCTEITLNTNEDEIAVCNLGSVNLTAHMTTDANGKMILDH 643

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           +KL  T+RTA+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH+  IPYAS E
Sbjct: 644 EKLQRTVRTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHMQRIPYASDE 703

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LA 737
           AV+ AD SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA  R   L 
Sbjct: 704 AVKFADSSMEAVCYYAYQASNELAEERGVYSTYKGSLWDRGILPQDSVALLAAERGGYLE 763

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++ +S + W+ L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNL+VKSN+SG
Sbjct: 764 VDSSSTMDWNGLRARIKQYGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLFVKSNLSG 823

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FTVVN +LV +LK R LWDE MI+DLKY DG++  I+RIP DL+ ++ATAFE+DP WL+
Sbjct: 824 EFTVVNEYLVRDLKDRGLWDEVMIADLKYFDGTLSKIDRIPQDLRDLYATAFEVDPTWLV 883

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E+ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ +AT VEKST+ 
Sbjct: 884 EAASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMAATHVEKSTV- 942

Query: 918 GVDGKLNAVPV------TDPNSSTHSLGIPSSCTSDT------ECEVCQ 954
              G+LNAV        TD  ++         CT         ECE CQ
Sbjct: 943 -ASGQLNAVSSGGGVNGTDAAAAGGVEADGPVCTMRPGDAGFEECEACQ 990


>gi|325983071|ref|YP_004295473.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           sp. AL212]
 gi|325532590|gb|ADZ27311.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           sp. AL212]
          Length = 954

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/931 (58%), Positives = 697/931 (74%), Gaps = 15/931 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V +F+P KIS A+ KAF+AV+G   + S+RV++++ NLT+  V  LL+    
Sbjct: 33  RVIRRNGAVVTFEPGKISVALTKAFIAVDGGQGAASVRVREVVVNLTQDVVNALLRRQPD 92

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
           +   HIEDIQDQVE +LM+SG H + R YVLYREER+  RA     KS A  A ++  +M
Sbjct: 93  SGTFHIEDIQDQVELALMRSGEHDVARAYVLYREERTRERARLKQ-KSTAETAAEVLYVM 151

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G  +  +  +L  ++E +C+GL + V   ++L  T K++YDG+   ++  +LI S+R 
Sbjct: 152 DNGQRVPLDVAKLSALIETSCAGLGNAVDPALILKATLKDLYDGVPIDEVRKSLILSARV 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y+ VTAR LL+ +R EVL        + +   M+  Y EYF  +I+ G++A L
Sbjct: 212 LIEKDPAYSYVTARLLLDNVRYEVLGA------EVSQQAMKSHYQEYFPAFIKRGIEADL 265

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L+  L  +RD  F+YLGLQ LYDRYFLHI   RIE+PQAFFMRVAMGL
Sbjct: 266 LDQRLAQFDLARLSEALDADRDLQFDYLGLQTLYDRYFLHIKEQRIELPQAFFMRVAMGL 325

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 326 ALNEIDREARAIEFYQVLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVPDDLDGIYESIK 385

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+LAKY+GGLGNDWT VR +GA I GTNGKSQGV+PFLKV +DTAVAVNQGGKRKGAV
Sbjct: 386 ENALLAKYAGGLGNDWTAVRAMGARIKGTNGKSQGVVPFLKVVSDTAVAVNQGGKRKGAV 445

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE WH+D+EEFL+LRKNTGDDRRRTHDMNTA WIPDLFMKRV +   WTLFSP +V 
Sbjct: 446 CAYLECWHLDIEEFLELRKNTGDDRRRTHDMNTATWIPDLFMKRVMEGGDWTLFSPSDVP 505

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLH+ +G++FE AY  YE + +RGE+++++KI AV LWRKML+MLFETGHPWITFKDPCN
Sbjct: 506 DLHEKFGQQFEQAYLGYEARIERGELELYKKIPAVQLWRKMLSMLFETGHPWITFKDPCN 565

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQ H+GVVHSSNLCTEITLN++ +E AVCNLGS+NL+AH  +   D DKL  TI   
Sbjct: 566 VRSPQNHIGVVHSSNLCTEITLNTNDKEIAVCNLGSVNLVAHLKDGALDLDKLKRTIHVV 625

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  LH L IPY SP AVE AD SME
Sbjct: 626 MRMLDNVIDINFYAVAKARNANLKHRPVGLGIMGFQDCLHQLGIPYGSPAAVEFADRSME 685

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            +++ A  AS ELAQERG YS++KGSLWD+G+ P D++ +L + R   +  + ++ L WD
Sbjct: 686 AVAYQAYWASTELAQERGCYSTYKGSLWDRGILPHDTLTVLQQERGGYVEADLSATLDWD 745

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++R+K  GMRNSNC+AIAPTATI+NI GVS SI+P+YQNLYVKSN+SG+FT+ N  LV
Sbjct: 746 ALRQRIKLHGMRNSNCLAIAPTATISNIVGVSASIEPTYQNLYVKSNLSGEFTITNRSLV 805

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
           N+LK+ +LWDE MISDLKY DG+I  I+RIPD+++ ++ATAFE+DP+WLIE+ +RRQKWI
Sbjct: 806 NDLKKLNLWDEVMISDLKYFDGAISKIDRIPDNIRTLYATAFEMDPLWLIEAGARRQKWI 865

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQ+QSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLRS  AT+ EKST++   G LNAVP
Sbjct: 866 DQSQSLNIYMGGVSGKKLDETYKLAWLRGLKTTYYLRSMGATAAEKSTVRA--GSLNAVP 923

Query: 928 ----VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
               +        ++ I      D  CE CQ
Sbjct: 924 ADGGIVKAAVEVSTVEIKYCAIDDESCESCQ 954


>gi|330815477|ref|YP_004359182.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           gladioli BSR3]
 gi|327367870|gb|AEA59226.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           gladioli BSR3]
          Length = 993

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/905 (60%), Positives = 678/905 (74%), Gaps = 16/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V +F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 39  KVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQSVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   RA  S +  + P       + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERA-HSDAPVETPDGSSGLTVT 157

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     + K L  +V  AC GL   V+   +++ET KN+YDG+  S +  + I ++RT
Sbjct: 158 DKGVSRPLDMKALHGLVAAACEGLGSAVNPDPIVAETVKNLYDGVPLSQVYDSAILAART 217

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++    EMQ  Y EYF ++++ GV+A L
Sbjct: 218 MIEKDPAYSQVTARILLHTIRREILG------EEVAQGEMQARYAEYFPQFLKRGVEAEL 271

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDLV L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAF+MRVAMGL
Sbjct: 272 LDDKLLQFDLVRLGEALDASRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFYMRVAMGL 331

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFYN+LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 332 ALNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 391

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 392 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 451

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 452 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCP 511

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGE+K+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 512 DLHDKFGAEFEAAYLGYEEKVARGELKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCN 571

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH A         D+DKL  
Sbjct: 572 IRSPQQHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLVAHLAKQADGSYALDHDKLKR 631

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  P++S  AVE A
Sbjct: 632 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPFSSDTAVEFA 691

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS+ GSLWD+G+ P D++ LL E R   + ++ + 
Sbjct: 692 DRSMEAVCYYAYWASTELAEERGRYSSYTGSLWDRGILPQDTLKLLEEARGGYVEVDMSE 751

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNL+VKSN+SG+FTVV
Sbjct: 752 SLDWTSLRGRISVHGMRNSNCIAIAPTATISNIIGVSPCIEPTFQNLFVKSNLSGEFTVV 811

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 812 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEAASR 871

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+++   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 872 RQKWIDQAQSLNIFMAGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 929

Query: 923 LNAVP 927
           LNAVP
Sbjct: 930 LNAVP 934


>gi|167586059|ref|ZP_02378447.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ubonensis Bu]
          Length = 990

 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/909 (59%), Positives = 678/909 (74%), Gaps = 20/909 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R    H+  +AP       + 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLER---QHAGEEAPAVESAGGIN 155

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +D+G     +   L  ++  AC GL   V+   +++ET KN+YDG+  S +  + I ++
Sbjct: 156 VVDNGVTRPLDLNALRALIVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAA 215

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RT+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A
Sbjct: 216 RTMIEKDPAYSQVTARILLHTIRREILG------EEVVQAEMSTRYAEYFPQFLKRGVDA 269

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH++GSRIEMPQAFFMRVAM
Sbjct: 270 GLLDDKLLQFDLKRLGDALDANRDLQFGYLGLQTLYDRYFLHVDGSRIEMPQAFFMRVAM 329

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ A
Sbjct: 330 GLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEA 389

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 390 LKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKG 449

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP  
Sbjct: 450 AVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPST 509

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDP
Sbjct: 510 CPDLHDKFGAEFETAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDP 569

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKL 621
           CN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL
Sbjct: 570 CNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKL 629

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             T+  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE
Sbjct: 630 KRTVSVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASQAAVE 689

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ 
Sbjct: 690 FADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDT 749

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           +  L W EL+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FT
Sbjct: 750 SESLDWSELRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT 809

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M++DLKY DG +  I+R+P DL+ I+ATAFE+DP WL+E+A
Sbjct: 810 VVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRVPADLRAIYATAFEVDPTWLVEAA 869

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           SRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    
Sbjct: 870 SRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AH 927

Query: 921 GKLNAVPVT 929
           G LNAVP +
Sbjct: 928 GALNAVPTS 936


>gi|330980157|gb|EGH78343.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 971

 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/945 (58%), Positives = 695/945 (73%), Gaps = 24/945 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYI-EEGVKAR 267
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+   G+K  
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVTPAGIKFE 269

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMG
Sbjct: 270 LLNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMG 329

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+
Sbjct: 330 LAIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAI 389

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
            +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 390 HDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 449

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV
Sbjct: 450 VCAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEV 509

Query: 508 SDLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
            DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDP
Sbjct: 510 PDLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDP 569

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+ 
Sbjct: 570 CNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVD 629

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
            AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD S
Sbjct: 630 VAVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTS 689

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L
Sbjct: 690 MEAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETL 749

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            W  ++ RV+  G+RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N 
Sbjct: 750 DWAPVRARVQK-GIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINP 808

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV +LK RDLWD  MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQ
Sbjct: 809 YLVRDLKARDLWDSVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQ 868

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLN
Sbjct: 869 KWIDQAQSLNLYIAGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLN 926

Query: 925 AVPVTDPNSSTHSLGIP--------------SSCTSD-TECEVCQ 954
           AV          ++  P               +C  D  +CE CQ
Sbjct: 927 AVSSGGHGPDDSAITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 971


>gi|300690380|ref|YP_003751375.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum PSI07]
 gi|299077440|emb|CBJ50066.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum PSI07]
          Length = 987

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/903 (60%), Positives = 676/903 (74%), Gaps = 17/903 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE R+  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERA-QAGETQQPPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+GL + V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMAALRNLIVSACAGLGEAVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++VTAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQVTARILLHTIRREILG------EEVTQAEMAARYADYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  L   L   RD  F YLGLQ L+DRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDEKLAQFDLAKLGAALDASRDLQFNYLGLQTLFDRYFLHISEKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDRESRAIEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGKAFETAYLGYEEKVARGEIKLFKKMPAMQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVTQADGSVALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYAS  AV+ A
Sbjct: 629 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDALHVLRIPYASDAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA+ R   L  + +S
Sbjct: 689 DNSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGILPQDSLKLLAQERGGYLEADLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 SMDWDSLRARIQQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNA 925
           LNA
Sbjct: 927 LNA 929


>gi|297538243|ref|YP_003674012.1| ribonucleoside-diphosphate reductase subunit alpha [Methylotenera
           sp. 301]
 gi|297257590|gb|ADI29435.1| ribonucleoside-diphosphate reductase, alpha subunit [Methylotenera
           sp. 301]
          Length = 938

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/933 (60%), Positives = 692/933 (74%), Gaps = 18/933 (1%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVI+RNG    F   KIS AI KAF+AVEG  +  S RV+D +  L++     L++   
Sbjct: 17  LQVIRRNGAAVQFTLDKISIAITKAFLAVEGNQSGASQRVRDQVATLSQLVNNALMRRLP 76

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           +   +HIEDIQDQVE +LM++G+H + R YVLYRE+R+  RAA+  S     ++  L + 
Sbjct: 77  AGGSIHIEDIQDQVELALMRNGNHDVARAYVLYREKRNAERAAEKASHPTTELSHTLNVN 136

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D G LI  + K+L  +V EAC  L DV +  IV+ +  +++YDG+  +++  ALI S+R
Sbjct: 137 ID-GKLIPLDIKQLNEMVGEACLNLGDVVNPSIVVEQAVRDLYDGIPFTEVYKALILSAR 195

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           +LIE EP Y  VTAR  L+ +R EVL       ++ +H +M   Y EYF RYI+ G+ A 
Sbjct: 196 SLIETEPAYNYVTARLQLDLVRAEVLG------ERVSHAQMDEHYAEYFPRYIKMGINAE 249

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  LA  L  +RDF F YLG+Q LYDRYFLHI   RIE+PQ FFMRVAMG
Sbjct: 250 LLDSRLAQFDLTKLAAALNKDRDFQFGYLGIQTLYDRYFLHIEERRIELPQIFFMRVAMG 309

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA+ E ++E RA+EFYN+LSSF FM STPTLFN+GT H QLSSC+LTTV DDL GI+  +
Sbjct: 310 LAINEIDRESRAIEFYNVLSSFDFMSSTPTLFNAGTLHSQLSSCYLTTVSDDLDGIYQGI 369

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENAML KY+GGLGNDWTPVR LGA I GTNGKSQGVIPFLKV NDTAVAVNQGGKRKGA
Sbjct: 370 KENAMLQKYAGGLGNDWTPVRSLGARIKGTNGKSQGVIPFLKVVNDTAVAVNQGGKRKGA 429

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC YLETWH+D+EEFLDLRKNTGDDRRRTHDMNTA+WIPDLFM+RVT+   WTLFSP +V
Sbjct: 430 VCGYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTAHWIPDLFMRRVTEAGDWTLFSPSDV 489

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD YGK FE AY  YER+A+ GEIK+F+KI A+ +WRKML+MLFETGHPWITFKDPC
Sbjct: 490 PDLHDKYGKAFETAYVEYERRAENGEIKLFKKIPALQMWRKMLSMLFETGHPWITFKDPC 549

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ----FDYDKLAS 623
           NIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NLL H A        D DKL +
Sbjct: 550 NIRSPQQHVGVVHSSNLCTEITLNTSETEIAVCNLGSVNLLQHLAEVNGKLVLDNDKLQA 609

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI+  +R+LDNV+DIN + + KA+ +N  HR +G+G+MGFQ+ LH + IPYAS EAVE A
Sbjct: 610 TIKIGMRMLDNVVDINFYPVGKARNANTRHRPVGMGIMGFQNCLHAMRIPYASMEAVEFA 669

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTS 742
           D +ME + ++A  AS  LA+ER AYSSFKGSLWDQG+ P+D++ LL   R   + ++R+ 
Sbjct: 670 DRAMEMVCYNAYYASTVLAEERAAYSSFKGSLWDQGILPLDTLDLLLNERGGNVEVDRSK 729

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L WD L+ R++ +GMRNSNC+AIAPTATI+NI GVS SI+P YQNLYVKSN+SG+FT+V
Sbjct: 730 TLDWDALRNRIQKVGMRNSNCVAIAPTATISNIVGVSASIEPEYQNLYVKSNLSGEFTIV 789

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N  LV +LK R LWD  M+SDLKY DGS+  I+R+P DLK+++ATAF++DP WLIE+A+R
Sbjct: 790 NEQLVIDLKARGLWDAVMVSDLKYFDGSLQKIDRVPADLKQLYATAFDVDPTWLIEAAAR 849

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLNLY   PSGKKL+  Y  AW  GLKTTYYLRS  AT+ EKST  G  G+
Sbjct: 850 RQKWIDQAQSLNLYFAVPSGKKLNDTYLLAWQRGLKTTYYLRSMGATAAEKST--GSGGE 907

Query: 923 LNAVPVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           LNAV      +    L  P  C+ D  ECE CQ
Sbjct: 908 LNAVSAGLEEAPKEYL--PKVCSIDNPECESCQ 938


>gi|92112800|ref|YP_572728.1| ribonucleotide-diphosphate reductase subunit alpha
           [Chromohalobacter salexigens DSM 3043]
 gi|91795890|gb|ABE58029.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens
           DSM 3043]
          Length = 976

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/906 (60%), Positives = 676/906 (74%), Gaps = 10/906 (1%)

Query: 23  PEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTR 82
           P++++   VIKR G V +FD SKIS AI KAF+A EG  A+ S R+++ +   T+  V  
Sbjct: 17  PQRLR---VIKRGGEVAAFDGSKISVAITKAFIATEGDNAAASSRIREFVSEATQSIVDT 73

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
            L+       +HIEDIQDQVE +LM++G  K+ R YVLYREE +  RA Q      A   
Sbjct: 74  FLRRMPDGGTLHIEDIQDQVELALMRAGEQKVARAYVLYREEHA--RARQPQGADIAKPH 131

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETAL 202
           P L +   DGT+   +  R+E +V +AC GL +V  + ++  + KN+YDG+    + TAL
Sbjct: 132 PSLNVTQADGTVRPLDLGRVETLVADACEGLANVEPQKIVDASLKNLYDGVPIDGVATAL 191

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           + ++RTL+EKEPNY   TAR L + LRRE L+ +     +AT+ EM  LY   F  YI++
Sbjct: 192 MMTARTLVEKEPNYTYATARLLQDNLRREALSFL-GIADEATYQEMATLYAPAFKAYIDK 250

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           G++   L E + +FDL  L   L + RD  F YLGLQ LYDRYFLH +  R E+PQ  FM
Sbjct: 251 GIEFEQLDERLREFDLDRLGAALDHTRDNQFTYLGLQTLYDRYFLHHDDVRYELPQVMFM 310

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLAL E + E RA+EFY LLSSF +M STPTLFN+GT+  QLSSC+LTTVPD L G
Sbjct: 311 RVAMGLALNEDDPEARAIEFYELLSSFDYMASTPTLFNAGTQRSQLSSCYLTTVPDQLDG 370

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           I+ A+++NA+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGG
Sbjct: 371 IYSAIRDNALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGG 430

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVCAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV  +  WTLF
Sbjct: 431 KRKGAVCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFDDEEWTLF 490

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SP    DLHDLYG  FE  Y  YE     G++K+F+++ A  LWRKML+MLFETGHPWIT
Sbjct: 491 SPSTCPDLHDLYGAAFEKRYAEYEEMTRNGQLKLFKRVKAKDLWRKMLSMLFETGHPWIT 550

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
           FKDPCN+RSPQ H GVVHSSNLCTEITLN+S++E AVCNLGS+NL  H  + Q D DKL 
Sbjct: 551 FKDPCNLRSPQNHAGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAQHIVDGQLDGDKLK 610

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T++TAVR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L I YAS +AV  
Sbjct: 611 KTVKTAVRMLDNVIDINYYAVPQARNSNFKHRPVGLGLMGFQDALYQLGIAYASDDAVTF 670

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNR 740
           AD SME IS+HAI AS +LA ERG Y SF+GSLW +GV PIDSI  LAE R  D + ++ 
Sbjct: 671 ADTSMELISYHAIEASSDLATERGRYQSFEGSLWSKGVLPIDSIAKLAEERGADYIEVDT 730

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           ++   W  L+ +V   GMRNSN MAIAPTATI+NICGV+QSI+P+YQNL+VKSN+SG+FT
Sbjct: 731 STTQDWARLRDKVTRQGMRNSNVMAIAPTATISNICGVTQSIEPTYQNLFVKSNLSGEFT 790

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN+++VN+LK R LWDE MI+DLKY+DGS+  I+RIPDDLK  +A+AFE++P WL+E+A
Sbjct: 791 VVNAYMVNDLKARGLWDEVMINDLKYYDGSVQPIDRIPDDLKARYASAFEVEPKWLVEAA 850

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           +RRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+  ATSVEKST+    
Sbjct: 851 ARRQKWIDQAQSLNLYIAGVSGKKLDVTYRMAWFRGLKTTYYLRALGATSVEKSTVD--R 908

Query: 921 GKLNAV 926
           GKLNAV
Sbjct: 909 GKLNAV 914


>gi|325001022|ref|ZP_08122134.1| ribonucleoside-diphosphate reductase alpha chain [Pseudonocardia
           sp. P1]
          Length = 927

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/911 (60%), Positives = 678/911 (74%), Gaps = 21/911 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VI+R+G  TSFD SKIS A+ KAF+AVEG   + S R+  +++ LT Q V  L +H  
Sbjct: 19  LRVIRRDGSETSFDASKISVAMTKAFLAVEGGAGASSSRLHPLVQELTGQVVAALHRHPT 78

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA-PKLKI 147
              +V +E IQDQVE +LM+  HHK+ R YVLYRE+++  RA    S  DA  A   + +
Sbjct: 79  P--VVQVEQIQDQVELALMRGEHHKVARSYVLYREQQAQARA----SGPDAGGASATIHV 132

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
              DGT    +  R+E ++ EA  G+ DV +  VL+E  + +YDG++  +L  AL+ ++R
Sbjct: 133 TGPDGTRAPLDRDRVETVLAEALDGIDDVEAAPVLAELDRTVYDGITADELSQALVMAAR 192

Query: 208 TLIEKEPNYAKVTARFLLEKLRREV---LTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           TL+E+EP+Y+ V +R L+++LR E    L+   + P +AT   M   Y  Y   Y+   +
Sbjct: 193 TLVEREPDYSLVASRLLMDRLRAEAVSHLSGTRETPDQAT---MARDYASYTKDYLRHAI 249

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
              L+   +  FDL  +   L  ERD    +LGLQ LYDRYFLH +G+R E+PQAFF+RV
Sbjct: 250 AIGLVDAELATFDLDRVTAALHPERDLQIGFLGLQTLYDRYFLHEHGTRFELPQAFFLRV 309

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLA++E ++E RA+EFY LLSSF FM STPTLFNSGT  PQLSSCFLTTV DDL  IF
Sbjct: 310 AMGLAVREVDREARAIEFYELLSSFDFMASTPTLFNSGTTRPQLSSCFLTTVDDDLDSIF 369

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
           G  + NA+LAKYSGGLGNDWTPVRGLGAHI GTNG SQGV+PFLK+A DTAVAVNQGGKR
Sbjct: 370 GGYRNNALLAKYSGGLGNDWTPVRGLGAHIRGTNGVSQGVVPFLKIAGDTAVAVNQGGKR 429

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGA CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNTANW+PD F++RV  +  WTLFSP
Sbjct: 430 KGAACAYLETWHVDIEEFLDLRKNTGDDRRRTHDMNTANWVPDEFLRRVEADTTWTLFSP 489

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           DEV DLHDLYG EF   Y  YE  A+RGE++V R + AV LWR+MLTMLFETGHPW+TFK
Sbjct: 490 DEVPDLHDLYGLEFAERYRAYEAAAERGELRVHRTVRAVDLWRRMLTMLFETGHPWVTFK 549

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSS------EETAVCNLGSINLLAHFANNQFDY 618
           DPCN+RSPQQH GVVHSSNLCTEITLN+ +       E AVCNLGS+NL AH   +  D 
Sbjct: 550 DPCNLRSPQQHAGVVHSSNLCTEITLNTRAGHDDDRGEVAVCNLGSVNLAAHVTRDGLDA 609

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           DKL  T+ TAVR+LDNV+DIN +TI +A++SN  HR +GLG+MGF  AL L  I   S  
Sbjct: 610 DKLRRTVTTAVRMLDNVVDINFYTIPEARRSNLRHRPVGLGMMGFSDALFLQRIAPGSEA 669

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DEL 736
           AV  AD S E +S+HAI+AS +LA ERG Y+SF+GSLW +GV PIDS+ LLA+ R   EL
Sbjct: 670 AVGFADVSAEVLSYHAIAASSDLAAERGRYASFEGSLWSRGVLPIDSLDLLADARGEGEL 729

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
            ++R+S L W  L++ V+T GMRNSN +AIAPTATI+NICGV QSI+P + NLYVKSNMS
Sbjct: 730 EIDRSSTLDWASLRETVRTQGMRNSNVLAIAPTATISNICGVGQSIEPIHLNLYVKSNMS 789

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           GDFTVVN  LV +LK+R LWDE M+SDLKY DGS+  I+R+P DLK+++ATAFEI+P WL
Sbjct: 790 GDFTVVNPHLVRDLKERGLWDEVMVSDLKYFDGSLAEIDRVPGDLKELYATAFEIEPRWL 849

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +E+ASRRQKW+DQAQSLNLYL  PSG+KLD +YR AW  GLKTTYYLR+R+ATSVEKSTL
Sbjct: 850 VEAASRRQKWLDQAQSLNLYLAGPSGRKLDELYRLAWRSGLKTTYYLRTRAATSVEKSTL 909

Query: 917 KGVDGKLNAVP 927
           KG DG+L  VP
Sbjct: 910 KGTDGRLTGVP 920


>gi|302877616|ref|YP_003846180.1| ribonucleoside-diphosphate reductase, alpha subunit [Gallionella
           capsiferriformans ES-2]
 gi|302580405|gb|ADL54416.1| ribonucleoside-diphosphate reductase, alpha subunit [Gallionella
           capsiferriformans ES-2]
          Length = 944

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/934 (58%), Positives = 689/934 (73%), Gaps = 26/934 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +V++RNG V  F+P+KIS A+ KAF+AV G  A+ S RV++++  LT+  V  L++    
Sbjct: 28  KVVRRNGSVVVFEPAKISVALTKAFIAVSGGPAAASARVRELVDQLTQGVVIALMRRQPH 87

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              +HIEDIQDQVE  LM+SG H + R YVLYREE S  RA Q+  +  A +   + +  
Sbjct: 88  GGTLHIEDIQDQVELGLMRSGEHDVARAYVLYREEHSRSRA-QTQVQQPAHV---INVTG 143

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
            DG +   +  RL ++V+ AC GL +V  +++VL    K+MYDG+   ++   LI S+R+
Sbjct: 144 KDGVVQPLDLARLSVLVQSACEGLGEVVDAELVLQVALKDMYDGVPLHEVHKCLILSARS 203

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEKEP Y  VTAR LL  +  EVL       +     +M   Y +YF ++I+ G+ A L
Sbjct: 204 MIEKEPAYNFVTARLLLNNICSEVLG------EDVAPADMATRYADYFPKFIKRGIAAEL 257

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  LA +L   RD  F YLGLQ LYDRYFLHI G+RIE PQ FFMRVAMGL
Sbjct: 258 LDEKLAGFDLPRLAAELDASRDLQFGYLGLQTLYDRYFLHIGGTRIEAPQVFFMRVAMGL 317

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY LLS F FMCSTPTLFNSG+R  QLSSC+L+TV D+L GI+ A++
Sbjct: 318 ALNEIDREARAIEFYRLLSGFDFMCSTPTLFNSGSRRSQLSSCYLSTVEDNLEGIYDAIK 377

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+LAK++GGLGNDWTPVR LGAHI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 378 DNALLAKFAGGLGNDWTPVRALGAHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 437

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFLDLRKNTGDDRRRTHDMNT+NWIPDLFMKRV +   WTLFSP +V 
Sbjct: 438 CAYLETWHLDIEEFLDLRKNTGDDRRRTHDMNTSNWIPDLFMKRVMEGGNWTLFSPSDVK 497

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G +FEIAY  YE +A  G+IK+++ + A +LWRKMLTMLFETGHPWITFKDPCN
Sbjct: 498 DLHDLFGIDFEIAYTAYEEKAAAGQIKLYKTVQAASLWRKMLTMLFETGHPWITFKDPCN 557

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF------ANNQFDYDKLA 622
           IRSPQQHVGVVHSSNLCTEITLN++++E AVCNLGS+NL AH          Q D+ KL 
Sbjct: 558 IRSPQQHVGVVHSSNLCTEITLNTNADEIAVCNLGSVNLPAHLYPEGHDLAGQIDHAKLR 617

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI TA+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH L +PY+S EAVE 
Sbjct: 618 RTINTAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHQLRLPYSSMEAVEF 677

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG Y+S+KGSLWD G+ P D++ LL E R   + ++ +
Sbjct: 678 ADRSMEAVCYYAYWASTELAEERGRYASYKGSLWDCGILPQDTLDLLREERGGYVEVDTS 737

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             + WD L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P+YQNL+VKSN+SG+FTV
Sbjct: 738 VSMDWDALRARIGQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLFVKSNLSGEFTV 797

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           +N  LV ELK+  LWDE MISDLKY DGS+  I+RIP +L+ ++ATAFE++P WLIE+AS
Sbjct: 798 INDHLVAELKRLGLWDEVMISDLKYFDGSLAKIDRIPAELRSLYATAFEVEPSWLIEAAS 857

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SG+KLD  Y+ AW+ GLKTTYYLR+  ATS EKST  G  G
Sbjct: 858 RRQKWIDQAQSLNIYMAGVSGRKLDDTYKLAWVRGLKTTYYLRTLGATSAEKST--GRAG 915

Query: 922 KLNAVPVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
            LNAV V D  + T        C+ D  ECE CQ
Sbjct: 916 ALNAVSVGDAPAETTQF-----CSIDNPECEACQ 944


>gi|288941564|ref|YP_003443804.1| ribonucleoside-diphosphate reductase subunit alpha [Allochromatium
           vinosum DSM 180]
 gi|288896936|gb|ADC62772.1| ribonucleoside-diphosphate reductase, alpha subunit [Allochromatium
           vinosum DSM 180]
          Length = 985

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/945 (59%), Positives = 703/945 (74%), Gaps = 20/945 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           VQVI+RNG +T FDPSKI  A+ KAF+AVEG  A  S R+ D +  LTEQ V  L +   
Sbjct: 42  VQVIRRNGQITHFDPSKIMVAMTKAFLAVEGDSAGASSRIHDRVAELTEQVVGALTRRLS 101

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAP-KLKI 147
               VHIEDIQDQVE +LM++G H+I R+YVLYRE R+  RAA+S +++ A   P  + +
Sbjct: 102 GGGTVHIEDIQDQVELALMRAGEHRIARDYVLYREARARERAARSAAETAAIREPHPINV 161

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            + DG+    +   +  ++EE+C  L  V    +LS+T +N++DG+ E+D+  AL+ S+R
Sbjct: 162 TLADGSTRPLDVAHMARLLEESCRDLDAVDPNAILSDTLRNLFDGVREADVRQALVMSAR 221

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIE+EP Y++  AR LL+ LRRE L  +       T  +M   Y +YF  YI+      
Sbjct: 222 TLIEREPQYSQAAARLLLDILRREALGFLDLAVGVETQADMAERYGDYFAAYIKRAADLE 281

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHI-NGSRIEMPQAFFMRVAM 326
            L   +  +DL  L   LK ERD  F YLGLQ LYDRYF+H  +G R E+PQAFFMRVAM
Sbjct: 282 HLDGQLARYDLKRLGAALKPERDLQFTYLGLQTLYDRYFIHTADGIRFELPQAFFMRVAM 341

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLA+ E E+E+RA+EFY LLSSF FMCSTPTLFNSG+  PQLSSCFLTTVPDDL GI+ A
Sbjct: 342 GLAINEIEREERAIEFYELLSSFDFMCSTPTLFNSGSPRPQLSSCFLTTVPDDLDGIYSA 401

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +++NA+L+K++GGLGNDWT VRG+GAHI GTNGKSQGVIPFLKVANDTA+AVNQGG+R+G
Sbjct: 402 IKDNALLSKFAGGLGNDWTRVRGMGAHIKGTNGKSQGVIPFLKVANDTAIAVNQGGRRRG 461

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWHID+EEFLDLRKNTGDDRRRTHDMNTANW+PDLFMKRV ++  WTLFSPDE
Sbjct: 462 AVCAYLETWHIDIEEFLDLRKNTGDDRRRTHDMNTANWVPDLFMKRVAEDGHWTLFSPDE 521

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDL G+ FE AY  YE +A RGE+K+ +++ AV LWRKML MLFETGHPWI FKDP
Sbjct: 522 TPDLHDLTGQAFEQAYVAYEERAARGELKISKRLKAVDLWRKMLAMLFETGHPWIAFKDP 581

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CN+R   QHVGVVHSSNLCTEITL+++  E AVCNLGSINL AH  +   D  +L  T+R
Sbjct: 582 CNLRYTNQHVGVVHSSNLCTEITLHTNDLEAAVCNLGSINLAAHITDKGLDTQRLRRTVR 641

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVID N + + +A+ SN  HR +GLGLMGFQ AL+ L IPYAS EAV  AD+S
Sbjct: 642 TAMRMLDNVIDYNFYNVPQARASNLRHRPVGLGLMGFQDALYRLRIPYASQEAVAFADQS 701

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
            E++S++AI AS +LA ERG Y SF+GSLW QGV PIDSIGL+ + R   L M+ +  L 
Sbjct: 702 TEYLSYYAIEASADLAAERGRYPSFEGSLWSQGVLPIDSIGLMEQGRGGYLQMDTSHTLD 761

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L++R++T+GMRNSNC+AIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTVVN +
Sbjct: 762 WDRLRERIQTVGMRNSNCLAIAPTATISNIVGVSQSIEPTYQNLFVKSNLSGEFTVVNPY 821

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK+R LWD  M++DLKY+DGS+  I+RIPD+LK+++ATAFEIDP WL+E+ASRRQK
Sbjct: 822 LVADLKERGLWDAVMVNDLKYYDGSLLPIDRIPDELKELYATAFEIDPRWLVEAASRRQK 881

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           W+DQAQSLNLY+ EPSGKKLD +Y+ AW+ GLKTTYYLRS  AT VEKST+    G+ N 
Sbjct: 882 WLDQAQSLNLYMQEPSGKKLDNLYKLAWVRGLKTTYYLRSMGATHVEKSTMADT-GRANR 940

Query: 926 VPVTDPNSSTHSLGIPS---------------SCTS-DTECEVCQ 954
           +     N        PS               +C+  D +CE CQ
Sbjct: 941 LSAVGGNYLGRQTAKPSDTTDDTPAAATATPSACSILDPDCEACQ 985


>gi|121606274|ref|YP_983603.1| ribonucleotide-diphosphate reductase subunit alpha [Polaromonas
           naphthalenivorans CJ2]
 gi|120595243|gb|ABM38682.1| ribonucleoside-diphosphate reductase, alpha subunit [Polaromonas
           naphthalenivorans CJ2]
          Length = 967

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/957 (56%), Positives = 698/957 (72%), Gaps = 32/957 (3%)

Query: 19  AYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQ 78
           A P    +   Q+I+RNG V +F+PSKI+ A+MKAF+AV G   + S  V++ +  LT+ 
Sbjct: 22  ATPASGALANYQIIRRNGSVVAFEPSKIAVAMMKAFLAVHGTQGAASASVRETVDTLTQA 81

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
            V  L++   S    HIED+QDQVE  LM+ GHH+I R YVLYRE+ +  RA Q  +++ 
Sbjct: 82  VVRALMRSRPSGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYREKHNQERARQLQAQT- 140

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESD 197
            P  P+L +M D G  ++ + + L+ ++E +C+ L  DV    ++SET +N+YDG+   +
Sbjct: 141 -PALPQLHVM-DGGKRVALDLRNLQALIEASCANLGTDVKPDPIVSETMRNLYDGVPIEE 198

Query: 198 LETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFC 257
           +  A I ++RTLIEK+P+Y   TAR LL  +R+EVL       ++ +H  M   Y  YF 
Sbjct: 199 VYKASILAARTLIEKDPDYTYATARLLLHTIRKEVLD------EEISHEAMAVRYVTYFP 252

Query: 258 RYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMP 317
            +I +G+K  LL E +  FDL  L   LK ERD  F+YLGLQ L+DRYFLHI   RIE+P
Sbjct: 253 EFIAKGIKNELLDEKLQQFDLARLGAALKPERDLQFDYLGLQTLFDRYFLHIRKQRIELP 312

Query: 318 QAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
           QAFFMRVAMGL+L ET++E RA+EFY +LSSF FM STPTLFN+GT   QLSSC+LTTV 
Sbjct: 313 QAFFMRVAMGLSLNETDREARAIEFYEILSSFDFMSSTPTLFNAGTLRSQLSSCYLTTVA 372

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           DDL GI+ A++ENA+L+K++GGLGNDWTPVR +GAHI GTNG+SQGV+PFLKV NDTAVA
Sbjct: 373 DDLGGIYDAIKENALLSKFAGGLGNDWTPVRAMGAHIKGTNGESQGVVPFLKVVNDTAVA 432

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
           VNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIPDLFM+RV +  
Sbjct: 433 VNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMRRVMEKG 492

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            WTLFSP +  DLHD +G++FE AY  YE +A+RGE+K  RK+ A  +WRKML+MLFETG
Sbjct: 493 SWTLFSPSDTPDLHDKFGQDFEKAYVAYEARAERGELKPSRKLQATDMWRKMLSMLFETG 552

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFD 617
           HPWITFKD CNIRSPQQH GVVHSSNLCTEITLN+S+ ETAVCNLGSINL+ H  +   D
Sbjct: 553 HPWITFKDACNIRSPQQHAGVVHSSNLCTEITLNTSATETAVCNLGSINLVQHLKDGALD 612

Query: 618 YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
           +DKL  TI TA+R+LDNVIDIN + +EKA+ SN  HR +GLGLMGFQ  L+ L +PYAS 
Sbjct: 613 HDKLKKTITTAMRMLDNVIDINYYAVEKARHSNMRHRPVGLGLMGFQDCLYELRVPYASQ 672

Query: 678 EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-L 736
            AVE AD SME I +HA  AS ELA+ERG Y S+KGSLWDQG+ P+D++ +LA+ R   +
Sbjct: 673 AAVEFADTSMEAICYHAYWASTELARERGQYESYKGSLWDQGILPLDTLDMLAKERGGYV 732

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
            ++R++ L WD L++++ T GMRNSNC+AIAPTATI+NI GV   I+P + NL VKSN+S
Sbjct: 733 EVDRSATLDWDALRQKIATDGMRNSNCVAIAPTATISNIIGVDACIEPCFGNLSVKSNLS 792

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           G+FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P+D+K ++ATAFEI+  WL
Sbjct: 793 GEFTVINHYLVRDLKKLGLWDDVMVVDLKHFDGSLRPIDRVPNDIKALYATAFEIETSWL 852

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +E+ SRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT  EKST+
Sbjct: 853 VEAGSRRQKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGLKTTYYLRTQSATHAEKSTV 912

Query: 917 KGVDGKLNAVPVTDPN-------------------SSTHSLGIPSSCTSDTECEVCQ 954
           +   GK+N+V                         S+T +  I      D  CE CQ
Sbjct: 913 QA--GKMNSVSSAPAAAMLGMSAIDKAAAAAQAQMSATPATDIKFCAIDDPGCEACQ 967


>gi|149927166|ref|ZP_01915423.1| ribonucleotide-diphosphate reductase alpha subunit [Limnobacter sp.
           MED105]
 gi|149824105|gb|EDM83326.1| ribonucleotide-diphosphate reductase alpha subunit [Limnobacter sp.
           MED105]
          Length = 969

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/935 (57%), Positives = 696/935 (74%), Gaps = 23/935 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S R++++++ +T   V  L++   S
Sbjct: 31  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARIRELVEQMTGSVVNALVRRQPS 90

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
             I HIEDIQDQVE +LM+SG  ++ R YVLYRE R+  RAA+   +++         +M
Sbjct: 91  GGIFHIEDIQDQVELALMRSGEAEVARAYVLYRERRAQERAAKQVEQAEQHALN----VM 146

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
           D       + + L+ ++E A  GL ++    +  ET KN+YDG+   ++  + I +SR +
Sbjct: 147 DGDIKRPLDVEALKALIESAAVGLNEIDVAHLQKETLKNLYDGVKIDEVFKSAILASRAM 206

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE EP+Y  VT+R LL  +RRE++       ++    EM  +YPEYF ++I++G+ A LL
Sbjct: 207 IENEPSYTLVTSRLLLHTIRREIIG------REIAQDEMAQVYPEYFPQFIKKGIAAGLL 260

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
              +  FD+  L   LKYERD  F+YLGLQ LYDRYFLH+ G+RIEMPQAF+MRVAMGLA
Sbjct: 261 DNRLAQFDMKKLGAALKYERDLQFDYLGLQTLYDRYFLHVEGTRIEMPQAFYMRVAMGLA 320

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L E ++E RA+EFY +LS+F FM STPTLFNSGT   QLSSC+LTT+ DDL  I+  ++E
Sbjct: 321 LNEVDREARAIEFYEVLSTFDFMSSTPTLFNSGTIRSQLSSCYLTTIGDDLDDIYEGIKE 380

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVC
Sbjct: 381 NALLSKFAGGLGNDWTPVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVC 440

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +  D
Sbjct: 441 AYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGNWTLFSPSDCPD 500

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LHDLYGK FE AY  YE +A RG++K+F+ + A  LWRK+L+MLFETGHPWITFKDPCNI
Sbjct: 501 LHDLYGKAFEKAYVGYEEKAARGDLKLFKTVEAAKLWRKILSMLFETGHPWITFKDPCNI 560

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF--ANNQ---FDYDKLAST 624
           RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL  H   A+N     D++KL  T
Sbjct: 561 RSPQQHVGVVHSSNLCTEITLNTNENEIAVCNLGSVNLTRHLKPADNGELVLDHEKLQKT 620

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           +  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ ALH++  PYAS +AVE AD
Sbjct: 621 VGVAMRMLDNVIDINYYAVAKARNSNLRHRPVGMGMMGFQDALHMMRKPYASRDAVEFAD 680

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSR 743
           ESME I ++A  AS ELA ERGAYS+FKGSLWD+G+ P+DS+ LL E R   + ++ +SR
Sbjct: 681 ESMEAICYYAYEASTELAAERGAYSTFKGSLWDKGIMPLDSLKLLEEERGGYVEVDTSSR 740

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           + WD L+ R+K  GMRNSNC+AIAPTATI+NI GV+ SI+P++QNLYVKSN+SG+FT+VN
Sbjct: 741 MDWDALRARIKKHGMRNSNCVAIAPTATISNIIGVAASIEPTFQNLYVKSNLSGEFTIVN 800

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
             LV +LK+  +WDE MISDLKY DGS+  I+RIP+DLK+++ATAFE+DP WL+E+A+RR
Sbjct: 801 EHLVRDLKRLGIWDEVMISDLKYFDGSVMKIDRIPEDLKRLYATAFEMDPRWLVEAAARR 860

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQ QSLN+Y+   SGK+LD  Y+ AW+ GLKTTYYLR+  AT  EKSTL G  G+L
Sbjct: 861 QKWIDQGQSLNIYMAGVSGKRLDDTYKLAWIRGLKTTYYLRTIGATHAEKSTLAG--GEL 918

Query: 924 NAVPVTDPNSSTHSLG-----IPSSCTSDTECEVC 953
           N+V      S+  +       +P+    + E +VC
Sbjct: 919 NSVNAEGGASAAFTSAPATGLVPNLPEQEIEGKVC 953


>gi|300703001|ref|YP_003744603.1| ribonucleoside-diphosphate reductase subunit alpha [Ralstonia
           solanacearum CFBP2957]
 gi|299070664|emb|CBJ41959.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum CFBP2957]
          Length = 987

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/903 (60%), Positives = 676/903 (74%), Gaps = 17/903 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE RS  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERA-QAGETQQQPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+GL D V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMAALRNLIVSACAGLGDTVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAARYVDYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L +++  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDDTLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISDKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  G+ FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGRAFEQAYLGYEEKVARGEIKLFKKMPAMQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVQQADGSYALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYA+  AV+ A
Sbjct: 629 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDALHVLRIPYANDAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA+ R   L  + +S
Sbjct: 689 DTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGILPQDSLKLLAQERGGYLETDLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 TMDWDSLRGRIQQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNA 925
           LNA
Sbjct: 927 LNA 929


>gi|221213240|ref|ZP_03586215.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD1]
 gi|221166692|gb|EED99163.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD1]
          Length = 995

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/928 (58%), Positives = 682/928 (73%), Gaps = 19/928 (2%)

Query: 10  GDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           G E   P+LA   P+      +VI+RNG V +F+PSKI+ A+ KAF+AV G   + S RV
Sbjct: 21  GAEQGAPALA---PQATFADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARV 77

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           ++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R   
Sbjct: 78  RELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLE 137

Query: 129 RAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYK 187
           R       +          ++D+G     +   L  ++  AC GL   V+   +++ET K
Sbjct: 138 RQHAGEETAAVRETTGGINVVDNGVTRPLDMNALRALIVSACEGLGAAVNPDPIVAETVK 197

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++    +
Sbjct: 198 NLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------EEVVQAD 251

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFL
Sbjct: 252 MSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQTLYDRYFL 311

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   Q
Sbjct: 312 HVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQ 371

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PF
Sbjct: 372 LSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPF 431

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 432 LKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 491

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWR
Sbjct: 492 LFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKKIPAQQLWR 551

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL
Sbjct: 552 KMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNL 611

Query: 608 LAHFANN-----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           +AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MG
Sbjct: 612 VAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGLGIMG 671

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P
Sbjct: 672 FQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILP 731

Query: 723 IDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
            D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  
Sbjct: 732 QDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATISNIIGVSAC 791

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL
Sbjct: 792 IEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADL 851

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           + I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTY
Sbjct: 852 RAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTY 911

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           YLR+ +AT VEKST+    G LNAVP +
Sbjct: 912 YLRTMAATHVEKSTV--AHGALNAVPTS 937


>gi|17547524|ref|NP_520926.1| ribonucleotide-diphosphate reductase subunit alpha [Ralstonia
           solanacearum GMI1000]
 gi|17429828|emb|CAD16512.1| putative ribonucleoside reductase 1 (large chain) oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 987

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/904 (60%), Positives = 677/904 (74%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE RS  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERA-QAGETQQQPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+GL + V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMAALRNLIVSACAGLGESVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAGRYADYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L +++  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDDTLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISDKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GK FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGKAFEAAYLGYEDKVARGEIKLFKKMPALQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHVVKQADGSYALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYA+  AV+ A
Sbjct: 629 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDALHVLRIPYATDAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+GV P DS+ LLA+ R   L  + +S
Sbjct: 689 DTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGVLPQDSLKLLAQERGGYLEADLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L++R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 TMDWDGLRERIQQHGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|238026166|ref|YP_002910397.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           glumae BGR1]
 gi|237875360|gb|ACR27693.1| Ribonucleotide-diphosphate reductase alpha subunit [Burkholderia
           glumae BGR1]
          Length = 999

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/905 (59%), Positives = 680/905 (75%), Gaps = 16/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V +F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  L++   +
Sbjct: 39  KVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQSVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   RA           A  + +  
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERAHSDAPADAPAGAAGINVT- 157

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC GL   V+   +++ET KN+YDG+  S +  + I ++RT
Sbjct: 158 DAGVTRPLDMGALRGLIASACEGLGSAVNPDPIVAETVKNLYDGVPMSQVYDSAILAART 217

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++ +  EMQ  Y EYF ++++ GV+A L
Sbjct: 218 MIEKDPAYSQVTARILLHTIRREILG------EEVSQGEMQARYAEYFPQFLKRGVEAEL 271

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDLV L   L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMGL
Sbjct: 272 LDDKLLQFDLVRLGEALDAGRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGL 331

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY++LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 332 ALNEIDREARAIEFYHVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 391

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 392 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 451

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP    
Sbjct: 452 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTCP 511

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGE+K+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 512 DLHDKFGAEFEAAYLGYEEKVARGELKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCN 571

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 572 VRSPQQHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLVAHLVKQADGSYALDHDKLKR 631

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LHLL  P++S  AVE A
Sbjct: 632 TVSVAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPFSSDAAVEFA 691

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS EL++ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +S
Sbjct: 692 DRSMEAVCYYAYWASTELSEERGRYSSYRGSLWDRGILPQDTLKLLEEARGGYVEVDMSS 751

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L++R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNL+VKSN+SG+FTVV
Sbjct: 752 SLDWTSLRERISLHGMRNSNCIAIAPTATISNIIGVSPCIEPTFQNLFVKSNLSGEFTVV 811

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 812 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPSDLRAIYATAFEVDPKWLVEAASR 871

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+++   SGKKLD IY+ AW+ GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 872 RQKWIDQAQSLNIFMAGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTV--AHGA 929

Query: 923 LNAVP 927
           LNAVP
Sbjct: 930 LNAVP 934


>gi|161525958|ref|YP_001580970.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           multivorans ATCC 17616]
 gi|221202416|ref|ZP_03575448.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2M]
 gi|221208124|ref|ZP_03581129.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2]
 gi|160343387|gb|ABX16473.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221172027|gb|EEE04469.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2]
 gi|221177693|gb|EEE10108.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           multivorans CGD2M]
          Length = 995

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/928 (58%), Positives = 682/928 (73%), Gaps = 19/928 (2%)

Query: 10  GDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           G E   P+LA   P+      +VI+RNG V +F+PSKI+ A+ KAF+AV G   + S RV
Sbjct: 21  GAEQGAPALA---PQATFADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARV 77

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           ++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R   
Sbjct: 78  RELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLE 137

Query: 129 RAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYK 187
           R       +          ++D+G     +   L  ++  AC GL   V+   +++ET K
Sbjct: 138 RQHAGEETAAVRETTGGINVVDNGVTRPLDMNALRALIVSACDGLGAAVNPDPIVAETVK 197

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++    +
Sbjct: 198 NLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------EEVVQAD 251

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFL
Sbjct: 252 MSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQTLYDRYFL 311

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   Q
Sbjct: 312 HVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQ 371

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PF
Sbjct: 372 LSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPF 431

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 432 LKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 491

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWR
Sbjct: 492 LFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKKIPAQQLWR 551

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL
Sbjct: 552 KMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNL 611

Query: 608 LAHFANN-----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           +AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MG
Sbjct: 612 VAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGLGIMG 671

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P
Sbjct: 672 FQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILP 731

Query: 723 IDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
            D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  
Sbjct: 732 QDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATISNIIGVSAC 791

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL
Sbjct: 792 IEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADL 851

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           + I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTY
Sbjct: 852 RAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTY 911

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           YLR+ +AT VEKST+    G LNAVP +
Sbjct: 912 YLRTMAATHVEKSTV--AHGALNAVPTS 937


>gi|332526549|ref|ZP_08402661.1| ribonucleotide-diphosphate reductase subunit alpha [Rubrivivax
           benzoatilyticus JA2]
 gi|332110817|gb|EGJ10994.1| ribonucleotide-diphosphate reductase subunit alpha [Rubrivivax
           benzoatilyticus JA2]
          Length = 950

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/935 (59%), Positives = 694/935 (74%), Gaps = 17/935 (1%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
           + G Q+I+RNG V +F+P+KI+ A+MKAF+AV G   + S  V++ +  LTE  V  L++
Sbjct: 27  VSGYQIIRRNGSVVAFEPNKIAVALMKAFLAVHGAQGAASASVRETVDQLTEGVVRALVR 86

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
                   HIED+QD VE  LM+ GHH++ R YVLYRE R+  R+ Q+ +   A  AP+L
Sbjct: 87  SRPGGGTFHIEDVQDHVELGLMRGGHHEVARAYVLYRERRAQERSRQAAAPQPA--APEL 144

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIF 204
            ++ D G  +  +   L  +VE+AC+GL +DV ++ +L+ET +N+YDG+   ++  A I 
Sbjct: 145 HVV-DGGQRLPLDLDALRSLVEQACAGLGEDVRAEPILAETRRNLYDGVPLDEVYKAAIL 203

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           +SRTLIEK+P Y + TAR LL  +RRE+L    + P+      M   Y EYF  Y+ +GV
Sbjct: 204 ASRTLIEKDPAYTRATARLLLHTIRREILGADVR-PEA-----MAARYAEYFPAYVRQGV 257

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +A LL E +  FDL  L   LK ERD  F+YLGLQ LYDRYFLH++G RIE+PQAFFMRV
Sbjct: 258 QAELLDEELQRFDLARLGAALKPERDLQFDYLGLQTLYDRYFLHVDGRRIELPQAFFMRV 317

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL E ++E RA+EFY++LSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+
Sbjct: 318 AMGLALNEIDREARAIEFYDVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVSDDLEGIY 377

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            AL+ENA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 378 EALKENALLSKFAGGLGNDWTPVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKR 437

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP
Sbjct: 438 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSP 497

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
               DLHD +G  FE AY  YER+ADRGEI+ F+++ A  LWRKMLTMLFETGHPWITFK
Sbjct: 498 SSCPDLHDKFGAAFEQAYVAYERKADRGEIRPFKRLPARDLWRKMLTMLFETGHPWITFK 557

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           D CN+RSPQQHVGVVHSSNLCTEITLN+S+ E AVCNLGSINL  H A    D  KL  T
Sbjct: 558 DACNLRSPQQHVGVVHSSNLCTEITLNTSAGEIAVCNLGSINLAQHVAGGGIDQAKLKRT 617

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TA+R+LDNVIDIN + ++KA+ +N  HR +GLGLMGFQ  L+ L +PYAS  AVE AD
Sbjct: 618 VSTAMRMLDNVIDINYYAVKKARDANLRHRPVGLGLMGFQDCLYQLRLPYASDAAVEFAD 677

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSR 743
            SME + +HA  AS ELA+ERG YSS++GSLWD+GV P D++ LLA  R   + ++R+  
Sbjct: 678 RSMEALCYHAYWASSELAEERGRYSSYRGSLWDRGVLPQDTLDLLAAERGGHVEVDRSET 737

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L W  L+ R+   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTVVN
Sbjct: 738 LDWAALRARIAVHGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVVN 797

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK+  LWD+ M+ DLK+ DGS+  ++R+PD+LK+++ATAFE+D  WL+E+A+RR
Sbjct: 798 EYLVRDLKRLGLWDDVMVMDLKHFDGSLRAVDRVPDELKQLYATAFEVDARWLVEAAARR 857

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLN+Y+   SGKKLD IY+ AW  GLKTTYYLR+ SAT  EKST+    G +
Sbjct: 858 QKWIDQAQSLNIYMAGASGKKLDEIYKLAWTRGLKTTYYLRTMSATHAEKSTV--APGAM 915

Query: 924 NAVPVTDPNSSTHSLGIPSS---CTSDT-ECEVCQ 954
           NAVP      +  +    S    C+ D  +CE CQ
Sbjct: 916 NAVPRHGGLEAAAAAEPASDVRFCSIDNPDCEACQ 950


>gi|107021672|ref|YP_619999.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           cenocepacia AU 1054]
 gi|116688618|ref|YP_834241.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           cenocepacia HI2424]
 gi|170731917|ref|YP_001763864.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           cenocepacia MC0-3]
 gi|105891861|gb|ABF75026.1| Ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           cenocepacia AU 1054]
 gi|116646707|gb|ABK07348.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           cenocepacia HI2424]
 gi|169815159|gb|ACA89742.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 1001

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/906 (59%), Positives = 674/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGESATGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC GL   V+   +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDQNALRALIVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVVQAEMSTRYAEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGADFEKAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS EAVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASQEAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYHASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWTALRARIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|189349323|ref|YP_001944951.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           multivorans ATCC 17616]
 gi|189333345|dbj|BAG42415.1| ribonucleoside-diphosphate reductase alpha chain [Burkholderia
           multivorans ATCC 17616]
          Length = 997

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/928 (58%), Positives = 682/928 (73%), Gaps = 19/928 (2%)

Query: 10  GDEDAFPSLAYPFPEK-IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           G E   P+LA   P+      +VI+RNG V +F+PSKI+ A+ KAF+AV G   + S RV
Sbjct: 23  GAEQGAPALA---PQATFADYKVIRRNGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARV 79

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           ++++  LT   V  L++   +    HIEDIQDQVE +LM+ G H + R YVLYRE+R   
Sbjct: 80  RELVDQLTRNVVRALVRSRPNGGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLE 139

Query: 129 RAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYK 187
           R       +          ++D+G     +   L  ++  AC GL   V+   +++ET K
Sbjct: 140 RQHAGEETAAVRETTGGINVVDNGVTRPLDMNALRALIVSACDGLGAAVNPDPIVAETVK 199

Query: 188 NMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHE 247
           N+YDG+  S +  + I ++RT+IEK+P Y++VTAR LL  +RRE+L       ++    +
Sbjct: 200 NLYDGVPMSQVYDSAILAARTMIEKDPAYSQVTARILLHTIRREILG------EEVVQAD 253

Query: 248 MQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL 307
           M   Y EYF ++++ GV+A LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFL
Sbjct: 254 MSTRYAEYFPQFLKRGVEAGLLDDKLLQFDLKRLGEALDASRDLQFGYLGLQTLYDRYFL 313

Query: 308 HINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQ 367
           H++G+RIEMPQAFFMRVAMGL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   Q
Sbjct: 314 HVDGTRIEMPQAFFMRVAMGLSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQ 373

Query: 368 LSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPF 427
           LSSC+LTTV DDL GI+ AL+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PF
Sbjct: 374 LSSCYLTTVADDLDGIYEALKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPF 433

Query: 428 LKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPD 487
           LKV NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPD
Sbjct: 434 LKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPD 493

Query: 488 LFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWR 547
           LFMKRV +   WTLFSP    DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWR
Sbjct: 494 LFMKRVMEGGEWTLFSPSTCPDLHDKFGADFEAAYTAYEEKVARGEIKLFKKIPAQQLWR 553

Query: 548 KMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINL 607
           KML MLFETGHPWITFKDPCN+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL
Sbjct: 554 KMLGMLFETGHPWITFKDPCNVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNL 613

Query: 608 LAHFANN-----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMG 662
           +AH           D+DKL  TI  A+R+LDNVIDIN + + KA+ SN  HR +GLG+MG
Sbjct: 614 VAHLVKQPDGTYALDHDKLKRTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGLGIMG 673

Query: 663 FQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFP 722
           FQ  LHLL  PYAS  AVE AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P
Sbjct: 674 FQDCLHLLRTPYASEAAVEFADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILP 733

Query: 723 IDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQS 781
            D++ LLAE R   + ++ +  L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  
Sbjct: 734 QDTLKLLAEARGGYVEVDSSESLDWATLRARIATHGMRNSNCVAIAPTATISNIIGVSAC 793

Query: 782 IDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDL 841
           I+P++QNLYVKSN+SG+FTVVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL
Sbjct: 794 IEPTFQNLYVKSNLSGEFTVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADL 853

Query: 842 KKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTY 901
           + I+ATAFE+DP WL+E+ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTY
Sbjct: 854 RAIYATAFEVDPKWLVEAASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTY 913

Query: 902 YLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           YLR+ +AT VEKST+    G LNAVP +
Sbjct: 914 YLRTMAATHVEKSTV--AHGALNAVPTS 939


>gi|83649536|ref|YP_437971.1| ribonucleotide-diphosphate reductase subunit alpha [Hahella
           chejuensis KCTC 2396]
 gi|83637579|gb|ABC33546.1| Ribonucleotide reductase, alpha subunit [Hahella chejuensis KCTC
           2396]
          Length = 953

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/929 (58%), Positives = 687/929 (73%), Gaps = 8/929 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G    FD  KI+ A+ KAF+AVEG+ AS S RV+D ++ L +  V RL + + 
Sbjct: 30  LQVIKRTGQAAPFDDRKIAMAVTKAFLAVEGQSASGSPRVRDSVEKLVKDIVARLRRRSP 89

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
               VHIE+IQD VE  LM+ G HK+ R YVLYREE +  RA  + S+      P + + 
Sbjct: 90  EGGSVHIEEIQDLVELGLMRGGFHKVARAYVLYREEHARQRAP-APSEQSGETHPDINVK 148

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    N  RL  ++ +AC+ L  VS + VL    KN+Y+G+   D+  AL+ ++R 
Sbjct: 149 FADGSEAPLNMGRLRTVISDACADLDGVSEEKVLQGALKNLYNGVKHKDVNAALVMAARP 208

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIE+EPNY+ V AR LL+ LR E L+ +      AT  EM  LYP  F   +E  V+  L
Sbjct: 209 LIEEEPNYSYVCARLLLDGLREESLSYL-NIAASATEGEMAELYPTAFRAIVERCVEHEL 267

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ FDL  L   LK ERD    YLGLQ LYDRYF+H   +R+E+PQAFFMRVAMGL
Sbjct: 268 LSPELLKFDLERLGAALKPERDRQLTYLGLQTLYDRYFIHWRETRLELPQAFFMRVAMGL 327

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +++E +   RA+EFY+LLSSF +MCSTPTLFN+GT  PQLSSC+LTTVPDDL GI+GA++
Sbjct: 328 SVQEDDPNARAIEFYDLLSSFDYMCSTPTLFNAGTNRPQLSSCYLTTVPDDLEGIYGAIK 387

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+K++GGLGNDWTPVR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 388 DNALLSKWAGGLGNDWTPVRSLGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 447

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMN+ANWIPDLFMKRV ++  WTLFSP +  
Sbjct: 448 CAYLESWHLDIEEFLELRKNTGDERRRTHDMNSANWIPDLFMKRVFEDKEWTLFSPSDAP 507

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG  FE  Y +YE   + G I +F+K+ A  LWRKML+MLFETGHPW+TFKDPCN
Sbjct: 508 DLHDLYGSAFEARYTHYESLVESGAITLFKKVPAQNLWRKMLSMLFETGHPWVTFKDPCN 567

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGS+NL+ H  N + D+D+L +T+ TA
Sbjct: 568 LRSPQQHVGVVHSSNLCTEITLNTSQDEIAVCNLGSVNLVNHIRNGEIDHDRLRNTVYTA 627

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +A+ +N  HR +G+GLMGFQ AL+ L +PY+S EAV  AD+SME
Sbjct: 628 VRMLDNVIDINYYAVPQARNANLRHRPVGMGLMGFQDALYKLGLPYSSVEAVRFADQSME 687

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLPW 746
            IS+ AI+AS  LA+ERG Y +++GSLWDQGV PIDS+  L + R  +   ++R   L W
Sbjct: 688 LISYFAITASSNLAKERGRYETYEGSLWDQGVLPIDSLDRLEQERGAEFCTLDRGHSLDW 747

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             +++ VK  GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTV+N +L
Sbjct: 748 APVRELVKKQGMRNSNVMAIAPTATISNIVGVSQSIEPTYQNLFVKSNLSGEFTVINPWL 807

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V ELK RDLWD  M++DLKY DGS+  I+RIP+D+K++  TAFEIDP WL+E+ASRRQKW
Sbjct: 808 VQELKARDLWDSVMVNDLKYFDGSVAQIDRIPEDVKQLFLTAFEIDPRWLVEAASRRQKW 867

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQ QSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  AT +EK +  G     NA 
Sbjct: 868 IDQGQSLNLYMAEPSGKKLDNLYKLAWSRGLKTTYYLRSLGATQMEKIS-SGASQSDNAK 926

Query: 927 PVTDPNSSTHSLGIPSSCTS-DTECEVCQ 954
           P  D + + +    P  C+  D +CE CQ
Sbjct: 927 P--DVDDTENQEPQPKFCSILDPDCEACQ 953


>gi|78065155|ref|YP_367924.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           sp. 383]
 gi|77965900|gb|ABB07280.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383]
          Length = 998

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/906 (60%), Positives = 676/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGEASTGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  +V  AC GL   V+   +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDLNALRALVVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VT+R LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTSRILLHTIRREILG------EEVVQAEMSTRYAEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---ANNQF--DYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH    A+  F  D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLVAHLVKQADGSFALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AV  
Sbjct: 633 RTISVAMRMLDNVIDINYYAVAKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVAF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYHASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWTSLRSRIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|254253305|ref|ZP_04946623.1| Ribonucleotide reductase alpha subunit [Burkholderia dolosa AUO158]
 gi|124895914|gb|EAY69794.1| Ribonucleotide reductase alpha subunit [Burkholderia dolosa AUO158]
          Length = 997

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/908 (60%), Positives = 676/908 (74%), Gaps = 20/908 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  LL+   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTRNVVRALLRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGEASSGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC GL   V+ + +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDLNALRALIVSACDGLGAAVNPEPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF +++  GV+A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVVQSEMSTRYAEYFPQFLRRGVEAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDREARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGAEFEAAYTAYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQPDGSYALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD---ELAMN 739
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R    E+ M+
Sbjct: 693 ADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDMS 752

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
            T  L W  L+ R+ T GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+F
Sbjct: 753 ET--LDWAALRARIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEF 810

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+
Sbjct: 811 TVVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEA 870

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           ASRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL G KTTYYLR+ +AT VEKST+   
Sbjct: 871 ASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGKKTTYYLRTMAATHVEKSTV--A 928

Query: 920 DGKLNAVP 927
            G LNAVP
Sbjct: 929 HGALNAVP 936


>gi|325528899|gb|EGD05935.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           sp. TJI49]
          Length = 963

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/907 (59%), Positives = 673/907 (74%), Gaps = 17/907 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++++  LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVDQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       ++ 
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAVAGGEAAGGVIN 158

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +D+G     +   L  +V  AC GL   V+   +++ET KN+YDG+  S +  + I ++
Sbjct: 159 VVDNGVTRPLDLNALRALVVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAA 218

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RT+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A
Sbjct: 219 RTMIEKDPAYSQVTARILLHTIRREILG------EEVVQAEMSTRYAEYFPQFLKRGVDA 272

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL + ++ FDL  L + L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAM
Sbjct: 273 GLLDDKLLQFDLKRLGDALDASRDLQFGYLGLQTLYDRYFLHVGGTRIEMPQAFFMRVAM 332

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GL+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ A
Sbjct: 333 GLSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEA 392

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           L+ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 393 LKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKG 452

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP  
Sbjct: 453 AVCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPST 512

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDP
Sbjct: 513 CPDLHDKFGAEFEAAYTAYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDP 572

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKL 621
           CNIRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL
Sbjct: 573 CNIRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKL 632

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE
Sbjct: 633 KRTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVE 692

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R   + ++ 
Sbjct: 693 FADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDS 752

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           +  L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FT
Sbjct: 753 SESLDWTALRARIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT 812

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+A
Sbjct: 813 VVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAA 872

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           SRRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    
Sbjct: 873 SRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AH 930

Query: 921 GKLNAVP 927
           G LNAVP
Sbjct: 931 GALNAVP 937


>gi|207721466|ref|YP_002251906.1| ribonucleoside reductase 1 (large chain) protein [Ralstonia
           solanacearum MolK2]
 gi|206586626|emb|CAQ17212.1| ribonucleoside reductase 1 (large chain) protein [Ralstonia
           solanacearum MolK2]
          Length = 987

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/904 (60%), Positives = 675/904 (74%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE RS  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERA-QAGETQQPPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+GL D V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMVALRNLIVSACAGLGDAVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAARYVDYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L +++  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDDTLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISDKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  G+ FE AY  YE +  RGEI +F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGRAFEQAYLGYEEKVARGEITLFKKMPAMQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVQQADGSYALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+R A+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYA+  AV+ A
Sbjct: 629 TVRIAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDALHVLRIPYANEAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA+ R   L  + +S
Sbjct: 689 DTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGILPQDSLKLLAQERGGYLEADLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 TMDWDSLRGRIQQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|83746811|ref|ZP_00943859.1| Ribonucleoside-diphosphate reductase alpha chain [Ralstonia
           solanacearum UW551]
 gi|207744362|ref|YP_002260754.1| ribonucleoside reductase 1 (large chain) (partial sequence n
           terminus) protein [Ralstonia solanacearum IPO1609]
 gi|83726580|gb|EAP73710.1| Ribonucleoside-diphosphate reductase alpha chain [Ralstonia
           solanacearum UW551]
 gi|206595767|emb|CAQ62694.1| ribonucleoside reductase 1 (large chain) (partial sequence n
           terminus) protein [Ralstonia solanacearum IPO1609]
          Length = 987

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/904 (60%), Positives = 676/904 (74%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE RS  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERA-QAGETQQPPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+GL D V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMVALRNLIVSACAGLGDAVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAARYVDYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L +++  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDDTLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISDKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY+LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAIEFYHLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +N  WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  G+ FE AY  YE +  RGEI +F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGRAFEQAYLGYEEKVARGEITLFKKMPAMQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLVQQADGSYALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+R A+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ ALH+L IPYA+  AV+ A
Sbjct: 629 TVRIAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMGFQDALHVLRIPYANEAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+G+ P DS+ LLA+ R   L  + +S
Sbjct: 689 DTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGILPQDSLKLLAQERGGYLEADLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 TMDWDSLRGRIQQYGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|134294682|ref|YP_001118417.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           vietnamiensis G4]
 gi|134137839|gb|ABO53582.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           vietnamiensis G4]
          Length = 996

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/906 (59%), Positives = 676/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV+++++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGAESNTGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC GL   V++  +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDMNALRALIVSACDGLGTAVNADPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    +M   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVVQADMSARYAEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + + WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGSDWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGADFEKAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWSTLRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|171318521|ref|ZP_02907673.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria MEX-5]
 gi|171096307|gb|EDT41213.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria MEX-5]
          Length = 1001

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/906 (59%), Positives = 675/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGEASAGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC+GL   V+ + +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDMNALRELIVSACAGLGAAVNPEPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVLQAEMSTRYTEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGADFEKAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LLAE R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYHASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWTALRARIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|299065647|emb|CBJ36819.1| Ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           solanacearum CMR15]
          Length = 987

 Score = 1125 bits (2911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/904 (60%), Positives = 674/904 (74%), Gaps = 17/904 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT+  V  LL+   +
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVNGGQGAASARVRELVEGLTQNVVRALLRSRPN 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE +LM+SG H + R YVLYRE RS  RA Q+      P    L +  
Sbjct: 97  GGTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRSQERA-QAGETQQQPAFIGLNVT- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++  AC+ L + V  + +L ET KN+Y+G+  S +  + I ++RT
Sbjct: 155 DGGITRPLDMAALRNLIVSACADLGESVDPEPILKETVKNLYEGVPMSQVYDSAILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y++ TAR LL  +RRE+L       ++ T  EM   Y +YF ++I+ G+ A L
Sbjct: 215 LIEKDPAYSQATARILLHTIRREILG------EEVTQAEMAGRYADYFPQFIKRGINAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + +  FDL  L   L   RD  F YLGLQ LYDRYFLHI+  RIEMPQAFFMRVAMGL
Sbjct: 269 LDDKLAQFDLAKLGAALDASRDLQFNYLGLQTLYDRYFLHISEKRIEMPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RAVEFY LLSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 329 SLNEIDREARAVEFYQLLSSFDFMSSTPTLFNSGTCRSQLSSCYLTTVSDDLDGIYEALK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  G+ FE AY  YE +  RGEIK+F+K+ A+ LWRKML MLFETGHPWITFKDPCN
Sbjct: 509 DLHDKVGRAFEAAYLGYEEKVARGEIKLFKKMPAMQLWRKMLGMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           IRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 569 IRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHVVKQADGSYALDHDKLKK 628

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTA+R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ +LH+L IPYA+  AV+ A
Sbjct: 629 TVRTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGIMGFQDSLHVLRIPYATDAAVQFA 688

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YS++KGSLWD+GV P DS+ LLA+ R   L  + +S
Sbjct: 689 DTSMEAVCYYAYWASTELAEERGRYSTYKGSLWDRGVLPQDSLKLLAQERGGYLEADLSS 748

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            + WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQNLYVKSN+SG+FTVV
Sbjct: 749 TMDWDGLRARIQQHGMRNSNCVAIAPTATISNIIGVSACIEPTYQNLYVKSNLSGEFTVV 808

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK R LWDE M++DLKY DGS+  I+RIP DL+ ++ATAFE++P WL+E+ASR
Sbjct: 809 NDYLVRDLKARGLWDEVMVADLKYFDGSLARIDRIPQDLRDLYATAFEVEPQWLVEAASR 868

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT VEKST+    G 
Sbjct: 869 RQKWIDQAQSLNIYMAGASGKMLDDTYKLAWLRGLKTTYYLRTIGATHVEKSTVS--RGT 926

Query: 923 LNAV 926
           LNAV
Sbjct: 927 LNAV 930


>gi|170699975|ref|ZP_02891002.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170135123|gb|EDT03424.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 999

 Score = 1125 bits (2910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/905 (59%), Positives = 672/905 (74%), Gaps = 15/905 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       +    A     ++
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAGGEASAGINVV 158

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G     +   L  ++  AC+GL   V+ + +++ET KN+YDG+  S +  + I ++RT
Sbjct: 159 DNGVTRPLDMNALRELIVSACAGLGAAVNPEPIVAETVKNLYDGVPMSQVYDSAILAART 218

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           +IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A L
Sbjct: 219 MIEKDPAYSQVTARILLHTIRREILG------EEVLQAEMSTRYTEYFPQFLKRGVDAGL 272

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMGL
Sbjct: 273 LDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMGL 332

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL+
Sbjct: 333 SLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEALK 392

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 393 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 452

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP    
Sbjct: 453 CAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGTDWTLFSPSTCP 512

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPCN
Sbjct: 513 DLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCN 572

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLAS 623
           +RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL  
Sbjct: 573 VRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLKR 632

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE A
Sbjct: 633 TISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEFA 692

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTS 742
           D SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ + 
Sbjct: 693 DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTSE 752

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
            L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTVV
Sbjct: 753 SLDWTTLRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVV 812

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+ASR
Sbjct: 813 NEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAASR 872

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G 
Sbjct: 873 RQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHGA 930

Query: 923 LNAVP 927
           LNAVP
Sbjct: 931 LNAVP 935


>gi|206561766|ref|YP_002232531.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           cenocepacia J2315]
 gi|198037808|emb|CAR53752.1| putative ribonucleoside reductase [Burkholderia cenocepacia J2315]
          Length = 1003

 Score = 1125 bits (2909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/906 (59%), Positives = 673/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 41  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHNVVRALVRSRPN 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 101 GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGESTTGINV 160

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC GL   V+   +++ET KN+YDG+  S +  + I ++R
Sbjct: 161 VDNGVTRPLDLNALRALIVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAAR 220

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 221 TMIEKDPAYSQVTARILLHTIRREILG------EEVVQAEMSTRYAEYFPQFLKRGVDAG 274

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH++G+RIEMPQAFFMRVAMG
Sbjct: 275 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMG 334

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 335 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 394

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 395 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 454

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 455 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 514

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G +FE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 515 PDLHDKFGADFEKAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 574

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 575 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLK 634

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 635 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 694

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 695 ADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 754

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 755 ESLDWTTLRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 814

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 815 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 874

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 875 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 932

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 933 ALNAVP 938


>gi|115350551|ref|YP_772390.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ambifaria AMMD]
 gi|115280539|gb|ABI86056.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria AMMD]
          Length = 999

 Score = 1125 bits (2909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/906 (59%), Positives = 674/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHNVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGEASAGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  +C+GL   V+ + +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDMNALRELIVSSCAGLGAAVNPEPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVLQAEMTTRYTEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D+DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWTTLRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|158341283|ref|YP_001522353.1| ribonucleotide-diphosphate reductase subunit alpha [Acaryochloris
           marina MBIC11017]
 gi|158311524|gb|ABW33135.1| ribonucleotide-diphosphate reductase, alpha subunit [Acaryochloris
           marina MBIC11017]
          Length = 960

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/931 (58%), Positives = 686/931 (73%), Gaps = 24/931 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V  F+  KI+ A+ KAF+AV+G  +  S RV++++  LT   VT L +   +
Sbjct: 31  KVIRRNGSVVGFEADKIAIAMTKAFLAVKGVQSGVSARVRELVATLTTNVVTALKRRQPT 90

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+SG H + R YVLYRE+RS  R  Q H    API      +M
Sbjct: 91  GGTFHIEDIQDQVELALMRSGEHDVARAYVLYREKRSQKRT-QQHGIEAAPI-----YLM 144

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G  +  + +R   +V+ AC  L D VS K +  E  KN+YDG S  +L  + I ++R+
Sbjct: 145 DGGDRVLLDLERFNDLVDSACINLGDTVSGKAIADEALKNIYDGASVVELHKSAILAARS 204

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IEK+P+Y+KVTAR LL ++R+EVL        + T  EMQ  Y EYF  +I++G+   L
Sbjct: 205 HIEKDPDYSKVTARLLLHRIRQEVLGA------EVTQAEMQARYAEYFPHFIQQGIATGL 258

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  F+L  L + L  ERD  F YLGLQ LYDRYFLH    RIE+PQAFFMRVAMGL
Sbjct: 259 LDEKLAQFNLQKLGSVLVAERDLQFGYLGLQTLYDRYFLHTEDRRIELPQAFFMRVAMGL 318

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E+RA EFY++LS F FM STPTLFNSGT   QLSSC+LTTVPD L GI+ A++
Sbjct: 319 ALNEIDREERAAEFYDILSKFDFMSSTPTLFNSGTVRSQLSSCYLTTVPDALDGIYSAIK 378

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NA+L+KY+GGLGNDWTPVR LGAHI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 379 DNALLSKYAGGLGNDWTPVRALGAHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 438

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHD+NTANWIPDLFMKRV ++  WTLFSPD V 
Sbjct: 439 CAYLETWHLDIEEFLELRKNTGDDRRRTHDINTANWIPDLFMKRVMEDGDWTLFSPDIVP 498

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD  GKEFE AY  YE+QA +GE+K F+ + A  LWRKML+MLFETGHPWITFKDPCN
Sbjct: 499 DLHDKVGKEFETAYLAYEQQAAKGELKPFKTVPANTLWRKMLSMLFETGHPWITFKDPCN 558

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN----QFDYDKLAST 624
           +RSPQQH+G+VHSSNLCTE+TLN++  E AVCNLGS+NL+ H        Q D  KL  T
Sbjct: 559 VRSPQQHIGMVHSSNLCTEVTLNTNENEIAVCNLGSVNLVNHMVEKNGQMQLDQAKLQHT 618

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           I  A+R+LDNVID+N + +  A+ SN  HR +GLG+MGFQ  LH L +PYAS +AV+ AD
Sbjct: 619 ITIAMRMLDNVIDLNYYAVSTARNSNLKHRPVGLGIMGFQDCLHQLRLPYASQDAVDFAD 678

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDELA-MNRTSR 743
            +ME + ++A  AS ELAQERG YS++KGSLWD+G+ P D++ LL EVR     ++ +S 
Sbjct: 679 RAMEAVCYYAYWASTELAQERGRYSTYKGSLWDRGILPQDTLALLKEVRGGFVEVDESST 738

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           + WD L+ R+   GMRNSNC+AIAPTATIANI GVS  I+P+YQNLYVKSN+SG+FTVVN
Sbjct: 739 MDWDLLRDRIAQHGMRNSNCVAIAPTATIANIIGVSACIEPTYQNLYVKSNLSGEFTVVN 798

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK R+LWDE MI+DLKY DGS+  I+RIP +L++++ATAFE++P W++E+A+RR
Sbjct: 799 EYLVRDLKVRELWDEVMIADLKYFDGSLAKIDRIPPELRQLYATAFEVEPNWIVEAAARR 858

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
            KWIDQAQSLN+Y+   SGKKLD IY+ AW  GLKTTYYLRS  AT VEKST       L
Sbjct: 859 SKWIDQAQSLNIYMAGASGKKLDQIYKLAWQRGLKTTYYLRSLGATHVEKSTAPA--SSL 916

Query: 924 NAVPVTDPNSSTHSLG-IPSSCTSDTECEVC 953
           NAV     N S++ +G I ++  S+   +VC
Sbjct: 917 NAV---SNNGSSNGIGNILTTSKSENLGQVC 944


>gi|172059583|ref|YP_001807235.1| ribonucleotide-diphosphate reductase subunit alpha [Burkholderia
           ambifaria MC40-6]
 gi|171992100|gb|ACB63019.1| ribonucleoside-diphosphate reductase, alpha subunit [Burkholderia
           ambifaria MC40-6]
          Length = 999

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/906 (59%), Positives = 673/906 (74%), Gaps = 16/906 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKI+ A+ KAF+AV G   + S RV++ ++ LT   V  L++   +
Sbjct: 39  KVIRRNGSVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHSVVRALVRSRPN 98

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI-M 148
               HIEDIQDQVE +LM+ G H + R YVLYRE+R   R       + A       I +
Sbjct: 99  GGTFHIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGEASAGINV 158

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
           +D+G     +   L  ++  AC+GL   V+ + +++ET KN+YDG+  S +  + I ++R
Sbjct: 159 VDNGVTRPLDMNALRELIVSACAGLGAAVNPEPIVAETVKNLYDGVPMSQVYDSAILAAR 218

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           T+IEK+P Y++VTAR LL  +RRE+L       ++    EM   Y EYF ++++ GV A 
Sbjct: 219 TMIEKDPAYSQVTARILLHTIRREILG------EEVLQAEMATRYTEYFPQFLKRGVDAG 272

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL + ++ FDL  L   L   RD  F YLGLQ LYDRYFLH+ G+RIEMPQAFFMRVAMG
Sbjct: 273 LLDDKLLQFDLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMG 332

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           L+L E ++E RA+EFYN+LSSF FM STPTLFNSGT   QLSSC+LTTV DDL GI+ AL
Sbjct: 333 LSLNEIDRETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEAL 392

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 393 KENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGA 452

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV + A WTLFSP   
Sbjct: 453 VCAYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTC 512

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G EFE AY  YE +  RGEIK+F+KI A  LWRKML MLFETGHPWITFKDPC
Sbjct: 513 PDLHDKFGAEFEAAYTAYEDKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPC 572

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-----QFDYDKLA 622
           N+RSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL+AH           D DKL 
Sbjct: 573 NVRSPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDQDKLK 632

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LHLL  PYAS  AVE 
Sbjct: 633 RTISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASEAAVEF 692

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS ELA+ERG YSS++GSLWD+G+ P D++ LL E R   + ++ +
Sbjct: 693 ADRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLTEARGGYVEVDTS 752

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
             L W  L+ R+   GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 753 ESLDWTTLRSRIAAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 812

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+R LWDE M++DLKY DG +  I+RIP DL+ I+ATAFE+DP WL+E+AS
Sbjct: 813 VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAAS 872

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+ +AT VEKST+    G
Sbjct: 873 RRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTV--AHG 930

Query: 922 KLNAVP 927
            LNAVP
Sbjct: 931 ALNAVP 936


>gi|91787005|ref|YP_547957.1| ribonucleotide-diphosphate reductase subunit alpha [Polaromonas sp.
           JS666]
 gi|91696230|gb|ABE43059.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666]
          Length = 969

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/899 (58%), Positives = 682/899 (75%), Gaps = 13/899 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  LT+  +  L++    
Sbjct: 35  QIIRRNGSVVPFEPNKIAVAMMKAFLAVHGTQGAASASVRETVDGLTQAVIRALMRSRPG 94

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+ GHH+I R YVLYRE+RS  RA Q   ++ AP AP L +  
Sbjct: 95  GGTFHIEDVQDQVELGLMRGGHHEIARAYVLYREKRSQERARQP--QTPAPEAPMLHVT- 151

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G  ++ + + L+ ++E +C+ L  DV    +++ET +N+YDG+   ++  A I ++RT
Sbjct: 152 DGGQRVALDVRNLQALIEASCANLGADVKPDPIVAETMRNLYDGVPIDEVYKASILAART 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR L+  +RREVL       ++ +  EM   Y EYF ++I +GV+  L
Sbjct: 212 LIEKDPDYTYATARLLMHTIRREVLG------EEVSQEEMHSRYAEYFPKFIAKGVQNEL 265

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  L   LK ERD  F+YLGLQ L+DRYFLH+   RIE+PQAFFMRVAMGL
Sbjct: 266 LDEKLQQFDLARLGAALKPERDLKFDYLGLQTLFDRYFLHVRKQRIELPQAFFMRVAMGL 325

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY +LSSF FM STPTLFN+GT   QLSSC+LTTV DDL GI+ A++
Sbjct: 326 SLGEIDREARAIEFYEILSSFDFMSSTPTLFNAGTLRSQLSSCYLTTVADDLGGIYDAIK 385

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWTPVR LGAHI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 386 ENALLSKFAGGLGNDWTPVRALGAHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 445

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP +  
Sbjct: 446 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSDTP 505

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +GKEFE  Y  YE +A+RGEIK  RK+ A  +WRKML+MLFETGHPWITFKD CN
Sbjct: 506 DLHDKFGKEFEKIYTAYEARAERGEIKPARKLQATDMWRKMLSMLFETGHPWITFKDACN 565

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  +   D+DKL  TI TA
Sbjct: 566 VRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLVQHLKDGAIDHDKLKKTITTA 625

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +GLG+MGFQ  L+ L +PYAS EAVE AD+SME
Sbjct: 626 MRMLDNVIDINYYAVKKARDSNMRHRPVGLGIMGFQDCLYELRVPYASQEAVEFADKSME 685

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            + +HA  AS ELA+ERG Y+S+KGSLWD+G+ P+D++ +LAE R   + ++R++ L WD
Sbjct: 686 AVCYHAYWASTELAKERGKYASYKGSLWDKGILPLDTLDMLAEERGGYVEVDRSATLDWD 745

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++++   GMRNSNC+AIAPTATI+NI GV   I+P + NL VKSN+SG+FTV+N +LV
Sbjct: 746 ALRQKIAQDGMRNSNCVAIAPTATISNIIGVDACIEPCFGNLSVKSNLSGEFTVINHYLV 805

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK+  LWD+ M+ DLK+ DGS+  ++R+P ++K ++ATAFE++  W++E+A+RRQKWI
Sbjct: 806 RDLKRLGLWDDVMVVDLKHFDGSLRPVDRVPQEIKALYATAFEVETSWIVEAAARRQKWI 865

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           DQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+  AT  EKST+K   GK+N+V
Sbjct: 866 DQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTMGATHAEKSTVKA--GKMNSV 922


>gi|30250347|ref|NP_842417.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosomonas
           europaea ATCC 19718]
 gi|30181142|emb|CAD86335.1| Ribonucleotide reductase large subunit [Nitrosomonas europaea ATCC
           19718]
          Length = 955

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/931 (57%), Positives = 697/931 (74%), Gaps = 17/931 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V +F+P KIS A+ KAF+AV G  ++ S  +++I+  LT + V  L +    
Sbjct: 36  KIIRRNGAVVAFEPGKISIALTKAFIAVRGGQSAASSSMREIVAQLTGEVVHALTRRRPE 95

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIEDIQDQVE +LM+SG H I R YVLYREER+  RA Q   +S  P + ++ ++ 
Sbjct: 96  GGTFHIEDIQDQVELALMRSGDHDIARAYVLYREERARERARQ---QSAQPASGQVAVLH 152

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +++G  I  +  +L   +E AC  L + V + +++    K++YDG+   ++  + I S+
Sbjct: 153 VVENGQKIPLDPAQLMARIESACQNLGNTVDAALIVKSMLKDLYDGVPAEEVRKSAILSA 212

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           R LIEKEP Y+ VTAR LL+ +R EVL       ++  H  MQ  Y EYF  ++ +G++A
Sbjct: 213 RALIEKEPAYSFVTARLLLDNIRYEVLG------EEVAHEAMQSRYAEYFPEFVRKGIEA 266

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL E +  FDL  L+  L  +RD  F YLGLQ LYDRYFLH++  RIE+PQ FFMRVAM
Sbjct: 267 GLLDERLGQFDLARLSEALAADRDLQFGYLGLQTLYDRYFLHVSERRIELPQIFFMRVAM 326

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++E RA+EFY+LLS F FM STPTLFNSGTR  QLSSC+L+TVPD L GI+ A
Sbjct: 327 GLALNEIDREARAIEFYHLLSKFDFMSSTPTLFNSGTRRSQLSSCYLSTVPDSLDGIYEA 386

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           ++ENA+L+K++GGLGNDWTPVR +GA I GTNGKSQGV+PFLKV +DTAVAVNQGGKRKG
Sbjct: 387 IKENALLSKFAGGLGNDWTPVRAMGARIKGTNGKSQGVVPFLKVVSDTAVAVNQGGKRKG 446

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKR+ ++  WTLFSP +
Sbjct: 447 AVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTAVWVPDLFMKRMQEDQEWTLFSPSD 506

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD +G+ FE AY  YE QA +G + +F++I A  LWRKMLTMLFETGHPWITFKDP
Sbjct: 507 TPDLHDKFGRAFEEAYIAYEEQAAQGRLTLFKRIPARQLWRKMLTMLFETGHPWITFKDP 566

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQ HVGVVHSSNLCTEITLN+S +E AVCNLGS+NLLAH  + + D  +L  T+ 
Sbjct: 567 CNIRSPQNHVGVVHSSNLCTEITLNTSEKEIAVCNLGSVNLLAHIVDGKLDQARLKQTVT 626

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  LH L I YASPEAVE AD S
Sbjct: 627 TAMRMLDNVIDINFYAVAKARNANFRHRPVGLGIMGFQDCLHKLGISYASPEAVEFADRS 686

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLP 745
           ME +++H   AS ELA+ERG Y++++GSLWD+G+ P D++ LL E R   + ++ +S   
Sbjct: 687 MEAVAYHTYWASTELAEERGTYATYRGSLWDRGILPQDTLELLREERGGHVEIDTSSTQD 746

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ R++  GMRNSNC+AIAPTATI+NI GVS SI+P+YQNLYVKSN+SG+FTVVN +
Sbjct: 747 WDALRDRIRQYGMRNSNCLAIAPTATISNIIGVSASIEPTYQNLYVKSNLSGEFTVVNQW 806

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LVN+LK++DLWDE MI+DLK++DG++  I+R+P++L+ ++ATAFE+DP WL+E+ASRRQK
Sbjct: 807 LVNDLKKQDLWDEVMIADLKHYDGAVSKIDRVPENLRNLYATAFEVDPRWLVEAASRRQK 866

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQAQSLNLY+   SGKK+D +YR AWL GLKTTYYLR+  AT+ EKST+    G LNA
Sbjct: 867 WIDQAQSLNLYMAGASGKKMDELYRLAWLRGLKTTYYLRALGATTAEKSTVH--TGTLNA 924

Query: 926 VPVT-DPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           VP   + ++   +   P  C  D  ECE CQ
Sbjct: 925 VPAQHEAHAGNLAHSAPQQCAIDNPECEACQ 955


>gi|114321251|ref|YP_742934.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227645|gb|ABI57444.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 928

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/927 (58%), Positives = 692/927 (74%), Gaps = 18/927 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           QVI+RNG +T+FDP KI  A+ KAF+AVEG+ ++ + R+Q +   LT Q V + L    +
Sbjct: 18  QVIRRNGALTAFDPDKIQLAMKKAFLAVEGERSADAARIQQVTAELTAQVV-QALTRRPT 76

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
           A  +HIEDIQDQVE +LM++G HK+ R YVLYREE +  R  ++   +D P  P+L +  
Sbjct: 77  ATPIHIEDIQDQVELALMRAGEHKVARAYVLYREEHARKRRQEA---TDEP--PRLHMTR 131

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG  +  +   L  ++  AC  L D   + V  E ++N+YDG++E ++  ALI S+R+L
Sbjct: 132 TDGEQVPLDESLLRRVLHHACHELADTDPERVAREAWRNLYDGVTEQEVHKALILSARSL 191

Query: 210 IEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLL 269
           IE+EP Y  V AR L  +L  E L  +      A   +    Y +YF RYI  GV+  LL
Sbjct: 192 IEQEPAYGHVAARLLQHQLNGEALRFLDFPYDGAPGADPG--YTDYFARYIRRGVELELL 249

Query: 270 HESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLA 329
            E ++ FDL  LA  L  ERD  F YLGLQ LYDRY  H +G+R E+PQAFFMRVAMGL 
Sbjct: 250 DEQLLTFDLERLAEALMPERDLQFNYLGLQTLYDRYLQHWDGTRFELPQAFFMRVAMGLT 309

Query: 330 LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQE 389
           L+E E+E+RA+EFY LLSSF FM STPTLFNSGTR PQLSSC+LT+VPDDL GI+GA+++
Sbjct: 310 LQEVEREERAIEFYRLLSSFDFMSSTPTLFNSGTRRPQLSSCYLTSVPDDLGGIYGAIRD 369

Query: 390 NAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVC 449
           NA+L+K++GGLGNDWT VR +GAHI GTNG+SQGV+PFLKVA+DTAVAVNQGGKRKGAVC
Sbjct: 370 NALLSKFAGGLGNDWTRVRAMGAHIKGTNGRSQGVVPFLKVASDTAVAVNQGGKRKGAVC 429

Query: 450 AYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSD 509
           AYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTA+W+PDLFM+R   +A WTLFSPD+ + 
Sbjct: 430 AYLETWHLDVEEFLELRKNTGDDRRRTHDMNTAHWVPDLFMQRAEADADWTLFSPDDAAH 489

Query: 510 LHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNI 569
           LH+LYG+ F+ AYE+ E +A RGEI+ ++ +SA  LWR+ML MLFETGHPWITFKDPCN+
Sbjct: 490 LHELYGQAFKAAYEDLEARAARGEIRNYKVVSAKQLWRRMLGMLFETGHPWITFKDPCNL 549

Query: 570 RSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAV 629
           RSPQQH GVVHSSNLCTEITLN+S EE AVCNLGS+NL AH   +  D+++L +T+RTA+
Sbjct: 550 RSPQQHAGVVHSSNLCTEITLNTSDEEIAVCNLGSVNLAAHTTPDGLDHERLRNTVRTAM 609

Query: 630 RVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEF 689
           R+LDNVIDIN +++ +A+++N  HR +GLG+MGFQ AL+   +PYAS EAV  AD S E 
Sbjct: 610 RMLDNVIDINYYSVPQARRANLRHRPVGLGVMGFQDALYAQDLPYASDEAVAFADRSQEA 669

Query: 690 ISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDE 748
           IS++AI AS +LA+ERGAY SF+GSLW +G  P+DSI  + E RD +  M+ +S L W  
Sbjct: 670 ISYYAIEASADLARERGAYPSFEGSLWQRGELPLDSIQRVVEARDGDCTMDTSSSLDWAA 729

Query: 749 LKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVN 808
           L+++V+T GMRNSNC+AIAPTATIANI GVSQ I+P+++NLYVKSN+SG+FTVVN  LV 
Sbjct: 730 LREKVRT-GMRNSNCLAIAPTATIANIVGVSQGIEPAFKNLYVKSNLSGEFTVVNPALVR 788

Query: 809 ELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWID 868
            LK   LWD  M++DLKY+DGS+  I R+P++LK+  ATAFE+D  WL+++ SRRQKW+D
Sbjct: 789 ALKAYGLWDAVMVNDLKYYDGSVQPIGRVPEELKQRFATAFELDSEWLVQAGSRRQKWLD 848

Query: 869 QAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG-KLNAVP 927
           Q+QSLNLY+ EPSG KLD +YRQAW +GLKTTYYLRS  AT VEKST+      +LNAV 
Sbjct: 849 QSQSLNLYMAEPSGPKLDALYRQAWRLGLKTTYYLRSTGATQVEKSTMDPARANRLNAV- 907

Query: 928 VTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                 S    G  S    D ECE CQ
Sbjct: 908 ------SAAPGGGQSCSVDDPECEACQ 928


>gi|239813963|ref|YP_002942873.1| ribonucleotide-diphosphate reductase subunit alpha [Variovorax
           paradoxus S110]
 gi|239800540|gb|ACS17607.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus S110]
          Length = 971

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/954 (56%), Positives = 702/954 (73%), Gaps = 31/954 (3%)

Query: 21  PFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTV 80
           P  + +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  LT+  +
Sbjct: 29  PAGQNLAHYQIIRRNGAVVPFEPNKIAIAMMKAFLAVHGTQGAASASVRETVDALTQGVI 88

Query: 81  TRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP 140
             +++        HIED+QDQVE  LM+ GHH+I R YVLYRE R+  R+ Q   + +AP
Sbjct: 89  RAMVRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYRERRTQERSKQV--EQEAP 146

Query: 141 IAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLE 199
             P L ++ D+G  ++ +  +L+ ++E AC  L D +++  +++ET +N+YDG+   ++ 
Sbjct: 147 ATPTLHVL-DNGERVALDLNQLKGLIESACENLGDSITAAPIVAETMRNLYDGVPLDEVY 205

Query: 200 TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRY 259
            A I ++RTLIEK+P+Y   TAR LL  + +E++       ++AT       Y +YF ++
Sbjct: 206 KASILAARTLIEKDPDYTFATARLLLHTIFKEIIGREVMPAERAT------AYADYFPQF 259

Query: 260 IEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQA 319
           I++GV+  LL E ++ +DL  L   LK ERD  F+YLGLQ LYDRYFLH+  SRIE+PQA
Sbjct: 260 IKKGVENDLLDEKLLQYDLPRLGAALKAERDNQFDYLGLQTLYDRYFLHVRKSRIELPQA 319

Query: 320 FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
           FFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFN+GT   QLSSC+LTTVPDD
Sbjct: 320 FFMRVAMGLSLGEIDREARAIEFYEVLSSFDFMSSTPTLFNAGTLRSQLSSCYLTTVPDD 379

Query: 380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           L GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVN
Sbjct: 380 LDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVN 439

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   W
Sbjct: 440 QGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTW 499

Query: 500 TLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHP 559
           TLFSP  V DLHDL+G +FE AY  YE +A RGEIK  R I A  LWRKMLTMLFETGHP
Sbjct: 500 TLFSPSNVPDLHDLFGADFEKAYVAYEEKAARGEIKPARTIQASDLWRKMLTMLFETGHP 559

Query: 560 WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYD 619
           WITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  + + D +
Sbjct: 560 WITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKDGKVDQE 619

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLMGFQ AL+ L IPYAS EA
Sbjct: 620 KLKRTISTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGLMGFQDALYELRIPYASQEA 679

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAM 738
           V+ ADESME I +HA  AS ELA+ERG YSS+KGSLWD+G+ PID++ LL + R   + +
Sbjct: 680 VQFADESMEAICYHAYWASTELARERGKYSSYKGSLWDKGILPIDTLDLLEKARGGYVEV 739

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           +R++ L W+ L++++K  GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+
Sbjct: 740 DRSATLDWEALRQKIKADGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGE 799

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D+K ++ATAFE++  WL+E
Sbjct: 800 FTVINHYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQDVKALYATAFEVETTWLVE 859

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR++SAT  EKST++ 
Sbjct: 860 AAARRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTQSATHAEKSTVQS 919

Query: 919 VDGKLNAVPVTDPNSSTHS-------------LGIPSS----C-TSDTECEVCQ 954
             G+LNAV      SS  S               +P++    C   D  CE CQ
Sbjct: 920 --GRLNAVSSGSDASSGMSALEAAAAAAKAQMSAMPATDIAFCGVDDPTCEACQ 971


>gi|294339030|emb|CAZ87377.1| putative Ribonucleoside-diphosphate reductase (ribonucleoside
           diphosphate reductase, alpha subunit) (Ribonucleotide
           reductase large subunit) [Thiomonas sp. 3As]
          Length = 974

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/947 (57%), Positives = 684/947 (72%), Gaps = 31/947 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV+G   + S  +++ +  LTE  V  LL+   S
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVQGGQGAASASMRETVNALTENVVRALLRSRPS 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE SLM++G H++ R YVLYRE R+  RA Q  +      AP L ++ 
Sbjct: 97  GGTFHIEDIQDQVELSLMRTGQHEVARAYVLYRERRTQERAKQKAAAEQQESAPVLHVL- 155

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++E AC  L  DV +  +++ET +N+YDG+   ++  A I +SRT
Sbjct: 156 DGGLRKPLDQAALVSLIESACVNLSADVKAAPIVAETLRNLYDGVPMLEVYKAAILASRT 215

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIE++P+Y+KVTAR LL  +RRE L       +     +M   Y EYF R I+EGV+  L
Sbjct: 216 LIERDPDYSKVTARLLLHTMRRETLN------EDIPQEQMTQRYAEYFPRCIKEGVELEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL--------HINGSRIEMPQAF 320
           L E +  FDL  L   LK ERD  F+YLGLQ LYDRYFL        + +G RIE+PQAF
Sbjct: 270 LDERLGQFDLARLGAALKAERDLQFDYLGLQTLYDRYFLANRADTRVNKDGRRIELPQAF 329

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           FMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFN+GTR  QLSSC+LTTV DDL
Sbjct: 330 FMRVAMGLSLNEIDREARAIEFYELLSSFDFMSSTPTLFNAGTRRSQLSSCYLTTVADDL 389

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
            GI+ A++ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQ
Sbjct: 390 DGIYEAIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQ 449

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +   WT
Sbjct: 450 GGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVMEGGDWT 509

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LFSP +V DLHD +GK+FE AY  YE++A  GEIK+F+ + AV LWRKML+MLFETGHPW
Sbjct: 510 LFSPADVPDLHDKFGKDFEQAYTRYEQKAALGEIKLFKTLPAVQLWRKMLSMLFETGHPW 569

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ----- 615
           ITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH  +       
Sbjct: 570 ITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLKDAADGAKV 629

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D  KL  TI+TA+R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  L+ L IPY 
Sbjct: 630 IDQAKLKRTIQTAMRMLDNVIDINYYAVAKARNANMKHRPVGLGIMGFQDCLYQLRIPYG 689

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S +AVE AD SME + + A  AS ELA+ERG YSS+ GSLWDQGV P+DS+ LLAE R  
Sbjct: 690 SQQAVEFADRSMEAVCYEAYWASSELARERGRYSSYGGSLWDQGVLPMDSLKLLAEQRGG 749

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            +  + +S L W+ L+ ++   GMRNSNC+AIAPTATI+NI GV   I+P++QNLYVKSN
Sbjct: 750 YVEADTSSTLDWNALRAQIAQHGMRNSNCVAIAPTATISNIVGVDACIEPTFQNLYVKSN 809

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV +LK R LWD  M++DLKY DGS   I+RIP DLK +++TAFE D  
Sbjct: 810 LSGEFTVINQYLVRDLKARGLWDAVMVADLKYFDGSTQRIDRIPADLKALYSTAFETDTQ 869

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W+IE+A+RRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT  EKS
Sbjct: 870 WIIEAAARRQKWIDQAQSLNIYMANASGKLLDDTYKLAWLRGLKTTYYLRTIGATHAEKS 929

Query: 915 TLKGVDGKLNAVPVTDPN------SSTHSLGIPSSCTSDT-ECEVCQ 954
           T+K   G+LNAVP +          +    G    C  D  ECE CQ
Sbjct: 930 TVKA--GQLNAVPQSPSESASASAQAVVQSGDIRYCAIDNPECEACQ 974


>gi|296135013|ref|YP_003642255.1| ribonucleoside-diphosphate reductase, alpha subunit [Thiomonas
           intermedia K12]
 gi|295795135|gb|ADG29925.1| ribonucleoside-diphosphate reductase, alpha subunit [Thiomonas
           intermedia K12]
          Length = 978

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/951 (57%), Positives = 685/951 (72%), Gaps = 35/951 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           ++I+RNG V  F+PSKI+ A+ KAF+AV+G   + S  +++ +  LTE  V  LL+   S
Sbjct: 37  KIIRRNGAVVGFEPSKIAVAMTKAFLAVQGGQGAASASMRETVNALTENVVRALLRSRPS 96

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE SLM++G H++TR YVLYRE R+  RA Q  +      AP L ++ 
Sbjct: 97  GGTFHIEDIQDQVELSLMRTGQHEVTRAYVLYRERRTQERAKQKAAAEQQESAPVLHVL- 155

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G     +   L  ++E AC  L  DV +  +++ET +N+YDG+   ++  A I +SRT
Sbjct: 156 DGGLRKPLDQAALVSLIESACVNLSADVKAAPIVAETLRNLYDGVPMLEVYKASILASRT 215

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIE++P+Y+KVTAR LL  +RRE L       +     +M   Y EYF R I+EGV+  L
Sbjct: 216 LIERDPDYSKVTARLLLHTMRRETLN------EDIPQEQMTQRYAEYFPRCIKEGVELEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL--------HINGSRIEMPQAF 320
           L E +  FDL  L   LK ERD  F+YLGLQ LYDRYFL        + +G RIE+PQAF
Sbjct: 270 LDERLGQFDLARLGAALKAERDLQFDYLGLQTLYDRYFLANRADTRVNKDGRRIELPQAF 329

Query: 321 FMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
           FMRVAMGL+L E ++E RA+EFY LLSSF FM STPTLFN+GTR  QLSSC+LTTV DDL
Sbjct: 330 FMRVAMGLSLNEIDREARAIEFYELLSSFDFMSSTPTLFNAGTRRSQLSSCYLTTVADDL 389

Query: 381 YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
            GI+ A++ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQ
Sbjct: 390 DGIYEAIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQ 449

Query: 441 GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
           GGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV +   WT
Sbjct: 450 GGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVMEGGEWT 509

Query: 501 LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
           LFSP +V DLHD +GK+FE AY  YE++A  GEIK+F+ + AV LWRKML+MLFETGHPW
Sbjct: 510 LFSPADVPDLHDKFGKDFEQAYTRYEQKAALGEIKLFKTLPAVQLWRKMLSMLFETGHPW 569

Query: 561 ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ----- 615
           ITFKD CN+RSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH  +       
Sbjct: 570 ITFKDACNVRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHLKDAADGAKV 629

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D  KL  TI+TA+R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  L+ L IPY 
Sbjct: 630 IDQAKLKRTIQTAMRMLDNVIDINYYAVAKARNANMKHRPVGLGIMGFQDCLYQLRIPYG 689

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S +AVE AD SME + + A  AS ELA+ERG YSS+ GSLWDQG+ P+DS+ LLAE R  
Sbjct: 690 SQQAVEFADRSMEAVCYEAYWASSELARERGRYSSYGGSLWDQGILPMDSLKLLAEQRGG 749

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            +  + +S L W+ L+ ++   GMRNSNC+AIAPTATI+NI GV   I+P++QNLYVKSN
Sbjct: 750 YVEADTSSTLDWNALRAQIAQHGMRNSNCVAIAPTATISNIVGVDACIEPTFQNLYVKSN 809

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           +SG+FTV+N +LV +LK R LWD  M++DLKY DGS   I+RIP DLK ++ATAFE D  
Sbjct: 810 LSGEFTVINQYLVRDLKARGLWDAVMVADLKYFDGSTQRIDRIPADLKALYATAFETDTQ 869

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS 914
           W+IE+A+RRQKWIDQAQSLN+Y+   SGK LD  Y+ AWL GLKTTYYLR+  AT  EKS
Sbjct: 870 WIIEAAARRQKWIDQAQSLNIYMANASGKLLDDTYKLAWLRGLKTTYYLRTIGATHAEKS 929

Query: 915 TLKGVDGKLNAVPVTDPNSS-----------THSLGIPSSCTSDTECEVCQ 954
           T+K   G+LNAVP +   S              S  I      + ECE CQ
Sbjct: 930 TVKA--GQLNAVPQSPSESVSALASASAQAVVQSGDIRYCAIDNPECEACQ 978


>gi|307546479|ref|YP_003898958.1| ribonucleotide-diphosphate reductase subunit alpha [Halomonas
           elongata DSM 2581]
 gi|307218503|emb|CBV43773.1| ribonucleotide-diphosphate reductase subunit alpha [Halomonas
           elongata DSM 2581]
          Length = 968

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/913 (58%), Positives = 680/913 (74%), Gaps = 10/913 (1%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           PS++   P+ ++   VIKR G V  FD  KI+ A+ KAF+AVEG  A+ S RV+D ++  
Sbjct: 10  PSVSVTAPQTLR---VIKRTGDVVPFDSGKIAVALSKAFIAVEGDNAATSSRVRDFVQRA 66

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           +E      L+       +HIEDIQDQVE +LM++G  K+ R YVLYREE +  RA +S +
Sbjct: 67  SENIEQAFLRRMPDGGTLHIEDIQDQVELALMRAGEQKVARAYVLYREEHARARA-ESGA 125

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
               P  P L +   DG+    +  R+E +V +AC  L +V    ++ ++ KN+YDG++ 
Sbjct: 126 DITKP-HPTLNVTAPDGSTRPLDLGRVETLVFDACENLANVEPGKIVEDSLKNLYDGVTV 184

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
             +  AL+ ++RTL+EK+PNY  VTAR L + LRRE L+ +    ++AT+ EM   Y   
Sbjct: 185 DGVSQALMMTARTLVEKDPNYTYVTARLLQDNLRREALSFL-GIAEEATYQEMADYYKPA 243

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F  YI +G++   L   + +FDL  L + L + RD  F YLGLQ LYDRYF+H +  R E
Sbjct: 244 FQAYIAKGIEFEQLDPRLAEFDLERLGDALDHTRDAQFTYLGLQTLYDRYFIHRDEVRYE 303

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQ  FMRVAMGLAL E ++E RA+EFY LLSSF +M STPTLFNSGT   QLSSC+LTT
Sbjct: 304 LPQVMFMRVAMGLALNEDDREARAIEFYELLSSFDYMASTPTLFNSGTVRSQLSSCYLTT 363

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           VPDDL  I+ A+++NA+L+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTA
Sbjct: 364 VPDDLDNIYSAIRDNALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTA 423

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           VAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKRV  
Sbjct: 424 VAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFD 483

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           +  WTLFSP    DLHDLYG  FE  Y+ YE     G++K+F+++ A  LWR+ML+MLFE
Sbjct: 484 DGEWTLFSPATCPDLHDLYGAAFEKRYQEYEEMTRNGQLKLFKRVRAKDLWRRMLSMLFE 543

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S +E AVCNLGSINL  H  + Q
Sbjct: 544 TGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSPDEIAVCNLGSINLAQHVTDGQ 603

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
           FD DKL  T++TAVR+LDNVIDIN + + +A++SN  HR +GLG+MGFQ AL+   I YA
Sbjct: 604 FDGDKLKKTVKTAVRMLDNVIDINYYAVPQAERSNFKHRPVGLGIMGFQDALYAQDIAYA 663

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S EAV  AD SME +S+HAI AS +LA ERG Y S++GSLW QG+ PIDSI  L + R E
Sbjct: 664 SDEAVAFADTSMELVSYHAIEASSDLAAERGHYESYEGSLWSQGILPIDSIEKLKQERGE 723

Query: 736 --LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKS 793
             + ++ ++   WD +++++   GMRNSN MAIAPTATI+NICGVSQSI+P+YQNL+VKS
Sbjct: 724 KYIEVDTSTTQDWDRIREKIAVQGMRNSNVMAIAPTATISNICGVSQSIEPTYQNLFVKS 783

Query: 794 NMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDP 853
           N+SG+FTVVN+++VN+LK+R LWDE MI+DLKY+DGS+  I+R+P+DLK  +ATAFE +P
Sbjct: 784 NLSGEFTVVNAYMVNDLKERGLWDEVMINDLKYYDGSVQAIDRVPEDLKAKYATAFETEP 843

Query: 854 MWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK 913
            WL+E+A+RRQKWIDQAQSLNLY+   SGKKLD  YR AW  GLKTTYYLR+  ATSVEK
Sbjct: 844 KWLVEAAARRQKWIDQAQSLNLYIQGVSGKKLDVTYRMAWFRGLKTTYYLRALGATSVEK 903

Query: 914 STLKGVDGKLNAV 926
           ST+    G LNAV
Sbjct: 904 STVD--RGNLNAV 914


>gi|260220050|emb|CBA27200.1| Ribonucleoside-diphosphate reductase subunit alpha [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 1306

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/899 (59%), Positives = 677/899 (75%), Gaps = 13/899 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  LT+Q +  L++    
Sbjct: 51  QIIRRNGAVVPFEPNKIAVAMMKAFLAVHGTQGAASASVRETVDGLTQQVIRALVRSRPG 110

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+ GHH+I R YVLYRE R+  RA Q    ++AP AP + ++ 
Sbjct: 111 GGTFHIEDVQDQVELGLMRGGHHEIARAYVLYRERRTQERAKQV--ATEAPAAPVIHVI- 167

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G  +  +  +L+  +E ACSGL  DV +  +L+ET +N+YDG+   ++  A I ++RT
Sbjct: 168 DNGQRVPLDLAQLQFRIETACSGLGADVKAAPILAETMRNLYDGVPLDEVYKAAILAART 227

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR L   + REVL       +     +MQ  Y +YF  +I+ G+ A L
Sbjct: 228 LIEKDPDYTYATARLLFHTISREVLG------RDVAQADMQEAYADYFPGFIKRGIAAEL 281

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  L + LK  RD  F+YLGLQ LYDRYFLH   +RIE+PQAFFMRVAMGL
Sbjct: 282 LDEKLQQFDLKRLGSALKAGRDLQFDYLGLQTLYDRYFLHEGKTRIELPQAFFMRVAMGL 341

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 342 SLNEIDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 401

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 402 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 461

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V 
Sbjct: 462 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSNVP 521

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G EFE AY  YE +A RGEIK  R + A  LWRKMLTMLFETGHPWITFKD CN
Sbjct: 522 DLHDLFGAEFEKAYVAYEEKAARGEIKPSRTVQASDLWRKMLTMLFETGHPWITFKDACN 581

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  +   D++KL  TI TA
Sbjct: 582 VRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKDGALDHNKLKRTISTA 641

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +GLGLM FQ +L+ L IPYAS  AVE AD+SME
Sbjct: 642 MRMLDNVIDINYYAVKKARDSNMRHRPVGLGLMAFQDSLYELRIPYASDAAVEFADQSME 701

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            IS++A  AS +LA+ERG Y S+KGSLWD+GV P D++ +LA  R   + ++R+S L W+
Sbjct: 702 AISYYAYWASTDLARERGKYHSYKGSLWDKGVLPPDTLDMLANARGGYVEVDRSSTLDWN 761

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTV+NS+LV
Sbjct: 762 ALRNKIAADGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVINSYLV 821

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K+++ATAFE++  WL+E+A+RRQKWI
Sbjct: 822 RDLKRLGLWDDVMVMDLKHFDGSLSPIDRVPQEIKQLYATAFEVETRWLVEAAARRQKWI 881

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           DQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ SAT  EKST+    G+LNAV
Sbjct: 882 DQAQSLNIYMAGASGKKLDETYKLAWLRGLKTTYYLRTMSATHAEKSTVTA--GRLNAV 938


>gi|319791702|ref|YP_004153342.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus EPS]
 gi|315594165|gb|ADU35231.1| ribonucleoside-diphosphate reductase, alpha subunit [Variovorax
           paradoxus EPS]
          Length = 971

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/908 (58%), Positives = 687/908 (75%), Gaps = 13/908 (1%)

Query: 21  PFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTV 80
           P  + +   Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  LT+  +
Sbjct: 29  PTGQNLAHYQIIRRNGAVVPFEPNKIAIAMMKAFLAVHGTQGAASASVRETVDVLTQGVI 88

Query: 81  TRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP 140
             +++        HIED+QDQVE  LM+ GHH+I R YVLYRE R+  R+ Q   + +AP
Sbjct: 89  RAMVRSRPGGGTFHIEDVQDQVELGLMRGGHHEIARAYVLYRERRTQERSKQV--EQEAP 146

Query: 141 IAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLE 199
             P L ++ D+G  ++ +  +L+ ++E AC  L D +++  +++ET +N+YDG+   ++ 
Sbjct: 147 ATPTLHVL-DNGERVALDLNQLKGLIESACENLGDSITAAPIVAETMRNLYDGVPLDEVY 205

Query: 200 TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRY 259
            A I ++RTLIEK+P+Y   TAR LL  + +E++        +AT       Y +YF ++
Sbjct: 206 KASILAARTLIEKDPDYTFATARLLLHTIFKEIIGREVMPVDRATA------YADYFPQF 259

Query: 260 IEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQA 319
           I++GV+  LL E ++ +DL  L   LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQA
Sbjct: 260 IKKGVENDLLDEKLLQYDLPRLGAALKAERDNQFDYLGLQTLYDRYFLHVRKTRIELPQA 319

Query: 320 FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
           FFMRVAMGL+L E ++E RA+EFY +LSSF FM STPTLFN+GT   QLSSC+LTTVPDD
Sbjct: 320 FFMRVAMGLSLGEIDREARAIEFYEVLSSFDFMSSTPTLFNAGTLRSQLSSCYLTTVPDD 379

Query: 380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           L GI+ +++ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVN
Sbjct: 380 LDGIYESIKENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVN 439

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGGKRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   W
Sbjct: 440 QGGKRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTW 499

Query: 500 TLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHP 559
           TLFSP  V DLHDL+G +FE AY  YE +A RGEIK  R I A  LWRKMLTMLFETGHP
Sbjct: 500 TLFSPSNVPDLHDLFGADFEKAYVAYEEKAARGEIKPARTIQASDLWRKMLTMLFETGHP 559

Query: 560 WITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYD 619
           WITFKD CN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  + + D +
Sbjct: 560 WITFKDACNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKDGKVDQE 619

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL  TI TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLMGFQ AL+ L IPYAS EA
Sbjct: 620 KLKRTISTAMRMLDNVIDINYYAVKKARDSNLRHRPVGLGLMGFQDALYELRIPYASQEA 679

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAM 738
           V+ ADESME I +HA  AS ELA+ERG YSS+KGSLWD+G+ PID++ LL + R   + +
Sbjct: 680 VQFADESMEAICYHAYWASTELAKERGKYSSYKGSLWDKGILPIDTLDLLEQARGGYVEV 739

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           +R++ L WD L+ ++K  GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+
Sbjct: 740 DRSATLDWDALRAKIKADGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGE 799

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FTV+N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D+K ++ATAFE++  WL+E
Sbjct: 800 FTVINHYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQDVKALYATAFEVETTWLVE 859

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR++SAT  EKST++ 
Sbjct: 860 AASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTQSATHAEKSTVQS 919

Query: 919 VDGKLNAV 926
             G+LNAV
Sbjct: 920 --GRLNAV 925


>gi|291615086|ref|YP_003525243.1| ribonucleoside-diphosphate reductase, subunit alpha [Sideroxydans
           lithotrophicus ES-1]
 gi|291585198|gb|ADE12856.1| ribonucleoside-diphosphate reductase, alpha subunit [Sideroxydans
           lithotrophicus ES-1]
          Length = 946

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/937 (58%), Positives = 687/937 (73%), Gaps = 24/937 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V SF+PSKIS A+ KAF+AV G   + S RV+++++ LT   V+ L++    
Sbjct: 22  KVIRRNGSVVSFEPSKISIAVTKAFIAVNGGQGAASARVRELVEQLTANVVSALIRRQPH 81

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              +HIEDIQDQVE SLM+SG H + R YVLYRE+R+  R   S  K +   AP L I  
Sbjct: 82  GGTLHIEDIQDQVELSLMRSGEHDVARSYVLYREQRTRER---SKGKKEIDAAPALNIKD 138

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
            D T    +  +L   ++ AC GL   V +  +L  T K++YDG++  ++    I S+RT
Sbjct: 139 GDVTR-PLDVVQLSAQIQSACVGLGGAVDADKILKLTLKDLYDGVAVEEVRKCAILSART 197

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIE++P Y+ VTAR LL  +  E+L        + +  +M   Y EYF ++I+ G++A L
Sbjct: 198 LIEQDPAYSFVTARLLLNNICCEILGG------QVSQADMAERYAEYFPKFIKRGIEAEL 251

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+E +  FDL  LA  L   RD  F YLGLQ LYDRYFLH++G RIE+PQAFFMRVAMGL
Sbjct: 252 LNEELGHFDLDRLAGALDSSRDLQFNYLGLQTLYDRYFLHVDGQRIELPQAFFMRVAMGL 311

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E  +E+RA+EFY LLSSF FM STPTLFNSGTR  QLSSC+LTTV DDL GI+ AL+
Sbjct: 312 SLNEINREERAIEFYRLLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALK 371

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 372 ENALLSKFAGGLGNDWTNVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 431

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNT+NWIPDLFMKRV +   WTLFSP    
Sbjct: 432 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTSNWIPDLFMKRVMEGGEWTLFSPSTCP 491

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G EFE AY  YE +   GE+K+F+K+ A +LWRKMLTMLFETGHPWITFKDPCN
Sbjct: 492 DLHDKFGAEFEKAYTAYEAKVASGELKLFKKVPAQSLWRKMLTMLFETGHPWITFKDPCN 551

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF------ANNQFDYDKLA 622
           IRSPQQHVGVVHSSNLCTEITLN+S  E AVCNLGS+NL AH          Q D+DKL 
Sbjct: 552 IRSPQQHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLAAHLFPKGHAKAGQIDHDKLK 611

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+ TA+R+LDNVIDIN + + KA+ SN  HR +GLG+MGFQ  LH L IPY+S  A+E 
Sbjct: 612 RTVSTAMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHDLRIPYSSDAAIEF 671

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD SME + ++A  AS +LA ERG Y+S++GSLWD+G+ P DS+ LL E R   + ++ +
Sbjct: 672 ADRSMEAVCYYAYWASTDLAAERGRYASYRGSLWDKGILPQDSLNLLLEQRGGYVEVDMS 731

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           S L WD L+ R++  GMRNSNC+AIAPTATI+NI GVS  I+P+YQN++VKSN+SG+FTV
Sbjct: 732 SNLDWDALRARIQQNGMRNSNCVAIAPTATISNIIGVSACIEPTYQNIFVKSNLSGEFTV 791

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           +N  LVN+LK   LWDE MI+DLKY DGS+  I+RIP +L++++ATAFE++P WLIE+AS
Sbjct: 792 INDHLVNDLKALGLWDEVMIADLKYFDGSLAKIDRIPAELRELYATAFEVEPKWLIEAAS 851

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SG+KLD  Y+ AWL GLKTTYYLR+  ATS EKST +   G
Sbjct: 852 RRQKWIDQAQSLNIYMSGVSGRKLDETYKLAWLRGLKTTYYLRALGATSAEKSTSRA--G 909

Query: 922 KLNAVPV---TDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
            LNAV         S++  +     C+ D  ECE CQ
Sbjct: 910 SLNAVSSGGGAGEMSASPVVEEAKFCSIDNPECEACQ 946


>gi|160872690|ref|ZP_02062822.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Rickettsiella grylli]
 gi|159121489|gb|EDP46827.1| ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide
           reductase) [Rickettsiella grylli]
          Length = 946

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/929 (58%), Positives = 685/929 (73%), Gaps = 22/929 (2%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG +  +DPSKI  AI KAF+AVEG  A+ S R+ + +  LT+Q  T L Q + 
Sbjct: 37  LQVIKRNGKLVDYDPSKIRVAITKAFLAVEGGQAALSTRIHERVSQLTQQITTILQQRHP 96

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKI 147
               + IE IQDQVE +LM+   H++ R YVLYREER  +RA  + HS+       +L+I
Sbjct: 97  QGGTLSIETIQDQVELALMRVEAHQVARAYVLYREERRKMRAETKPHSEI------QLQI 150

Query: 148 MMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            + DG+    +  +L +++ E C+ L+DV  + +L ET +N+YDG+  +D++ ALI S+R
Sbjct: 151 TLTDGSQRPLDLIQLSLLITETCNDLKDVKHERILQETLRNLYDGMPAADIDKALIISAR 210

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           +L+E +P Y   TARFLL  L  E L  + + P     H    +Y  YF  YI+ G++  
Sbjct: 211 SLVEHDPQYTYATARFLLRTLYAEALHFL-ELPLHT--HRHSGIYSHYFQHYIKRGIQLE 267

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   +  FDL  L+  L  ERD  F YLGLQ LYDRYFLH +  R E+PQAFFMRVAMG
Sbjct: 268 LLDPQLHTFDLEQLSQALLPERDQQFTYLGLQTLYDRYFLHADHIRFELPQAFFMRVAMG 327

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LA  E+ K  RA+EFY+LLSSF +M STPTLFNSGT  PQLSSCFLTTV DDL  I+ A+
Sbjct: 328 LAQHESNKNDRAIEFYHLLSSFDYMASTPTLFNSGTLRPQLSSCFLTTVTDDLDHIYSAI 387

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           ++NA+L+K++GGLGNDWTPVR +GA I GTNGKS GV+PFL VAN +AVAVNQGGKRKGA
Sbjct: 388 KDNALLSKFAGGLGNDWTPVRAMGARIKGTNGKSLGVVPFLNVANASAVAVNQGGKRKGA 447

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFMKR+ +   WTLFSPDE 
Sbjct: 448 VCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRLMKGENWTLFSPDET 507

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD +G  FE  Y+ YE +A RGEIK F+ I A  LWRKML++LFETGHPWITFKDPC
Sbjct: 508 PDLHDAFGSAFEEKYQAYEAKALRGEIKNFKTIPAATLWRKMLSLLFETGHPWITFKDPC 567

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA-NNQFDYDKLASTIR 626
           N+RSPQQHVG +HSSNLCTEITLN+S +E AVCNLGSINL  H   + + +  KL  TIR
Sbjct: 568 NLRSPQQHVGTIHSSNLCTEITLNTSIDEIAVCNLGSINLPQHLTESGEIEKTKLRQTIR 627

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN +T+ +A++SN  HR IGLGLMGFQ AL+ L +PYAS  A+  AD++
Sbjct: 628 TAIRMLDNVIDINYYTVPQARRSNLKHRPIGLGLMGFQDALYQLRLPYASDAAITFADQT 687

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME IS++AI AS +LA ERGAY SF GSLW QGV P+DSI  L + R E L  +RT+RL 
Sbjct: 688 MELISYYAIEASSDLAHERGAYESFPGSLWSQGVLPLDSIARLQKARGEFLDQDRTARLD 747

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+K+V   GMR+SNCMAIAPTATI+NICGVSQSI+P+YQNL+VKSNMSG+FT++N +
Sbjct: 748 WDTLRKKVMH-GMRHSNCMAIAPTATISNICGVSQSIEPTYQNLFVKSNMSGEFTMINPY 806

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           L+N+LK   LWD  M++DLKY+DGS+  IERIPD LK+++ATAFEI   WL+E+ SRRQK
Sbjct: 807 LINDLKLLGLWDAVMLNDLKYYDGSLQKIERIPDHLKQLYATAFEIPAHWLVEAGSRRQK 866

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNA 925
           WIDQ+QSLNLY+   SGKKLD +Y+Q WL GLKT+YYLR+  AT  EK+TL      LN+
Sbjct: 867 WIDQSQSLNLYMAHASGKKLDELYKQVWLKGLKTSYYLRTMGATHTEKATL--AKSHLNS 924

Query: 926 VPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           V +       +++  P+    D +CE CQ
Sbjct: 925 VHM-------NTVATPACSIVDPDCESCQ 946


>gi|332286775|ref|YP_004418686.1| ribonucleotide-diphosphate reductase subunit alpha [Pusillimonas
           sp. T7-7]
 gi|330430728|gb|AEC22062.1| ribonucleotide-diphosphate reductase subunit alpha [Pusillimonas
           sp. T7-7]
          Length = 973

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/906 (59%), Positives = 683/906 (75%), Gaps = 21/906 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
            +I+RNG V  F+P KI+ A+ KAF+AV G   + S RV+++++ LT Q V  L+++  S
Sbjct: 35  HIIRRNGVVVGFEPGKIAIAMTKAFLAVNGGQGAASARVRELVETLTAQVVNALVRNRPS 94

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIE+IQDQVE +LM+SG H + R YVLYRE+RS  RA      + AP A    I+ 
Sbjct: 95  GGTFHIEEIQDQVELTLMRSGEHDVARAYVLYREKRSQERA----QSTPAPAATDQTIIH 150

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             D+G     +  RL   + EA   L  ++ ++ +L ET KN+YDG+   ++  + I S+
Sbjct: 151 VTDNGVQCPLDLARLRATITEAGLNLPHNIDAEAILKETVKNIYDGIPVDEVFKSAILSA 210

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           R ++E +P+Y++VTAR LL  +R+EVL       ++ +  +M   Y EYF ++++ G++ 
Sbjct: 211 RAMVENDPSYSQVTARLLLHTIRKEVLG------EEVSQSDMATRYAEYFPQFLKAGIEG 264

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL E +  FDL  LA  LK ERD  F YLGLQ LYDRYFLH+ G RIE+PQ FFMRVAM
Sbjct: 265 GLLDEKLAQFDLPKLAAALKAERDLQFNYLGLQTLYDRYFLHLRGRRIELPQVFFMRVAM 324

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E  +E+RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV DDL GI+ A
Sbjct: 325 GLALNEINREERAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLAGIYDA 384

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           ++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 385 IKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKG 444

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +N  WTLFSP +
Sbjct: 445 AVCAYLETWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSD 504

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHD YGK+FE AY  YE +  RGE+ +F+K+ A  LWRKML+MLFETGHPWITFKDP
Sbjct: 505 APDLHDKYGKDFEEAYLGYEDKVARGELPLFKKVPANMLWRKMLSMLFETGHPWITFKDP 564

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---ANNQF--DYDKL 621
           CNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL AH    AN Q+  D++KL
Sbjct: 565 CNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLAAHLKQDANGQYVLDHEKL 624

Query: 622 ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
             TI  A+R+LDNVIDIN + + KA+ SN  HR +G+G+MGFQ  LH++ +P+AS +AVE
Sbjct: 625 ERTIGIAMRMLDNVIDINYYAVPKARNSNVRHRPVGMGVMGFQDCLHMMRVPFASDDAVE 684

Query: 682 IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNR 740
            +D SME   ++A  AS +LA ERG Y+SFKGSLWD+G+ P D++ LL E R   + ++ 
Sbjct: 685 FSDRSMEAACYYAYWASSKLAAERGHYASFKGSLWDRGILPQDTLALLREERGGYVEVDD 744

Query: 741 TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
           +S L WD L+  +K  GMRNSNC+AIAPTATI+NI GVS  I+P+Y+NLYVKSN+SG+FT
Sbjct: 745 SSTLDWDSLRAHIKQHGMRNSNCVAIAPTATISNIIGVSPCIEPNYRNLYVKSNLSGEFT 804

Query: 801 VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
           VVN +LV +LK+R LWDE M+SDLKY DGS+  I+RIP DL+K++ATAFE+DP W++E A
Sbjct: 805 VVNDYLVRDLKERKLWDEVMVSDLKYFDGSLARIDRIPADLRKLYATAFEVDPTWVVECA 864

Query: 861 SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
           +RR KWIDQAQSLN+++   SGKKLD IY+ AW+ GLKTTYYLRS  AT+ EKST +G  
Sbjct: 865 ARRSKWIDQAQSLNIFMAGVSGKKLDDIYKLAWVRGLKTTYYLRSIGATNAEKSTGRG-- 922

Query: 921 GKLNAV 926
           G+LNAV
Sbjct: 923 GELNAV 928


>gi|114332418|ref|YP_748640.1| ribonucleotide-diphosphate reductase subunit alpha [Nitrosomonas
           eutropha C91]
 gi|114309432|gb|ABI60675.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosomonas
           eutropha C91]
          Length = 957

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/932 (58%), Positives = 690/932 (74%), Gaps = 17/932 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG V +F+P KIS A+ KAF+AV G  ++ S  +++I+  LT + V  L +    
Sbjct: 36  KVIRRNGAVVAFEPGKISIAMTKAFIAVRGGQSAASSSMREIVAQLTGEVVHALTRRRPG 95

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIEDIQDQVE +LM+SG H + R YVLYREER+  RA Q      +  A  L I+ 
Sbjct: 96  GGTFHIEDIQDQVELALMRSGDHDVARAYVLYREERARERARQQKEPPTSTQAAVLHIV- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           ++G  I  +  RL   +E AC  L +V ++ +++    +++YDG+   ++  + I S+R 
Sbjct: 155 ENGQRIPLDPSRLTARIESACQHLGNVVNAGLIVKAMLRDLYDGVPAEEVRKSAILSARA 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEKEP Y+ VTAR LL+ +R EVL       +  +H  MQ  Y +YF  +I +G++A L
Sbjct: 215 LIEKEPAYSFVTARLLLDNIRHEVLG------EDVSHEAMQSRYADYFPGFIRQGMEAGL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  L+  L  +RD  F YLGLQ LYDRYFLHI+  RIE+PQAFFMRVAMGL
Sbjct: 269 LDERLGQFDLARLSETLIADRDLQFGYLGLQTLYDRYFLHISERRIELPQAFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY+LLS+F FM STPTLFNSGTR  QLSSC+L+TVPD L GI+ A++
Sbjct: 329 ALNEIDREARAIEFYHLLSTFDFMSSTPTLFNSGTRRSQLSSCYLSTVPDSLDGIYEAIK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWTPVR +GA I GTNGKSQGV+PFLKV +DTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTPVRAMGARIKGTNGKSQGVVPFLKVVSDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTA W+PDLFMKR+ ++  WTLFSP +  
Sbjct: 449 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTAVWVPDLFMKRMLEDQEWTLFSPSDTP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLH+ YGK FE AY  YE QA +G + + ++I A  LWRKMLTMLFETGHPWITFKDPCN
Sbjct: 509 DLHEKYGKAFEEAYIAYEEQATQGRLALHKRIPARQLWRKMLTMLFETGHPWITFKDPCN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           IRSPQ HVGVVHSSNLCTEITLN++ +E AVCNLGSINL AH  + + D  KL  T+ TA
Sbjct: 569 IRSPQNHVGVVHSSNLCTEITLNTNEKEIAVCNLGSINLPAHIVDGKLDLTKLKQTVATA 628

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + + KA+ +N  HR +GLG+MGFQ  LH L I YAS EAVE AD SME
Sbjct: 629 MRMLDNVIDINFYAVAKARNANLRHRPVGLGIMGFQDCLHKLGISYASREAVEFADSSME 688

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWD 747
            +++H   AS ELA+ERG Y+++ GSLW++G+ P DS+ LL E R   + ++ +S L W 
Sbjct: 689 AVAYHTYWASTELAEERGTYATYHGSLWERGILPQDSLALLQEERGGHVEVDTSSTLDWT 748

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L++R+K  GMRNSNC+AIAPTATI+NI GVS SI+P+YQNLYVKSN+SG+FTVVN  LV
Sbjct: 749 PLRERIKQYGMRNSNCLAIAPTATISNIIGVSASIEPTYQNLYVKSNLSGEFTVVNQSLV 808

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
           N+LK++DLWDE MI+DLK++DG+   I+RIP++L+ ++ATAFEIDP WL+E+A+RRQKWI
Sbjct: 809 NDLKKQDLWDEVMIADLKHYDGAASKIDRIPENLRALYATAFEIDPRWLVEAAARRQKWI 868

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLNLY+   SGKK+D +YR AWL GLKTTYYLR+  AT+ EKST+    G LNAVP
Sbjct: 869 DQAQSLNLYMSGASGKKMDDLYRLAWLRGLKTTYYLRAMGATTAEKSTVH--TGTLNAVP 926

Query: 928 V-----TDPNSSTHSLGIPSSCTSDTECEVCQ 954
                 TD +   HS         D ECE CQ
Sbjct: 927 AQQNGHTDSSGQIHS-ATKQCAIDDPECEACQ 957


>gi|241764093|ref|ZP_04762130.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           delafieldii 2AN]
 gi|241366557|gb|EER61045.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           delafieldii 2AN]
          Length = 975

 Score = 1116 bits (2886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/919 (58%), Positives = 690/919 (75%), Gaps = 13/919 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++  LT      L++    
Sbjct: 33  QIIRRNGAVVPFEPQKIAVAMMKAFLAVHGTQGAASASVREVVDTLTHNVTRALMRSRPG 92

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+SGHH+I R YVLYRE R+  +    H++   P AP+L ++ 
Sbjct: 93  GGTFHIEDVQDQVELGLMRSGHHEIARAYVLYRERRT--QERTRHNEEQLPQAPQLHVL- 149

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G  +  +  RL+ ++E AC+GL  DVS++ +++ET +N+YDG+   ++  A I ++RT
Sbjct: 150 DGGERVVLDQGRLQSLIESACTGLGADVSAQPIVAETMRNLYDGVPMEEVYKASILAART 209

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR LL  + REVL       ++    +M   Y +YF ++I++GV+  L
Sbjct: 210 LIEKDPDYTYATARLLLHTIVREVLG------REVAPADMAQSYVDYFPQFIKKGVENDL 263

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E ++ +DL  L   LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQAFFMRVAMGL
Sbjct: 264 LDERLLQYDLQRLGAALKAERDLQFDYLGLQTLYDRYFLHVKKNRIELPQAFFMRVAMGL 323

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 324 SLNEIDREARAIEFYEILSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 383

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 384 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 443

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V 
Sbjct: 444 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSNVP 503

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G +FE AY  YE +A RGEIK  R + A  LWRK+LTMLFETGHPWITFKD CN
Sbjct: 504 DLHDLFGTDFEKAYVAYEEKAARGEIKPARTVQATDLWRKILTMLFETGHPWITFKDACN 563

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  N Q D+DKL  TI  A
Sbjct: 564 VRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKNGQIDHDKLKKTITVA 623

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +GLG+M FQ +L+ L IPYAS EAVE AD+SME
Sbjct: 624 MRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMAFQDSLYELRIPYASQEAVEFADQSME 683

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            I ++A  AS ELA+ERG YSS+KGSLWD+G+ P+D++ +LA+ R   + ++R++ L WD
Sbjct: 684 AICYYAYWASTELARERGRYSSYKGSLWDRGILPLDTLDMLAQARGGYVEVDRSATLDWD 743

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+K++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N  LV
Sbjct: 744 ALRKKIAQDGMRNSNCVAIAPTATISNIIGVDASIEPSFGNLSVKSNLSGEFTVINGGLV 803

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK+  LWD+ MI DLK+  GS+  I+R+P D+K +++TAFE++P WL+E+ASRRQKWI
Sbjct: 804 RDLKRLGLWDDVMIMDLKHFKGSLHPIDRVPQDIKALYSTAFEVEPRWLVEAASRRQKWI 863

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVP 927
           DQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT VE ST+     +LNAV 
Sbjct: 864 DQAQSLNIYMAGASGKKLDDTYKLAWVRGLKTTYYLRTQSATHVEMSTVN--TRQLNAVS 921

Query: 928 VTDPNSSTHSLGIPSSCTS 946
               N  +H+    S+  S
Sbjct: 922 SGHDNGGSHASAAQSAPPS 940


>gi|72163400|ref|YP_291057.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
 gi|71917132|gb|AAZ57034.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
          Length = 821

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/771 (67%), Positives = 629/771 (81%), Gaps = 2/771 (0%)

Query: 160 KRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKV 219
           +R+  +V EAC GL   S++ V++E  +  Y G++ ++LE ALI ++RT +E +P+Y+ V
Sbjct: 2   ERIRKVVAEACQGLPGASAETVIAEATRGFYPGITPAELELALIMAARTFVETDPDYSYV 61

Query: 220 TARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLV 279
           +AR LL+KLRRE LT +   P +ATH +M   YPEY   +I  G++   L   + DFDL 
Sbjct: 62  SARLLLDKLRREALTFLSGHPDEATHADMARRYPEYLRAFITRGIELEHLTPELADFDLD 121

Query: 280 YLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRA 339
            L   L+ ERD  F YLGLQ LYDRYFLH  G+R E+PQAF MRVAMG+AL E ++  RA
Sbjct: 122 RLGAALRPERDLNFTYLGLQTLYDRYFLHHEGTRYELPQAFLMRVAMGVALHEDDRNARA 181

Query: 340 VEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGG 399
           +EFY LLSSF FMCSTPTLFN+GTR PQLSSCFLTTV DDL  IF A+  NA+L+KYSGG
Sbjct: 182 IEFYELLSSFDFMCSTPTLFNAGTRRPQLSSCFLTTVGDDLAEIFRAISNNALLSKYSGG 241

Query: 400 LGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDV 459
           LGNDWTPVRGLGAHI GTNGKSQGV+PFLK+ANDTAVAVNQGGKRKGAVCAYLETWHID+
Sbjct: 242 LGNDWTPVRGLGAHIKGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDI 301

Query: 460 EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFE 519
           EEFLDLRKNTGD+RRRTHDMNTANW+PDLF++RV  +A WTLFSPDEV DLHD YG++F 
Sbjct: 302 EEFLDLRKNTGDERRRTHDMNTANWVPDLFLERVESDAQWTLFSPDEVPDLHDRYGEDFA 361

Query: 520 IAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVV 579
            AY  YER ADRGEI+VFR++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GVV
Sbjct: 362 RAYVAYERAADRGEIRVFRRVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHAGVV 421

Query: 580 HSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDIN 639
           HSSNLCTEITLN+S +E AVCNLGS+NL  H   +  D ++L  T+RTAVR+LDNVID+N
Sbjct: 422 HSSNLCTEITLNTSLDEVAVCNLGSVNLANHVGPDGLDAERLRRTVRTAVRMLDNVIDVN 481

Query: 640 CHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASV 699
            +TI +A+++N  HR IGLGLMG+Q AL  L +P ASPEAVE ADESME +S++AI AS 
Sbjct: 482 LYTIPEAERANMRHRPIGLGLMGYQDALFTLRLPVASPEAVEFADESMELLSYYAIEASA 541

Query: 700 ELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV-RDELAMNRTSRLPWDELKKRVKTIGM 758
           +LA ERG+YSSF+GSLW +G+ PIDS+ LLAE  R +L ++RT RL WD L+++V+T GM
Sbjct: 542 DLAAERGSYSSFEGSLWSRGILPIDSLELLAEARRGDLDVDRTQRLDWDTLREKVRTTGM 601

Query: 759 RNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDE 818
           RNSN MAIAPTATIANI GV+ SI+P Y+NLYVK+NMSGDFTVVN  LV +LK+R LWDE
Sbjct: 602 RNSNVMAIAPTATIANIVGVNPSIEPLYRNLYVKANMSGDFTVVNPSLVRDLKERGLWDE 661

Query: 819 AMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLD 878
            M++ LK HDGS+G I+R+P+DLK ++ATAFEIDP+WL+++ASRRQKWIDQAQSLNLY+ 
Sbjct: 662 EMVTALKLHDGSLGPIDRVPEDLKNLYATAFEIDPIWLVDAASRRQKWIDQAQSLNLYMA 721

Query: 879 EPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV-PV 928
           EPSG+KLD +YR+AW  GLKTTYYLRS+ AT VEKSTL+G DG+LNAV PV
Sbjct: 722 EPSGRKLDELYRRAWRKGLKTTYYLRSQGATHVEKSTLRGTDGRLNAVTPV 772


>gi|33598410|ref|NP_886053.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           parapertussis 12822]
 gi|33603350|ref|NP_890910.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           bronchiseptica RB50]
 gi|33574539|emb|CAE39186.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           parapertussis]
 gi|33577474|emb|CAE34739.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           bronchiseptica RB50]
          Length = 975

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/959 (56%), Positives = 695/959 (72%), Gaps = 53/959 (5%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT Q V+ L+++  + 
Sbjct: 35  IIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQGAASARVRELVEQLTAQAVSALVRNRPAG 94

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYRE-------------ERSDVRAAQSHSKS 137
              HIED+QDQVE +LM+SG H + R YVLYRE             E+S   AAQ     
Sbjct: 95  GTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERAAAAEVLEKSSPAAAQE---- 150

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSES 196
                P L ++ D+G     +   L   +E A  GL Q   ++ +L ET KN+YDG+   
Sbjct: 151 -----PTLSVV-DNGVRRPLDLAALRATIEAAGEGLTQYTDTEAILKETVKNLYDGVPVD 204

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           ++  + I ++R L+EK+P Y++VTAR LL  +R+EVL       ++ +  +M   Y EYF
Sbjct: 205 EVFKSAILAARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQADMATRYAEYF 258

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             +I+ G++  LL   + ++DL  +A  L   RD  F YLGLQ LYDRYFLH+ G+RIE+
Sbjct: 259 PAFIQRGIEGGLLDAKLAEYDLERVAKALDGRRDLQFGYLGLQTLYDRYFLHVRGTRIEL 318

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV
Sbjct: 319 PQVFFMRVAMGLALREADREARAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTV 378

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAV
Sbjct: 379 SDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAV 438

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +N
Sbjct: 439 AVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEN 498

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP +  DLHD YGK FE AY  YE +   GE+K+F+K+ AV+LWRKML+MLFET
Sbjct: 499 GEWTLFSPSDCPDLHDKYGKAFEQAYAGYEAKVASGELKLFKKMPAVSLWRKMLSMLFET 558

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---AN 613
           GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+++ E AVCNLGS+NL+AH    AN
Sbjct: 559 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNATEIAVCNLGSVNLVAHMKPSAN 618

Query: 614 N--QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
              + D+DKL  TI  A+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH++ 
Sbjct: 619 GGYELDHDKLKRTIGVAMRMLDNVIDINYYAVDKARNSNERHRPVGMGIMGFQDCLHVMR 678

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           +PYAS +A++ AD SME + +HA  AS ELAQERG Y S++GSLW +G+ P D++ +L E
Sbjct: 679 VPYASQDAIDFADRSMEAVCYHAYWASSELAQERGRYQSYEGSLWSRGILPQDTLAMLRE 738

Query: 732 VR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   + ++ +S L WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLY
Sbjct: 739 ERGGNVDVDDSSSLDWDTLRSRIKEHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLY 798

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L+K++ATAFE
Sbjct: 799 VKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRKLYATAFE 858

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS
Sbjct: 859 VEPSWLVECASRRQKWIDQAQSLNIYMSGASGKKLDDTYKLAWQRGLKTTYYLRTLGATS 918

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP---------SSCTSDT------ECEVCQ 954
            EKST +G  G+LNAV   D  + +     P         + CT         ECE CQ
Sbjct: 919 AEKSTGRG--GELNAVSAGDHGAGSAVSAAPVLPEPEIVGAVCTMRPGDPGFEECEACQ 975


>gi|121608467|ref|YP_996274.1| ribonucleotide-diphosphate reductase subunit alpha
           [Verminephrobacter eiseniae EF01-2]
 gi|121553107|gb|ABM57256.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Verminephrobacter eiseniae EF01-2]
          Length = 968

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/920 (58%), Positives = 685/920 (74%), Gaps = 20/920 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTR-LLQHNK 88
           Q+++RNG V  F P KI+ A+MKAF+AV G   + S  V++++  LT QTVTR L++   
Sbjct: 34  QIMRRNGAVVPFQPQKIALAMMKAFLAVHGTQGAASASVREVVDGLT-QTVTRALMRSRP 92

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
                HIED+QDQVE  LM+ GHH+I R YVLYRE R+  R+ Q   +   P A  L ++
Sbjct: 93  GGGTFHIEDVQDQVELGLMRGGHHEIARSYVLYRERRTQERSRQGSPQQ--PAAALLHVL 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D G  ++ +  RL+ ++E AC GL  DV +  +++ET +N+YDG+   ++  A I ++R
Sbjct: 151 -DAGVRVALDPARLQALIESACVGLGPDVKADPIVAETMRNLYDGVPMDEVCKAAILAAR 209

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
           TLIEK+P+Y+  TAR LL  + REVL +    PQ     +M   Y +YF R+I++GV   
Sbjct: 210 TLIEKDPDYSYATARLLLHTIVREVLGS--DVPQA----QMALAYGDYFPRFIKKGVDNG 263

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL E ++ +DL  L   ++ ERD  F+YLGLQ LYDRYFLH+  +RIE+PQ FFMRVAMG
Sbjct: 264 LLDERLLQYDLQRLGAAIRAERDLKFDYLGLQTLYDRYFLHVRKTRIELPQVFFMRVAMG 323

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL E E+E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ ++
Sbjct: 324 LALNEVEREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESI 383

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+L+K++GGLGNDWT VR LG++I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 384 KENALLSKFAGGLGNDWTRVRALGSYIAGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGA 443

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM RV +   WTLFSP  V
Sbjct: 444 VCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMHRVMEKGHWTLFSPSSV 503

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLH+L+G +FE AY  YE QA RG I   R + A  LWRKMLTMLFETGHPWITFKD C
Sbjct: 504 PDLHELFGADFEKAYVAYEEQAARGAIGPARTVQATDLWRKMLTMLFETGHPWITFKDAC 563

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  + Q D+DKL  TI  
Sbjct: 564 NLRSPQQHAGVVHSSNLCTEITLNTSDSETAVCNLGSVNLLQHLKDGQIDHDKLRQTITV 623

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           A+R+LDNVIDIN + + KA+ SN  HR +GLG+M FQ  L+ L IPYAS  AVE AD+SM
Sbjct: 624 AMRMLDNVIDINYYAVRKARDSNLRHRPVGLGVMAFQDCLYELRIPYASQAAVEFADQSM 683

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPW 746
           E I ++A  AS ELA+ERG Y S++GSLW++G  P+D++ LLA+ R D L ++R+SRL W
Sbjct: 684 EAICYYAYWASTELAKERGKYLSYEGSLWERGQLPLDTLDLLAQARGDYLQVDRSSRLDW 743

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L++++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N+ L
Sbjct: 744 DALRQKIAQDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVINAGL 803

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK+  LWDE MI DLK+  GS+  I+R+P D+K +++TAFE+DP WL+E+ASRRQKW
Sbjct: 804 VRDLKRLGLWDEVMIMDLKHFKGSLHPIDRVPQDIKALYSTAFEVDPQWLVEAASRRQKW 863

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLN+Y+   SG+KLD  Y+ AW+ GLKTTYYLR++SAT VE ST+    G+LNAV
Sbjct: 864 IDQAQSLNIYMAGASGRKLDETYKLAWVRGLKTTYYLRTQSATHVEMSTVN--TGQLNAV 921

Query: 927 PVTDPNSSTHSLGIPSSCTS 946
                +S  H     ++ TS
Sbjct: 922 -----SSGPHGDAFGAAATS 936


>gi|222112112|ref|YP_002554376.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax
           ebreus TPSY]
 gi|221731556|gb|ACM34376.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           ebreus TPSY]
          Length = 974

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/933 (57%), Positives = 687/933 (73%), Gaps = 18/933 (1%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           A P+ A+P    +   Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++ 
Sbjct: 22  ATPTGAHP----LMHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVHGAQGAASASVREVVD 77

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+  V  L++   +    HIED+QDQVE  LM+  HH++ R YVLYRE R+  RA + 
Sbjct: 78  QLTQAVVRALMRSRPAGGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRERRAQERAQKK 137

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDG 192
                 P  P L +  D G  +  +  RL+ +VE AC+GL  DV +  +++ET +N+YDG
Sbjct: 138 EQL--LPQMPALYVQ-DQGQRVELDILRLQSLVEAACTGLGSDVQAAPIIAETMRNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +   ++  A I ++RTLIEK+P Y   TAR LL  + REVL       +      M   Y
Sbjct: 195 VPMDEVYKASILAARTLIEKDPGYTYATARLLLHTIVREVLG------RDVNPANMALAY 248

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            E F ++I +GV   LL   +M+FDL  L + LK ERD  F+YLGLQ LYDRYFLH+  +
Sbjct: 249 AENFPQFIRQGVDNELLDPRLMEFDLQRLGSALKAERDLQFDYLGLQTLYDRYFLHVRKT 308

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQ+FFMRVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+
Sbjct: 309 RIELPQSFFMRVAMGLALREDDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCY 368

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPD+L GI+ +++ENA+L+K++GGLGNDWT VR LGA I GTNG+SQGV+PFLKV N
Sbjct: 369 LTTVPDELEGIYESIKENALLSKFAGGLGNDWTRVRALGARIKGTNGESQGVVPFLKVVN 428

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 429 DTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 488

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHDLYG+ FE AY  YE +A+ GE+ +F+++ AV LWRKML+M
Sbjct: 489 VMEKGLWTLFSPSDVPDLHDLYGQAFEKAYIAYEAKAESGELPLFKRVPAVDLWRKMLSM 548

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  
Sbjct: 549 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDAETAVCNLGSVNLARHLK 608

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           +   D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ AL+ L I
Sbjct: 609 DGGIDHDKLRKTVSTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQDALYELRI 668

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS  AVE AD SME + ++A  AS +LAQERG YSS++GSLW QG+ P+DS+ LL + 
Sbjct: 669 PYASDAAVEFADTSMEALCYYAYWASTDLAQERGQYSSYQGSLWSQGILPLDSLQLLEQE 728

Query: 733 RDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++RT+RL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL V
Sbjct: 729 RGGYVEVDRTTRLDWDMLRAKIAQDGMRNSNCIAIAPTATISNIVGVDASIEPSFGNLSV 788

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSN+SG+FTV+N +LV +LKQ  LWD+ M+ DLK+  GS+  I+R+P  +K ++ATAFE+
Sbjct: 789 KSNLSGEFTVINQYLVRDLKQLGLWDDVMLMDLKHFKGSLHAIDRVPLTVKALYATAFEV 848

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
            P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT V
Sbjct: 849 APTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWIRGLKTTYYLRTQSATHV 908

Query: 912 EKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSC 944
           E ST+     +LNAV     ++   ++  PSS 
Sbjct: 909 EMSTVN--TRQLNAVASGASDTGEGTMA-PSSA 938


>gi|33593915|ref|NP_881559.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           pertussis Tohama I]
 gi|33563989|emb|CAE43254.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           pertussis Tohama I]
 gi|332383334|gb|AEE68181.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           pertussis CS]
          Length = 975

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/959 (56%), Positives = 693/959 (72%), Gaps = 53/959 (5%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++ LT Q V+ L+++  + 
Sbjct: 35  IIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQGAASARVRELVEQLTAQAVSALVRNRPAG 94

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYRE-------------ERSDVRAAQSHSKS 137
              HIED+QDQVE +LM+SG H + R YVLYRE             E+S   AAQ     
Sbjct: 95  GTFHIEDVQDQVELALMRSGEHDVARAYVLYRERRAQERAAAAEVLEKSSPAAAQE---- 150

Query: 138 DAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSES 196
                P L ++ D+G     +   L   +E A  GL Q   ++ +L ET KN+YDG+   
Sbjct: 151 -----PTLSVV-DNGVRRPLDLAALRATIEAAGEGLTQYTDTEAILKETVKNLYDGVPVD 204

Query: 197 DLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYF 256
           ++  + I ++R L+EK+P Y++VTAR LL  +R+EVL       ++ +  +M   Y EYF
Sbjct: 205 EVFKSAILAARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQADMATRYAEYF 258

Query: 257 CRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEM 316
             +I+ G++  LL   + ++DL  +A  L   RD  F YLGLQ LYDRYFLH+ G+RIE+
Sbjct: 259 PAFIQRGIEGGLLDAKLAEYDLERVAKALDGRRDLQFGYLGLQTLYDRYFLHVRGTRIEL 318

Query: 317 PQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTV 376
           PQ FFMRVAMGLAL+E ++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV
Sbjct: 319 PQVFFMRVAMGLALREADREARAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTV 378

Query: 377 PDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAV 436
            DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAV
Sbjct: 379 SDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAV 438

Query: 437 AVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQN 496
           AVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +N
Sbjct: 439 AVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEN 498

Query: 497 AGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
             WTLFSP +  DLHD YGK FE AY  YE +   GE+K+F+K+ AV+LWRKML+MLFET
Sbjct: 499 GEWTLFSPSDCPDLHDKYGKAFEQAYAGYEAKVASGELKLFKKMPAVSLWRKMLSMLFET 558

Query: 557 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN-- 614
           GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+++ E AVCNLGS+NL+AH   N  
Sbjct: 559 GHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNATEIAVCNLGSVNLVAHMKPNAN 618

Query: 615 ---QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLH 671
              + ++DKL  TI  A+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  LH++ 
Sbjct: 619 GGYELNHDKLKRTIGVAMRMLDNVIDINYYAVDKARNSNERHRPVGMGIMGFQDCLHVMR 678

Query: 672 IPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAE 731
           +PYAS +A++ AD SME + +HA  AS ELAQERG Y S++GSLW +G+ P D++ +L E
Sbjct: 679 VPYASQDAIDFADRSMEAVCYHAYWASSELAQERGRYQSYEGSLWSRGILPQDTLAMLRE 738

Query: 732 VR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLY 790
            R   + ++ +S L WD L+ R+K  GMRNSNC+AIAPTATI+NI G S  I+P++QNLY
Sbjct: 739 ERGGNVDVDDSSSLDWDTLRSRIKEHGMRNSNCIAIAPTATISNIIGASACIEPTFQNLY 798

Query: 791 VKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFE 850
           VKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L+K++ATAFE
Sbjct: 799 VKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRKLYATAFE 858

Query: 851 IDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATS 910
           ++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS
Sbjct: 859 VEPSWLVECASRRQKWIDQAQSLNIYMSGASGKKLDDTYKLAWQRGLKTTYYLRTLGATS 918

Query: 911 VEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP---------SSCTSDT------ECEVCQ 954
            EKST +G  G+LNAV   D  + +     P         + CT         ECE CQ
Sbjct: 919 AEKSTGRG--GELNAVSAGDHGAGSAVSAAPVLPEPEIVGAVCTMRPGDPGFEECEACQ 975


>gi|121595924|ref|YP_987820.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax sp.
           JS42]
 gi|120608004|gb|ABM43744.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax sp.
           JS42]
          Length = 972

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/915 (58%), Positives = 680/915 (74%), Gaps = 17/915 (1%)

Query: 14  AFPSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           A P+ A+P    +   Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++ 
Sbjct: 22  ATPTGAHP----LMHYQIIRRNGAVVPFEPQKIAVAMMKAFLAVHGAQGAASASVREVVD 77

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            LT+  V  L++   +    HIED+QDQVE  LM+  HH++ R YVLYRE R+  RA + 
Sbjct: 78  QLTQAVVRALMRSRPAGGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRERRAQERAQKK 137

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDG 192
                 P  P L +  D G  +  +  RL+ +VE AC+GL  DV +  +++ET +N+YDG
Sbjct: 138 EQL--LPQMPALYVQ-DQGQRVELDILRLQSLVEAACTGLGSDVQAAPIIAETMRNLYDG 194

Query: 193 LSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLY 252
           +   ++  A I ++RTLIEK+P Y   TAR LL  + REVL       +     +M   Y
Sbjct: 195 VPMDEVYKASILAARTLIEKDPGYTYATARLLLHTIVREVLG------RDVNPADMALAY 248

Query: 253 PEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
            E F ++I +GV   LL   +M+FDL  L + LK ERD  F+YLGLQ LYDRYFLH+  +
Sbjct: 249 AENFPQFIRQGVDNELLDPRLMEFDLQRLGSALKAERDLQFDYLGLQTLYDRYFLHVRKT 308

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQ FFMRVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+
Sbjct: 309 RIELPQTFFMRVAMGLALREDDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCY 368

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTTVPD+L GI+ +++ENA+L+K++GGLGNDWT VR LGA I GTNG+SQGV+PFLKV N
Sbjct: 369 LTTVPDELEGIYESIKENALLSKFAGGLGNDWTRVRALGARIKGTNGESQGVVPFLKVVN 428

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 429 DTAVAVNQGGKRKGAVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 488

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V +   WTLFSP +V DLHDLYG+ FE AY  YE +A+ GE+ +F+++ AV LWRKML+M
Sbjct: 489 VMEKGLWTLFSPSDVPDLHDLYGQAFEKAYIAYEAKAESGELPLFKRVPAVDLWRKMLSM 548

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  
Sbjct: 549 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTSDAETAVCNLGSVNLARHLK 608

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
           +   D+DKL  T+ TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ AL+ L I
Sbjct: 609 DGGIDHDKLRKTVSTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQDALYELRI 668

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
           PYAS  AVE AD SME + ++A  AS +LAQERG YSS++GSLW QG+ P+DS+ LL + 
Sbjct: 669 PYASDAAVEFADTSMEALCYYAYWASTDLAQERGQYSSYQGSLWSQGILPLDSLQLLEQE 728

Query: 733 RDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
           R   + ++RT+RL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL V
Sbjct: 729 RGGYVEVDRTTRLDWDMLRAKIAQDGMRNSNCIAIAPTATISNIVGVDASIEPSFGNLSV 788

Query: 792 KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
           KSN+SG+FTV+N +LV +LKQ  LWD+ M+ DLK+  GS+  I+R+P  +K ++ATAFE+
Sbjct: 789 KSNLSGEFTVINQYLVRDLKQLGLWDDVMLMDLKHFKGSLHAIDRVPLTVKALYATAFEV 848

Query: 852 DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
            P WL+E+A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT V
Sbjct: 849 APTWLVEAAARRQKWIDQAQSLNIYMAGASGKKLDETYKLAWIRGLKTTYYLRTQSATHV 908

Query: 912 EKSTLKGVDGKLNAV 926
           E ST+     +LNAV
Sbjct: 909 EMSTVN--TRQLNAV 921


>gi|187479452|ref|YP_787477.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           avium 197N]
 gi|115424039|emb|CAJ50592.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella avium
           197N]
          Length = 970

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/944 (57%), Positives = 697/944 (73%), Gaps = 29/944 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+P KI+ A+ KAF+AV G   + S RV++++  LTEQ V  L+++  S 
Sbjct: 36  LIRRNGSVVGFEPGKIAIAMTKAFLAVNGGQGAASARVRELVGQLTEQVVNALVRNRPSG 95

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS--HSKSDAPIAPKLKIM 148
              HIED+QDQVE SLM+SG H + R YVLYRE R+  RAA +    K+  P  P L + 
Sbjct: 96  GTFHIEDVQDQVELSLMRSGQHDVARAYVLYRERRAQERAAAAEVQDKAAVPAEPTLNVN 155

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFSSR 207
            D+G     +  +L   +E A  GL + + ++ +L ET KN+YDG+   ++  + I ++R
Sbjct: 156 -DNGVRRPLDMAQLRATIEAAGVGLTEFIDTETILKETVKNLYDGVPVDEVFKSAILAAR 214

Query: 208 TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
            L+EK+P Y++VTAR LL  +R+EVL       ++ +   M   Y  YF  +I+ G++A 
Sbjct: 215 ALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQASMAERYATYFPTFIQRGIEAG 268

Query: 268 LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
           LL   + +FDL  +A  L   RD  F YLGLQ LYDRYFLH+ G+RIE+PQ FFMRVAMG
Sbjct: 269 LLDAKLAEFDLERIARALNANRDLQFGYLGLQTLYDRYFLHVRGTRIELPQVFFMRVAMG 328

Query: 328 LALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGAL 387
           LAL+E+++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV DDL GI+ A+
Sbjct: 329 LALRESDREARAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAI 388

Query: 388 QENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGA 447
           +ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGA
Sbjct: 389 KENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGA 448

Query: 448 VCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEV 507
           VC YLETWH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +N  WTLFSP + 
Sbjct: 449 VCTYLETWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVVENGDWTLFSPSDC 508

Query: 508 SDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
            DLHD YG+ FE AY  YE +A  GE+K+F+K+ A++LWRKML+MLFETGHPWITFKDPC
Sbjct: 509 PDLHDKYGRAFEQAYLGYEAKAASGELKLFKKMPAISLWRKMLSMLFETGHPWITFKDPC 568

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF---ANN--QFDYDKLA 622
           NIRSPQQH+GVVHSSNLCTEITLN++  E AVCNLGS+NL+AH    AN   + D+DK+ 
Sbjct: 569 NIRSPQQHIGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMKPSANGGYELDHDKIK 628

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+  A+R+LDNVIDIN + +EKA+ SN  HR +GLG+MGFQ  LH++ +PYAS  A+E 
Sbjct: 629 HTVGIAMRMLDNVIDINYYAVEKARNSNLRHRPVGLGIMGFQDCLHMMRVPYASQAAIEF 688

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRT 741
           AD SME + + A  AS  LA+ERG Y S++GSLW +G+ P DSI +L + R   + ++ +
Sbjct: 689 ADRSMEAVCYQAYWASSTLAEERGRYPSYEGSLWSRGILPQDSIAMLRDERGGNVDVDES 748

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           S L WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+FTV
Sbjct: 749 SSLDWDTLRARIKAHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV 808

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           VN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L++++ATAFE++P WL+E A+
Sbjct: 809 VNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPTELRELYATAFEVEPSWLVECAA 868

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDG 921
           RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS EKST +G  G
Sbjct: 869 RRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWQRGLKTTYYLRTMGATSAEKSTGRG--G 926

Query: 922 KLNAVPVTDPNSSTHSL-----GIPSSCTSDT------ECEVCQ 954
           +LNAV   + ++S   +      + ++CT         ECE CQ
Sbjct: 927 ELNAVSAGNHSASAAPVLPEPEVVGAACTMRPGDPGFEECEACQ 970


>gi|293603287|ref|ZP_06685716.1| ribonucleotide-diphosphate reductase alpha subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292818322|gb|EFF77374.1| ribonucleotide-diphosphate reductase alpha subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 976

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/950 (56%), Positives = 687/950 (72%), Gaps = 34/950 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+PSKI+ A+ KAF+AV G   + S RV+++++NLT Q V  L+++  + 
Sbjct: 35  IIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQGAASARVRELVENLTSQAVNALVRNRPNG 94

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA----QSHSKSDAPIAPKLK 146
              HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAA    +   KS A  A  + 
Sbjct: 95  GTFHIEDIQDQVELALMRSGEHDVARAYVLYREKRTQERAAAAAAEGQEKSAAAPAEHVL 154

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFS 205
            + D G     +   L   +  A  GL + + S+ +L ET KN+YDG+   ++  + I S
Sbjct: 155 NVTDAGVRRPLDLAELRATIVAAGEGLAEFIDSEAILKETVKNLYDGIPVDEVFKSAILS 214

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +R L+EK+P Y++VTAR LL  +R+EVL       ++ +   M   Y EYF  +I  G++
Sbjct: 215 ARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQDGMVARYAEYFPTFIARGIE 268

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
             LL   + ++DL  L   L  +RD  F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVA
Sbjct: 269 GGLLSPELANYDLTRLGKALNAKRDLQFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVA 328

Query: 326 MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
           MGLAL+E ++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV DDL GI+ 
Sbjct: 329 MGLALREADRETRAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYD 388

Query: 386 ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
           A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRK
Sbjct: 389 AIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRK 448

Query: 446 GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
           GAVC YLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +   WTLFSP 
Sbjct: 449 GAVCTYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPS 508

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
           +  DLHD YG+ FE AY  YE++   GE+K+++K+ A+ LWRKML+MLFETGHPWITFKD
Sbjct: 509 DCPDLHDKYGRAFEEAYIGYEKRVASGELKLYKKMPALTLWRKMLSMLFETGHPWITFKD 568

Query: 566 PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-----ANNQFDYDK 620
           PCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH         + D DK
Sbjct: 569 PCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMKPAAGGGFELDLDK 628

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           +  T+  A+R+LDNVIDIN + +EKA+ SN  HR +G+G+MGFQ  L ++ +PYAS  AV
Sbjct: 629 IKRTVSIAMRMLDNVIDINYYAVEKARNSNARHRPVGMGIMGFQDCLQMMRVPYASQAAV 688

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMN 739
           E AD SME + +HA  AS  LA+ERG Y S++GSLW +G+ P D++ +L + R   + ++
Sbjct: 689 EFADRSMEAVCYHAYFASSLLAEERGRYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVD 748

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
            +S L WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+F
Sbjct: 749 ESSTLDWDTLRARIKQHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEF 808

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L++++ATAFE++P WL+E 
Sbjct: 809 TVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRELYATAFEVEPSWLVEC 868

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS EKST +G 
Sbjct: 869 ASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWTRGLKTTYYLRTLGATSAEKSTGRG- 927

Query: 920 DGKLNAVPVTDPNSSTHSLGIP---------SSCTSDT------ECEVCQ 954
            G+LNAV     +++      P         + CT         ECE CQ
Sbjct: 928 -GELNAVTAGGQSTAAAVGAAPVLPEPEVLGAVCTMRPGDPGFEECEACQ 976


>gi|311696540|gb|ADP99413.1| ribonucleotide-diphosphate reductase subunit alpha [marine
           bacterium HP15]
          Length = 921

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/947 (57%), Positives = 695/947 (73%), Gaps = 39/947 (4%)

Query: 17  SLAYPFPEK---IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIK 73
           +LA P P      + +QVIKRNG +  FDPSKIS A+ KAF+AVEG  A+ S R+ D + 
Sbjct: 5   ALAEPRPTSHTDTESLQVIKRNGTLVGFDPSKISIAVTKAFLAVEGDTAAGSARINDAVH 64

Query: 74  NLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS 133
            +T+Q +  + +  K+   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA   
Sbjct: 65  RVTDQVIQAIGRRLKAGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARERA--R 122

Query: 134 HSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGL 193
           H+  +A   P L +    G +   +   +++ VE+A +GL+ +    ++ +   N+YDG+
Sbjct: 123 HAPVEA--HPHLTVKKTSGEIAPLDLGLMKLQVEQAATGLEGIDGDSLVDDALTNLYDGI 180

Query: 194 SESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRRE---VLTTVYKKPQKATHHEMQC 250
           +E D+ +ALI ++R+ IE+EP+Y+ VTAR LLE+LR E    L      P       +  
Sbjct: 181 AEEDVLSALIMTARSRIEREPDYSAVTARLLLEQLRLENAAALGLPISLP-------LAE 233

Query: 251 LYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHIN 310
           +YP+    ++E G++  LL E++  FDL  L   L+ ERD  F +LGLQ LYDRYFLH N
Sbjct: 234 IYPQALSAFVEAGIRYELLDEALAAFDLERLGAALQPERDLQFGFLGLQTLYDRYFLHWN 293

Query: 311 GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
            +R+E+PQ FFMRVAMGLAL+E +   RA+EFYNLLSSF +M STPTLFNSGTRH QLSS
Sbjct: 294 KARLELPQVFFMRVAMGLALREDDPNARAIEFYNLLSSFDYMASTPTLFNSGTRHSQLSS 353

Query: 371 CFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKV 430
           C+LTTV DDL  I+GA+++NAML+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV
Sbjct: 354 CYLTTVGDDLEDIYGAIRDNAMLSKWAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKV 413

Query: 431 ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFM 490
            NDTAVAVNQGGKRKGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL +
Sbjct: 414 VNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLI 473

Query: 491 KRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKML 550
           +R+ ++  WTLFSP +  DLHDLYG  F   YE+YE  A++G+IK+F+KI A  LWRKML
Sbjct: 474 ERMREDRDWTLFSPSDAPDLHDLYGNAFRERYEHYEALAEQGKIKLFKKIPAKQLWRKML 533

Query: 551 TMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAH 610
           T+LFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH
Sbjct: 534 TVLFETGHPWITFKDPCNLRSPQQHRGVVHSSNLCTEITLNTSADEIAVCNLGSVNLTAH 593

Query: 611 FANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLL 670
            AN + D  +L  T+ TAVR+LDNVIDIN + + +A+ SN  HR +GLG+MGFQ AL+ L
Sbjct: 594 IANGELDVQRLEQTVNTAVRMLDNVIDINYYAVPQARNSNLKHRPVGLGIMGFQDALYQL 653

Query: 671 HIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLA 730
            +PY+SPEAVE AD +ME +S+ AI AS  LA ERGAY S++GSLW QG+ PIDSI LL 
Sbjct: 654 GLPYSSPEAVEFADVAMEQLSYFAIRASATLAGERGAYESYEGSLWQQGILPIDSINLLK 713

Query: 731 EVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQN 788
           E R E  L++N  +RL W  +++ + T GMRNSN MAIAPTATI+NI GVSQSI+P+YQN
Sbjct: 714 ENRREGDLSVNTNARLDWSPVRELIATNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQN 773

Query: 789 LYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATA 848
           L+VKSN+SG+FTVVN  LV +LK   LWD  M++DLKY DGS+  I+RIP++LK  +ATA
Sbjct: 774 LFVKSNLSGEFTVVNPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPNELKARYATA 833

Query: 849 FEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSA 908
           FEID  WL+E+A+RRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  A
Sbjct: 834 FEIDARWLVEAAARRQKWLDQAQSLNLYMAEPSGKKLDALYQLAWERGLKTTYYLRSLGA 893

Query: 909 TSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           T  EK+            PV  P         P  C+  D +CE CQ
Sbjct: 894 TGAEKT-----------APVAAPQ--------PQVCSIDDPDCEACQ 921


>gi|262369329|ref|ZP_06062657.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           johnsonii SH046]
 gi|262315397|gb|EEY96436.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           johnsonii SH046]
          Length = 943

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/951 (56%), Positives = 690/951 (72%), Gaps = 43/951 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V SFD  KIS AI KAF+AVEG+ ++ S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVASFDAEKISVAIGKAFLAVEGQQSADSSRIHDRISQLTEMVLNTFSRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVR--AAQSHSKSDAPIAPKLK 146
           S   +HIE+IQDQVE +LM++G  K+ R YV+YR++R+D R  A ++H        P L+
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYRDQRADARKQAGENHH-------PTLQ 123

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           I   +G L   + ++LE  V +A  GL+ ++ + ++ ET KN+Y+G+  SD+ T ++ ++
Sbjct: 124 ITDANGQLQPLDMRKLEATVTKAAEGLEGINVQAIIDETIKNLYNGVKASDIATTMMMAT 183

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RT IE+EPNY  VTAR L ++L    LT +      A    ++         ++++G++ 
Sbjct: 184 RTRIEQEPNYTYVTARLLRDELVATGLTFLGLSEDTAEGDALET--------FLKKGIEL 235

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H +G R E+PQ FFMRV+M
Sbjct: 236 DLLSPELLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSDGVRFELPQLFFMRVSM 295

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GL+L E  +E+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA
Sbjct: 296 GLSLNEANREERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIDDDLYDIYGA 355

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKG
Sbjct: 356 MRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKG 415

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E
Sbjct: 416 AVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSE 475

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDL G EF   Y +YE  A    + + +KI A  LWRKML+MLFETGHPWITFKD 
Sbjct: 476 TPDLHDLMGAEFAERYAHYEAIAKETNM-LHKKIRAKDLWRKMLSMLFETGHPWITFKDV 534

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CN+RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      D +KLA T++
Sbjct: 535 CNLRSPQQHVGVVHSSNLCTEITLNTSKDEIAVCNLGSINLVQHVQGGVLDREKLARTVK 594

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S  AV+ ADES
Sbjct: 595 TAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMQLAYGSDAAVDFADES 654

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME IS++AIS S +LA ERG Y +FKGSLWDQG+ PIDS+ L+A+ R E    ++RT RL
Sbjct: 655 MEVISYYAISTSSDLAVERGTYETFKGSLWDQGILPIDSLDLVAKTRPERMFEVDRTQRL 714

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N 
Sbjct: 715 DWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINP 774

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQ
Sbjct: 775 YLVRALKDRGLWDSVMVNDLKHFEGSVQKISRIPEELKAIFATAFEVEPRWIVDAASRRQ 834

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LN
Sbjct: 835 KWIDQAQSLNLYISGANGKKLDLTYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALN 892

Query: 925 AVP--------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
           AV                     V +      +  +P +C+ D  +CE CQ
Sbjct: 893 AVKPATVTAAPVAAVAQEVKPEVVAEDEGFGQAAPVPMACSIDNPDCEACQ 943


>gi|120556761|ref|YP_961112.1| ribonucleotide-diphosphate reductase subunit alpha [Marinobacter
           aquaeolei VT8]
 gi|120326610|gb|ABM20925.1| ribonucleoside-diphosphate reductase, alpha subunit [Marinobacter
           aquaeolei VT8]
          Length = 949

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/933 (57%), Positives = 693/933 (74%), Gaps = 34/933 (3%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
           + +QVIKRNG + SF+P+KIS A+ KAF+AVEG  A+ S R+ D +  +TEQ V  + + 
Sbjct: 46  QSLQVIKRNGTLVSFNPAKISVAVTKAFLAVEGDQAAGSARINDAVHRVTEQVVQAISRR 105

Query: 87  NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA--PK 144
            K+   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA       D P+   P 
Sbjct: 106 LKAGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARQRAV------DEPVEAHPH 159

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           L +   DG++   +   ++  VE+A +GL  ++   ++ +  +N+YDG+ E+++ +ALI 
Sbjct: 160 LTVKKADGSIAPLDLGLMKQQVEQASTGLDGINGDSLVEDALRNLYDGIEETEVLSALIM 219

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           ++R  IE+EP+Y+ VTAR LLE+LR E    +   P+     E   +YP+    +I  G+
Sbjct: 220 TARGRIEREPDYSAVTARLLLEQLRLETAEAL-DLPRSLPLAE---IYPQALSAFIHAGI 275

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +  LL E++  FDL  L N LK ERD  F +LGLQ LYDRYFLH N +R+E+PQ FFMRV
Sbjct: 276 RYELLDEALAAFDLERLGNALKPERDLQFGFLGLQTLYDRYFLHWNKARLELPQVFFMRV 335

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL+E +   RA+EFY LLSSF +M STPTLFNSGTRH QLSSC+LTTV DDL GI+
Sbjct: 336 AMGLALREDDPNARAIEFYELLSSFDYMASTPTLFNSGTRHSQLSSCYLTTVGDDLEGIY 395

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
           GA+++NA+L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 396 GAIRDNALLSKWAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKVVNDTAVAVNQGGKR 455

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+ ++  WTLFSP
Sbjct: 456 KGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMREDREWTLFSP 515

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +V DLHDLYG  F   Y++YE  A++G+IK+F+KI A  LWRKMLT+LFETGHPWITFK
Sbjct: 516 SDVPDLHDLYGNAFRERYQHYEALAEQGKIKLFKKIPAKQLWRKMLTVLFETGHPWITFK 575

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DPCN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH  + + D  +L  T
Sbjct: 576 DPCNLRSPQQHQGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAAHIKDGELDVTRLERT 635

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TAVR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L +PY+SPEAVE AD
Sbjct: 636 VNTAVRMLDNVIDINFYAVPQARNSNLKHRPVGLGLMGFQDALYQLGLPYSSPEAVEFAD 695

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTS 742
            +ME +S+ A+ AS  LA ERGAY +++GSLW QG+ P+DS+GLL + R   +L++N  S
Sbjct: 696 VAMEQLSYFALRASATLAGERGAYDTYEGSLWSQGILPMDSVGLLKDNRRDGDLSLNTNS 755

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
           RL W  +++ +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTVV
Sbjct: 756 RLDWTPVRELIAKNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVV 815

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N  LV +LK   LWD  M++DLKY DGS+  I+RIP +LK  +ATAFEIDP WL+E+A+R
Sbjct: 816 NPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPAELKARYATAFEIDPRWLVEAAAR 875

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW  GLKTTYYLRS  AT  EK+        
Sbjct: 876 RQKWLDQAQSLNLYMAEPSGKKLDALYQLAWERGLKTTYYLRSLGATGAEKT-------- 927

Query: 923 LNAVPVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
               PV+ P         P  C+ D  +CE CQ
Sbjct: 928 ---APVSAPQ--------PQVCSIDNPDCEACQ 949


>gi|94986919|ref|YP_594852.1| ribonucleotide-diphosphate reductase subunit alpha [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731168|emb|CAJ54530.1| Ribonucleotide reductase large subunit [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 916

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/946 (58%), Positives = 694/946 (73%), Gaps = 40/946 (4%)

Query: 16  PSLAYPFPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNL 75
           P +A+     +  +QVI+RNG + SF   KI+ A+ KAF+AV+G+ +  S  ++D++ +L
Sbjct: 4   PEVAF----SLAAMQVIRRNGDIVSFKSEKIAAALTKAFIAVKGEQSPLSSSLRDVVTHL 59

Query: 76  TEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS 135
           TE  ++ L         +HIEDIQDQVE +LMQSG H + R YVLYRE+R+ +R   + S
Sbjct: 60  TETVISALTHRFPDGGSIHIEDIQDQVERALMQSGEHDVARAYVLYREKRAAMR---NTS 116

Query: 136 KSDAPIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSE 195
           +  A +      ++D G     +   L  I   AC  L  VSS  + + T K++YDG+S 
Sbjct: 117 EKKAVLH-----LVDKGEKKVLDHTWLMNICHVACKNLTSVSSISIFNNTLKSLYDGMSL 171

Query: 196 SDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEY 255
           +D+ ++LI S+RT+IE EP Y KVTAR L   L  EVL    +  +    H+++     Y
Sbjct: 172 ADVYSSLILSARTMIEYEPEYNKVTARLLRLSLAYEVLD---QSTELMDLHQLKIATISY 228

Query: 256 FCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIE 315
           F ++IE G+ A LL   +  F+  YLA  L  ERD  F Y+G+Q LYDRYFLHI   RIE
Sbjct: 229 FPKFIELGINAGLLDPRLSTFNYSYLAQALVPERDELFGYIGIQTLYDRYFLHIKKRRIE 288

Query: 316 MPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTT 375
           +PQ FFMRVAMGLAL E +KE +A+EFYNLLS+F FM STPTLFNSGT  PQLSSCFLTT
Sbjct: 289 LPQLFFMRVAMGLALNEKKKEDKAIEFYNLLSNFDFMSSTPTLFNSGTIRPQLSSCFLTT 348

Query: 376 VPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTA 435
           + DDL  IF +++ENA+L KY+GG+GNDWTPVR LG+ I GTNG+SQGVIPF+KVANDTA
Sbjct: 349 INDDLENIFQSIKENALLQKYAGGIGNDWTPVRALGSPIKGTNGQSQGVIPFMKVANDTA 408

Query: 436 VAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQ 495
           +AVNQGGKRKGAVCAYLETWH+D+E+FLDLRKNTGDDRRRTHDMNTANW+PDLFMKRV +
Sbjct: 409 LAVNQGGKRKGAVCAYLETWHLDIEDFLDLRKNTGDDRRRTHDMNTANWVPDLFMKRVLE 468

Query: 496 NAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFE 555
           N+ WTLFSP++V +LH+ +G EFE  Y +YE +   GEI +F+K+SAV LWRKMLTMLFE
Sbjct: 469 NSDWTLFSPNDVPELHEKFGLEFEKFYTHYEAKTLTGEITLFKKVSAVQLWRKMLTMLFE 528

Query: 556 TGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQ 615
           TGHPWITFKD CN+RSPQQH+GV+HSSNLCTEITLN+S EE AVCNLGSINL +H  N +
Sbjct: 529 TGHPWITFKDACNLRSPQQHIGVIHSSNLCTEITLNTSKEEIAVCNLGSINLSSHLINGE 588

Query: 616 FDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYA 675
            D +KL+ TI TA+R+LDNVIDIN +   KA  +N  HR IG+G+MGF   L+ L IPYA
Sbjct: 589 VDQNKLSQTIATALRMLDNVIDINYYNSPKASYANLQHRPIGIGIMGFADCLYKLGIPYA 648

Query: 676 SPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE 735
           S +AVE AD SME + ++   AS ELA+ERGAYS+F GSLWD+ + P+DS+ LL + R  
Sbjct: 649 SHQAVEFADRSMEIVCYYTYWASTELAKERGAYSTFPGSLWDRKILPLDSLDLLLKERGG 708

Query: 736 -LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSN 794
            L ++R+SRL WD LK R+   GMRNSNC+++APTATI+NI GVSQ I+P+YQNLYVKSN
Sbjct: 709 FLEVDRSSRLDWDALKDRIAKYGMRNSNCVSLAPTATISNIIGVSQGIEPAYQNLYVKSN 768

Query: 795 MSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPM 854
           MSG+FT+VN +LVN+LK+ +LWDEAM++DLKY DGS+  I+R+PD LKK++ATAFEIDP+
Sbjct: 769 MSGEFTIVNEYLVNDLKKLNLWDEAMVADLKYFDGSVAYIDRVPDSLKKLYATAFEIDPV 828

Query: 855 WLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEK- 913
           WLIE+ASRRQKWIDQAQSLNLYLD PSGKK+D IY+ AWL GLKTTYYLRS  A+ VEK 
Sbjct: 829 WLIEAASRRQKWIDQAQSLNLYLDTPSGKKMDEIYKLAWLRGLKTTYYLRSLGASQVEKV 888

Query: 914 -----STLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
                S LK  D  L A  + DP                 ECE CQ
Sbjct: 889 GTNSQSVLKK-DTVLRACSIDDP-----------------ECEACQ 916


>gi|50083945|ref|YP_045455.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. ADP1]
 gi|49529921|emb|CAG67633.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ADP1]
          Length = 941

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/947 (57%), Positives = 691/947 (72%), Gaps = 37/947 (3%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LTE  +    +   
Sbjct: 11  LQVIKRNGEVATFDAEKISVAIGKAFLAVEGQQSADSSRIHDRISQLTEMVLNTFNRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G HKI R YV+YRE+RS+ R      +S A   P L+I 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEHKIARSYVIYREQRSNAR-----QQSGANHHPTLQIT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L   +   L+  VE+A  GL+ +  + ++ ET KN+Y+G+  SD+ T ++ ++RT
Sbjct: 126 DAQGQLQPLDLDALKATVEKAAEGLEGIEIQAIVEETVKNLYNGVKVSDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE EPNY  VTAR L  +L  + L  +      A +  ++         ++++GV+  L
Sbjct: 186 RIEHEPNYTYVTARLLRNELVAKGLEFLGLSEDTAENDALET--------FLKKGVELEL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +++FDL  LA  ++ ER   F YLGLQ LYDRYF+H +G R E+PQ FFMRV+MGL
Sbjct: 238 LDPELLNFDLATLAAAIQPERSNQFTYLGLQTLYDRYFIHSDGVRYELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A+ E  +E+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 AINEDNREERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYNIYGAIR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P EV 
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWLPDLFMQRVFEDGEWTLFTPSEVP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G+EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGEEFAQRYAYYESIAKEQNL-LHKKVRAQDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      D DKLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTSDDEIAVCNLGSINLVQHVQGGVLDRDKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ +++ Y S EAV  ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNMAYGSDEAVNFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERG YS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLAIERGVYSTFKGSLWDQGILPIDSLDIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRNKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 P------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                              VT  +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPTTVAAPVAAVAQETKPEVTAEDGFTTAAPVPMACSIDNPDCEACQ 941


>gi|311103858|ref|YP_003976711.1| ribonucleoside-diphosphate reductase subunit alpha [Achromobacter
           xylosoxidans A8]
 gi|310758547|gb|ADP13996.1| ribonucleoside-diphosphate reductase, alpha subunit [Achromobacter
           xylosoxidans A8]
          Length = 976

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/951 (56%), Positives = 687/951 (72%), Gaps = 36/951 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+P+KI+ A+ KAF+AV G   + S RV+++++NLT Q V  L+++  + 
Sbjct: 35  IIRRNGSVVGFEPNKIAIAMTKAFLAVNGGQGAASARVRELVENLTGQAVNALVRNRPNG 94

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA-----QSHSKSDAPIAPKL 145
              HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAA      +  K+ AP    L
Sbjct: 95  GTFHIEDIQDQVELALMRSGEHDVARAYVLYREKRTQERAAAAAAADTQEKAAAPQEHVL 154

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIF 204
            +  D G     +   L   +E A  GL + + ++ +L ET KN+YDG+   ++  + I 
Sbjct: 155 NVT-DAGVRRPLDLAELRATIEAAGEGLAEFIDTEAILKETVKNLYDGIPVDEVFKSAIL 213

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGV 264
           S+R L+EK+P Y++VTAR LL  +R+EVL       ++ +   M   Y EYF  +I  G+
Sbjct: 214 SARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQDGMAARYAEYFPTFIARGI 267

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
           +  LL   +  +DL  L + L  +RD  F YLGLQ LYDRYFLHI G+RIE+PQ FFMRV
Sbjct: 268 EGGLLSPDLASYDLTKLGHALNAKRDLQFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRV 327

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL+E ++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV DDL GI+
Sbjct: 328 AMGLALREADRETRAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIY 387

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 388 DAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKR 447

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVC YLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +   WTLFSP
Sbjct: 448 KGAVCTYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSP 507

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +  DLHD YG+ FE AY  YE +   GE+K+F+K+ A+ LWRKML+MLFETGHPWITFK
Sbjct: 508 SDCPDLHDKYGRAFEEAYVGYEARVASGELKLFKKMPALNLWRKMLSMLFETGHPWITFK 567

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-----ANNQFDYD 619
           DPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH         + D+D
Sbjct: 568 DPCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMKPAAGGGFELDHD 627

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           K+  T+  A+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  L ++ +PYAS  A
Sbjct: 628 KIKRTVSIAMRMLDNVIDINYYAVDKARNSNARHRPVGMGIMGFQDCLQMMRVPYASQSA 687

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAM 738
           VE AD SME + +HA  AS  LA+ERG Y S++GSLW +G+ P D++ +L + R   + +
Sbjct: 688 VEFADRSMEAVCYHAYWASSLLAEERGRYQSYEGSLWSRGILPQDTLKMLRDERGGHVEV 747

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           + +S L WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+
Sbjct: 748 DESSTLDWDTLRARIKKHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGE 807

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FTVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L+ ++ATAFE++P WL+E
Sbjct: 808 FTVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRDLYATAFEVEPSWLVE 867

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
            ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS EKST +G
Sbjct: 868 CASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWKRGLKTTYYLRTLGATSAEKSTGRG 927

Query: 919 VDGKLNAVPVTDPNSSTHSLGIP---------SSCTSDT------ECEVCQ 954
             G+LNAV     ++S      P         + CT         ECE CQ
Sbjct: 928 --GELNAVSAGGQSTSAAVAAAPVLPEPEVLGAVCTMRPGDPGFEECEACQ 976


>gi|198284353|ref|YP_002220674.1| ribonucleoside-diphosphate reductase subunit alpha
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665782|ref|YP_002427015.1| ribonucleotide-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248874|gb|ACH84467.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517995|gb|ACK78581.1| ribonucleotide-diphosphate reductase, alpha subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 948

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/952 (57%), Positives = 696/952 (73%), Gaps = 40/952 (4%)

Query: 23  PEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTR 82
           P +    +VI+RN  + +FD SKI  A+ KAF+AVEG   + S RV+D++  LTEQ +  
Sbjct: 17  PSEASHYKVIRRNNAMVNFDASKIHIAVTKAFLAVEGGSGAASARVRDLVSRLTEQVIEA 76

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           L +        HIEDIQDQVE +LM++G H++ R YVLYREER+  R  Q+ +++ A + 
Sbjct: 77  LKRRQPGGGTFHIEDIQDQVELALMRAGEHEVARAYVLYREERARERRQQAAAETPADV- 135

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETA 201
           P +++   +G+  + +  RL  +++EACSGL   VS   +L  T KN+YDG+SE +L  A
Sbjct: 136 PVIRVSYPNGSQRALDMVRLRAVIDEACSGLGTAVSIDAILGNTVKNLYDGISEDELFQA 195

Query: 202 LIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIE 261
            I +SR LIE++P YA  +AR LL+++R EVL       + AT  EM   YP+YF  Y++
Sbjct: 196 PILASRVLIERDPAYAYASARLLLDRVRWEVLG------EAATQAEMTARYPQYFRDYLQ 249

Query: 262 EGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFF 321
            G++  L+   +  +DL  +   L+ ERD  F+YLG+QILYDRYFLH+   RIE+PQAF+
Sbjct: 250 TGIQNELIDPRLGQYDLERITAALRPERDLDFQYLGMQILYDRYFLHVRERRIELPQAFW 309

Query: 322 MRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY 381
           MRVAMGLA+ E ++E  A+ FY +LSSF F+ STPTLFN+GT  PQLSSCFLTTV DDL 
Sbjct: 310 MRVAMGLAMNEVDRETHAIAFYEVLSSFDFVSSTPTLFNAGTLRPQLSSCFLTTVGDDLD 369

Query: 382 GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
            I+ A++ENAML+K+SGGLGNDWTPVR LG+ I GTNGKSQGV+PFLKV NDTAVAVNQG
Sbjct: 370 DIYEAIKENAMLSKFSGGLGNDWTPVRALGSFIKGTNGKSQGVVPFLKVVNDTAVAVNQG 429

Query: 442 GKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTL 501
           GKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV  NA WTL
Sbjct: 430 GKRKGAVCAYLETWHMDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMERVENNAMWTL 489

Query: 502 FSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWI 561
           FSP+E  DLHDL G  F   YE+YER AD G I++F++I A+ LWRKMLTMLFETGHPWI
Sbjct: 490 FSPNETPDLHDLTGSAFRERYEHYERMADAGGIELFKRIPAIHLWRKMLTMLFETGHPWI 549

Query: 562 TFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN-------- 613
           TFKDPCN+RSPQQHVGVVHSSNLCTEITLN++++E AVCNLGS+NL++H           
Sbjct: 550 TFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNAKEIAVCNLGSVNLVSHLRAVADAGALR 609

Query: 614 ---------NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQ 664
                       D +KL  TIR A+R+LDNVID+N + + KA+ SN  HR +GLGLMGF 
Sbjct: 610 EDSTPEELLAMMDGEKLHHTIRVAMRMLDNVIDMNYYAVAKARNSNLRHRPVGLGLMGFS 669

Query: 665 SALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPID 724
            AL  + IPYAS  A+  AD S E IS+HAI AS +LA+ERG+Y SF GSLW QG+ PID
Sbjct: 670 DALLQMRIPYASAAALAFADISQEVISYHAIDASADLARERGSYQSFPGSLWSQGILPID 729

Query: 725 SIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSID 783
           SI LLA  R+  + ++R+  L W  L+ +V+  GMRNSNC+AIAPTATI+NI GVSQ I+
Sbjct: 730 SIDLLAAGREHGVDVDRSQHLDWATLRSKVRG-GMRNSNCLAIAPTATISNIVGVSQGIE 788

Query: 784 PSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKK 843
           P YQNLYVKSN+SG+FTVVNS+LV++LK+ +LWDE M++DLKY DGS+  ++RIP  +K 
Sbjct: 789 PIYQNLYVKSNLSGEFTVVNSYLVHDLKRLELWDEVMVNDLKYFDGSVMPVDRIPASIKP 848

Query: 844 IHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYL 903
           ++A AFE DP WL+E+A+RRQKW+DQAQSLNLY  +PSGKK+D IYR AW  GLKTTYYL
Sbjct: 849 LYANAFETDPEWLVEAAARRQKWLDQAQSLNLYFGQPSGKKIDEIYRLAWKRGLKTTYYL 908

Query: 904 RSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           RS  AT+ EKST++   G LNAV            G P +C   D  CE CQ
Sbjct: 909 RSLGATAAEKSTVQ--TGTLNAV----------VSGQPKACAIDDPTCEACQ 948


>gi|163854888|ref|YP_001629186.1| ribonucleotide-diphosphate reductase subunit alpha [Bordetella
           petrii DSM 12804]
 gi|163258616|emb|CAP40915.1| ribonucleoside-diphosphate reductase alpha chain [Bordetella
           petrii]
          Length = 974

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/971 (55%), Positives = 698/971 (71%), Gaps = 39/971 (4%)

Query: 14  AFPSLAYPFPEKIKGVQ-----VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRV 68
           A P      P    G Q     VI+RNG V  F+PSKI+ A+ KAF+AV G   + S RV
Sbjct: 13  AVPPSQTDVPADANGGQWASYNVIRRNGSVVGFEPSKIAIAMTKAFLAVNGGQGAASARV 72

Query: 69  QDIIKNLTEQTVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDV 128
           +++++ L  Q V  L+++  +    HIEDIQDQVE +LM+SG H + R YVLYRE+R+  
Sbjct: 73  RELVETLASQAVNALVRNRPAGGTFHIEDIQDQVELALMRSGEHDVARAYVLYREKRAQE 132

Query: 129 RAAQSH--SKSDAPIAPKLKI-MMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSE 184
           RAA +    K+   +A +  + ++D+G     +   L   +E A  GL + + ++ +L E
Sbjct: 133 RAAAAEVLEKTAPAVAQESHLNVVDNGVRRPLDLAALRATIEAAGEGLSEFIDTEAILKE 192

Query: 185 TYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKAT 244
           T KN+YDG+   ++  + I S+R L+EK+P Y++VTAR LL  +R+EVL       ++ +
Sbjct: 193 TVKNLYDGIPVDEVFKSAILSARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVS 246

Query: 245 HHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDR 304
              M   Y EYF  +I+ G++  LL   + ++DL  +   L   RD  F YLGLQ LYDR
Sbjct: 247 QAGMATRYAEYFPTFIQRGIEGGLLDAKLAEYDLARVGAALDARRDLQFGYLGLQTLYDR 306

Query: 305 YFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTR 364
           YFLHI G+RIE+PQ FFMRVAMGLAL+E+++E RA+EFY +LSSF FM STPTLFNSGT 
Sbjct: 307 YFLHIRGTRIELPQVFFMRVAMGLALRESDREARAIEFYEILSSFDFMSSTPTLFNSGTL 366

Query: 365 HPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGV 424
           H QLSSC+LTTV DDL GI+ A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV
Sbjct: 367 HSQLSSCYLTTVSDDLEGIYDAIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGV 426

Query: 425 IPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANW 484
           +PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+LRKNTGD+RRRTHDMNTANW
Sbjct: 427 VPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLELRKNTGDERRRTHDMNTANW 486

Query: 485 IPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVA 544
           IPDLFMKRV +N  WTLFSP +  DLHD YGK FE AY  YE +   GE+K+F+K+ A++
Sbjct: 487 IPDLFMKRVMENGEWTLFSPSDCPDLHDKYGKAFEQAYLGYEAKVASGELKLFKKMPAIS 546

Query: 545 LWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGS 604
           LWRKML+MLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS
Sbjct: 547 LWRKMLSMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGS 606

Query: 605 INLLAHF-----ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLG 659
           +NL+AH         + D+DKL  T+  A+R+LDNVIDIN + ++KAK SN  HR +G+G
Sbjct: 607 VNLVAHMKPAAAGGFELDHDKLKRTVGIAMRMLDNVIDINYYAVKKAKDSNERHRPVGMG 666

Query: 660 LMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQG 719
           +MGFQ  L ++ +PYAS  AVE AD SME + +HA  AS ELAQERG Y S++GSLW +G
Sbjct: 667 IMGFQDCLQMMRVPYASQAAVEFADRSMEAVCYHAYWASSELAQERGRYPSYEGSLWSRG 726

Query: 720 VFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGV 778
           + P D++ +L + R   + ++ +S L W+ L+ R+K  GMRNSNC+AIAPTATI+NI GV
Sbjct: 727 ILPQDTLAMLRDERGGHVEVDESSTLDWNALRARIKEHGMRNSNCIAIAPTATISNIIGV 786

Query: 779 SQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIP 838
           S  I+P++QNLYVKSN+SG+FTVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P
Sbjct: 787 SACIEPTFQNLYVKSNLSGEFTVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVP 846

Query: 839 DDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLK 898
            +L++++ATAFE++P WL+E ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLK
Sbjct: 847 SELRELYATAFEVEPRWLVECASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWQRGLK 906

Query: 899 TTYYLRSRSATSVEKSTLKGVDGKLNAVPVTD---------PNSSTHSLGIPSSCTSDT- 948
           TTYYLR+  ATS EKST +G  G+LNAV             PN     + + + CT    
Sbjct: 907 TTYYLRTLGATSAEKSTGRG--GELNAVSAGQAATAVTAAAPNLPEPEV-LGAVCTMRPG 963

Query: 949 -----ECEVCQ 954
                ECE CQ
Sbjct: 964 DPGFEECEACQ 974


>gi|169634185|ref|YP_001707921.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii SDF]
 gi|169152977|emb|CAP02025.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           baumannii]
          Length = 943

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/949 (56%), Positives = 689/949 (72%), Gaps = 39/949 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R       +++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASAR-----KDTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L ++L    L  +      A ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA T++TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVLDREKLARTVKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S EAV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGSDEAVKFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N  L
Sbjct: 717 DSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPCL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 --------PVTDP------------NSSTHSLGIPSSCTSDT-ECEVCQ 954
                   P   P            +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAPAVAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 943


>gi|221065169|ref|ZP_03541274.1| ribonucleoside-diphosphate reductase, alpha subunit [Comamonas
           testosteroni KF-1]
 gi|220710192|gb|EED65560.1| ribonucleoside-diphosphate reductase, alpha subunit [Comamonas
           testosteroni KF-1]
          Length = 969

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/892 (58%), Positives = 674/892 (75%), Gaps = 10/892 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D +  LT+  V  L++    
Sbjct: 27  QIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDTVNELTDGVVRALVRSRPD 86

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIED+QDQVE  LM++GH  + R YVLYRE R+  RA Q      A  A    ++ 
Sbjct: 87  GGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAEQKKVAEVAAAAATKPVLH 146

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             D+G  +  N +RLE ++  +C  L  D+ S  +++ET +N+YDG+  +++  A I ++
Sbjct: 147 VTDNGQRVPLNQERLEALIVASCGNLNADIQSAPIVAETLRNLYDGVPLAEVYKASILAA 206

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTLIEK+P+Y  VTAR LL  + REV+    +  Q A   EMQ  Y +YF  ++++GV  
Sbjct: 207 RTLIEKDPDYTYVTARLLLHTIVREVMG---RDVQPA---EMQAAYADYFPGFVQKGVDN 260

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQ+FFMRVAM
Sbjct: 261 ELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFLHVRKTRIELPQSFFMRVAM 320

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +
Sbjct: 321 GLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYES 380

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           ++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 381 IKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKG 440

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +
Sbjct: 441 AVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEAGQWTLFSPAD 500

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWRKML+MLFETGHPWITFKDP
Sbjct: 501 APDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWRKMLSMLFETGHPWITFKDP 560

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  + + D+DKL  T+ 
Sbjct: 561 CNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNLVQHIKDGKIDHDKLRKTVN 620

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL+ +   YAS  AVE ADE+
Sbjct: 621 TAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDALYEMRTAYASQGAVEFADEA 680

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ LL + R   + ++R+++L 
Sbjct: 681 MEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLKLLEKARGGYVEVDRSAKLD 740

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N +
Sbjct: 741 WDALRAKIAKDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVINQY 800

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++ATAFE+ P WL+E+ASRRQK
Sbjct: 801 LVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYATAFEVSPEWLVEAASRRQK 860

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           WIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ SAT++EKST++
Sbjct: 861 WIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTTSATNIEKSTVQ 912


>gi|226940722|ref|YP_002795796.1| NrdA [Laribacter hongkongensis HLHK9]
 gi|226715649|gb|ACO74787.1| NrdA [Laribacter hongkongensis HLHK9]
          Length = 917

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/926 (58%), Positives = 680/926 (73%), Gaps = 23/926 (2%)

Query: 32  IKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSAL 91
           I+R G V  F+  KI+ A+ KAF+AV+G+ A +S R++D +  LT+  V  L        
Sbjct: 12  IRRTGDVVPFNADKIALAMRKAFIAVQGESAGQSSRLRDEVARLTQDVVNALTGRRPEGS 71

Query: 92  IVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDD 151
            + IEDIQDQVE +LM+SG H++ R YVLYRE R+  R A+  +     + P L +   D
Sbjct: 72  AIAIEDIQDQVELALMRSGEHEVARAYVLYREARAAERRARHAALGIDQL-PALHVTRPD 130

Query: 152 GTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLI 210
           G+    + +RL   +E AC GL+ D     +L++T KN+YDG++E+++E ALI S+R  I
Sbjct: 131 GSRAPLDIERLGRQLEAACHGLEADTRPAALLADTLKNLYDGVTEAEVERALILSARQWI 190

Query: 211 EKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLH 270
           E++P Y KVTAR LL+ +RREV   V               Y E F + I+ G++A LL 
Sbjct: 191 ERDPAYDKVTARLLLDTIRREVAGGV------------AATYAEVFQQGIQRGMQADLLD 238

Query: 271 ESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLAL 330
             + DFDL  LA  L  ERD  F YLGLQ LYDRYFLH++G RIEMPQ FFMRVAMGLAL
Sbjct: 239 PRLADFDLPRLAAALDGERDRQFGYLGLQTLYDRYFLHVDGRRIEMPQTFFMRVAMGLAL 298

Query: 331 KETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQEN 390
            E +   +A+EFY+LLS F FM STPTLFN+GTRH QLSSC+LTT+ D L GIF A++EN
Sbjct: 299 NEADPTTQAMEFYDLLSRFDFMSSTPTLFNAGTRHSQLSSCYLTTIADSLDGIFDAIKEN 358

Query: 391 AMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCA 450
           A L+K++GGLGNDWTPVR LG+HI GTNG+SQGV+PFLKVANDTAVAVNQGGKRKGAVCA
Sbjct: 359 AQLSKFAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKVANDTAVAVNQGGKRKGAVCA 418

Query: 451 YLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDL 510
           YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +NA WTLFSP +V DL
Sbjct: 419 YLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMQRVMENAEWTLFSPADVPDL 478

Query: 511 HDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIR 570
           HDL G+ F   Y  YE  A    ++  + + AV LWRKMLTMLFETGHPW+T+KD CN+R
Sbjct: 479 HDLTGRAFARRYAEYEAMARADTLRNAKTLRAVDLWRKMLTMLFETGHPWLTWKDACNLR 538

Query: 571 SPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVR 630
           SPQQHVG VHSSNLCTEITLN+S +E AVCNLGS+NL  H      D +KLA T+R A+R
Sbjct: 539 SPQQHVGRVHSSNLCTEITLNTSDDEIAVCNLGSVNLANHLKEGALDQEKLARTVRVAMR 598

Query: 631 VLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFI 690
           +LDNVID+N + +EKA+ +N  HR +GLG+MGFQ  LHLL +PY S  AV  ADESME I
Sbjct: 599 MLDNVIDLNFYPVEKARTANLRHRPVGLGVMGFQDCLHLLRLPYGSQAAVGFADESMELI 658

Query: 691 SFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL-AEVRDELAMNRTSRLPWDEL 749
           ++HA  AS ELA+ RG Y SF+GSLW QG+ P DS+ LL AE +  L ++R+SRL W  +
Sbjct: 659 AYHAYLASTELAEMRGCYPSFEGSLWSQGILPQDSVELLAAERQGYLEVDRSSRLDWTPV 718

Query: 750 KKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNE 809
           ++R+   GMRNSNC+AIAPTATIANI GVS SI+P+Y+NL+VKSN+SG+FTVVN FLV +
Sbjct: 719 RERIARFGMRNSNCLAIAPTATIANIIGVSASIEPTYKNLFVKSNLSGEFTVVNEFLVQD 778

Query: 810 LKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQ 869
           LK+  LWD  M++DLKY DG +  IERIP D+K ++ATAF++DP WL+E+ASRRQKWIDQ
Sbjct: 779 LKRLGLWDAVMLADLKYFDGDLAPIERIPQDIKTLYATAFDVDPGWLVEAASRRQKWIDQ 838

Query: 870 AQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVT 929
           AQSLNLY+   SGKKLD +Y+ AW+ GLKTTYYLR+ +ATS EKST +G  G+LNAVP+ 
Sbjct: 839 AQSLNLYMAGASGKKLDTLYKLAWVRGLKTTYYLRTLAATSAEKSTGRG--GELNAVPI- 895

Query: 930 DPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                   +  P  C+ D  +CE CQ
Sbjct: 896 ----EGGMVAEPKFCSIDNPDCEACQ 917


>gi|264680214|ref|YP_003280124.1| ribonucleoside-diphosphate reductase, alpha [Comamonas testosteroni
           CNB-2]
 gi|262210730|gb|ACY34828.1| ribonucleoside-diphosphate reductase, alpha [Comamonas testosteroni
           CNB-2]
          Length = 969

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/892 (58%), Positives = 675/892 (75%), Gaps = 10/892 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D +  LTE  V  L++    
Sbjct: 27  QIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDTVNELTEGVVRALVRSRPD 86

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIED+QDQVE  LM++GH  + R YVLYRE R+  RA Q  +   A  A    ++ 
Sbjct: 87  GGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAEQKKAAEVAAAAAAKPVLH 146

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             D+G  +  + +RLE ++  +C  L  D+ S  +++ET +N+YDG+  +++  A I ++
Sbjct: 147 VTDNGQRVPLDQERLEALIVASCRNLNADIQSAPIVAETLRNLYDGVPLAEVYKASILAA 206

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTLIEK+P+Y  VTAR LL  + REV+    +  Q A   EMQ  Y +YF  ++++GV  
Sbjct: 207 RTLIEKDPDYTYVTARLLLHTIVREVMG---RDVQPA---EMQAAYADYFPGFVQKGVDN 260

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQ+FFMRVAM
Sbjct: 261 ELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFLHVRKTRIELPQSFFMRVAM 320

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +
Sbjct: 321 GLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYES 380

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           ++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 381 IKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKG 440

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +
Sbjct: 441 AVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEAGQWTLFSPAD 500

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWRKML+MLFETGHPWITFKDP
Sbjct: 501 APDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWRKMLSMLFETGHPWITFKDP 560

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  + + D+DKL  T+ 
Sbjct: 561 CNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNLVQHIKDGKIDHDKLRKTVN 620

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL+ +   YAS  AVE ADE+
Sbjct: 621 TAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDALYEMRTAYASQGAVEFADEA 680

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ LL + R   + ++R+++L 
Sbjct: 681 MEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLKLLEKARGGYVEVDRSAKLD 740

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N +
Sbjct: 741 WDALRAKIAQDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVINQY 800

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++ATAFE+ P WL+E+ASRRQK
Sbjct: 801 LVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYATAFEVSPEWLVEAASRRQK 860

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           WIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ SAT++EKST++
Sbjct: 861 WIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTTSATNIEKSTVQ 912


>gi|299533978|ref|ZP_07047330.1| ribonucleotide-diphosphate reductase subunit alpha [Comamonas
           testosteroni S44]
 gi|298717887|gb|EFI58892.1| ribonucleotide-diphosphate reductase subunit alpha [Comamonas
           testosteroni S44]
          Length = 969

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/892 (58%), Positives = 675/892 (75%), Gaps = 10/892 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+R+G V +F P KI+ A+ KAF+AV G   + S  V+D +  LTE  V  L++    
Sbjct: 27  QIIRRSGDVVAFAPQKIAVALTKAFLAVRGAQGAASASVRDTVNELTEGVVRALVRSRPD 86

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM- 148
               HIED+QDQVE  LM++GH  + R YVLYRE R+  RA Q  +   A  A    ++ 
Sbjct: 87  GGTFHIEDVQDQVELGLMRAGHQDVARAYVLYRERRNQERAEQKKAAEVAAAAAAKPVLH 146

Query: 149 -MDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             D+G  +  + +RLE ++  +C  L  D+ S  +++ET +N+YDG+  +++  A I ++
Sbjct: 147 VTDNGQRVPLDQERLEALIVASCRNLNADIQSAPIVAETLRNLYDGVPLAEVYKASILAA 206

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           RTLIEK+P+Y  VTAR LL  + REV+    +  Q A   EMQ  Y +YF  ++++GV  
Sbjct: 207 RTLIEKDPDYTYVTARLLLHTIVREVMG---RDVQPA---EMQTAYADYFPGFVQKGVDN 260

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL+  ++++DL  LA  LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQ+FFMRVAM
Sbjct: 261 ELLNPELLNYDLPRLAKALKAERDEQFDYLGLQTLYDRYFLHVRKTRIELPQSFFMRVAM 320

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +
Sbjct: 321 GLALNEPDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYES 380

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           ++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 381 IKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKG 440

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVC YLE+WH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLFSP +
Sbjct: 441 AVCTYLESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGQWTLFSPAD 500

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDLYG+ FE AY  YE + D GE+K+F+++ AV LWRKML+MLFETGHPWITFKDP
Sbjct: 501 APDLHDLYGEAFEKAYTAYEAKTDSGELKLFKRVPAVDLWRKMLSMLFETGHPWITFKDP 560

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  + + D+DKL  T+ 
Sbjct: 561 CNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNLVQHIKDGKIDHDKLRKTVN 620

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TA+R+LDNVIDIN + ++KAK SN  HR +G+GLMGFQ AL+ +   YAS  AVE ADE+
Sbjct: 621 TAMRMLDNVIDINYYAVQKAKDSNLRHRPVGMGLMGFQDALYEMRTAYASQGAVEFADEA 680

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLP 745
           ME I ++A  AS EL++ERG YS+FKGSLWDQG+ P D++ LL + R   + ++R+++L 
Sbjct: 681 MEAICYYAYWASTELSKERGTYSTFKGSLWDQGILPPDTLKLLEKARGGYVEVDRSAKLD 740

Query: 746 WDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSF 805
           WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N +
Sbjct: 741 WDALRAKIAQDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVINQY 800

Query: 806 LVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQK 865
           LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P ++K ++ATAFE+ P WL+E+ASRRQK
Sbjct: 801 LVRDLKRLGLWDDVMVMDLKHFDGSLRAIDRVPQEIKNLYATAFEVSPEWLVEAASRRQK 860

Query: 866 WIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           WIDQAQSLN+Y+   SGKKL   Y  AWL GLKTTYYLR+ SAT++EKST++
Sbjct: 861 WIDQAQSLNIYMAGASGKKLHDTYMLAWLRGLKTTYYLRTTSATNIEKSTVQ 912


>gi|169797063|ref|YP_001714856.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AYE]
 gi|184157024|ref|YP_001845363.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii ACICU]
 gi|213156531|ref|YP_002318192.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           baumannii AB0057]
 gi|215484524|ref|YP_002326759.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AB307-0294]
 gi|239501300|ref|ZP_04660610.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB900]
 gi|260555645|ref|ZP_05827865.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|301345631|ref|ZP_07226372.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB056]
 gi|301512782|ref|ZP_07238019.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB058]
 gi|301596293|ref|ZP_07241301.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii AB059]
 gi|332852153|ref|ZP_08433980.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013150]
 gi|332867552|ref|ZP_08437705.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013113]
 gi|332872598|ref|ZP_08440566.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6014059]
 gi|169149990|emb|CAM87884.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AYE]
 gi|183208618|gb|ACC56016.1| Ribonucleotide reductase, alpha subunit [Acinetobacter baumannii
           ACICU]
 gi|193076531|gb|ABO11187.2| ribonucleoside diphosphate reductase alpha subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055691|gb|ACJ40593.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           baumannii AB0057]
 gi|213986949|gb|ACJ57248.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii AB307-0294]
 gi|260410556|gb|EEX03854.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|322506923|gb|ADX02377.1| nrdA [Acinetobacter baumannii 1656-2]
 gi|323516790|gb|ADX91171.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332729525|gb|EGJ60864.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013150]
 gi|332733969|gb|EGJ65114.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6013113]
 gi|332739127|gb|EGJ69986.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           baumannii 6014059]
          Length = 944

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/950 (56%), Positives = 688/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R       +++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASAR-----KDTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L ++L    L  +      A ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA T++TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVLDREKLARTVKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S EAV  ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGSDEAVNFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 P---------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                                   + +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 944


>gi|120609558|ref|YP_969236.1| ribonucleotide-diphosphate reductase subunit alpha [Acidovorax
           citrulli AAC00-1]
 gi|120588022|gb|ABM31462.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           citrulli AAC00-1]
          Length = 983

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/903 (58%), Positives = 668/903 (73%), Gaps = 15/903 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++ +  LT+  V  L++    
Sbjct: 36  QIIRRNGAVVPFEPQKIAVAMMKAFLAVHGTQGAASASVRETVDTLTQSVVRALMRSRPG 95

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QD VE SLM+ GHH++ R YVLYRE R+  RA Q H +   P  P L ++ 
Sbjct: 96  GGTFHIEDVQDNVELSLMRGGHHEVARAYVLYRERRTQERAHQQHDRQPVPSTPVLHVI- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G  +  +  RL  +++ AC+ L  DV +  +++ET +N+YDG+   ++  A I ++RT
Sbjct: 155 DNGQRVPLDEARLRGLIDSACANLGADVHAAPIVAETLRNLYDGVPMDEVYKASILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR LL  + REVL       Q     +M   Y  YF ++I++GV   L
Sbjct: 215 LIEKDPDYTYATARLLLHTIVREVLG------QDVVPADMGPAYAAYFPQFIQKGVDNEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ +DLV L   L   RD  F+YLGLQ LYDRYFLH+  +RIE+PQ FFMRVAMGL
Sbjct: 269 LDPRLLQYDLVRLGAALDAGRDQQFDYLGLQTLYDRYFLHVRKTRIELPQCFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 329 ALNEPDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V 
Sbjct: 449 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSSVP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G +FE AY  YE +A RGEIK  R + A  LWRK+LTMLFETGHPWITFKD CN
Sbjct: 509 DLHDLFGADFEKAYVAYEEKAARGEIKPSRTVQATDLWRKILTMLFETGHPWITFKDACN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN----QFDYDKLAST 624
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  +     + D+ KL  T
Sbjct: 569 VRSPQQHAGVVHSSNLCTEITLNTSDAETAVCNLGSVNLVRHLKDGPNGKELDHAKLRKT 628

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           I TA+R+LDNVIDIN + +EKA+ SN  HR +GLGLM FQ +L+ L IPYAS  AVE AD
Sbjct: 629 ISTAMRMLDNVIDINYYAVEKARNSNMRHRPVGLGLMAFQDSLYELRIPYASQAAVEFAD 688

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSR 743
            SME I ++A  AS ELAQERG YSS+ GSLWD+G+ PID++ LL + R   + ++R + 
Sbjct: 689 RSMEAICYYAYWASTELAQERGKYSSYPGSLWDRGILPIDTLDLLEKARGGYVEVDRAAT 748

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD L++++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N
Sbjct: 749 LDWDALRQKIARDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVIN 808

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK+  LWD+ M+ DLK+  GS+  I+R+P D+K +++TAFE+ P WL+E+ASRR
Sbjct: 809 GYLVRDLKRLGLWDDVMVMDLKHFKGSLHPIDRVPQDVKALYSTAFEVAPTWLVEAASRR 868

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT VE ST+     +L
Sbjct: 869 QKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGLKTTYYLRTQSATHVEMSTVN--TRQL 926

Query: 924 NAV 926
           NAV
Sbjct: 927 NAV 929


>gi|326315614|ref|YP_004233286.1| ribonucleoside-diphosphate reductase subunit alpha [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372450|gb|ADX44719.1| ribonucleoside-diphosphate reductase, alpha subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 983

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/903 (58%), Positives = 668/903 (73%), Gaps = 15/903 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++ +  LT+  V  L++    
Sbjct: 36  QIIRRNGAVVPFEPQKIAVAMMKAFLAVHGTQGAASASVRETVDTLTQSVVRALMRSRPG 95

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QD VE SLM+ GHH++ R YVLYRE R+  RA Q H +   P  P L ++ 
Sbjct: 96  GGTFHIEDVQDNVELSLMRGGHHEVARAYVLYRERRTQERAHQQHDRQPVPSTPVLHVI- 154

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G  +  +  RL  +++ AC+ L QDV +  +++ET +N+YDG+   ++  A I ++RT
Sbjct: 155 DNGQRVPLDEARLRGLIDSACANLGQDVHAAPIVAETLRNLYDGVPMDEVYKASILAART 214

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR LL  + REVL       Q     +M   Y  YF ++I++GV   L
Sbjct: 215 LIEKDPDYTYATARLLLHTIVREVLG------QDVVPADMGPAYAAYFPQFIQKGVDNEL 268

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ +DL  L   L   RD  F+YLGLQ LYDRYFLH+  +RIE+PQ FFMRVAMGL
Sbjct: 269 LDPRLLQYDLARLGAALDAGRDQQFDYLGLQTLYDRYFLHVRKTRIELPQCFFMRVAMGL 328

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 329 ALNEPDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 388

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 389 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 448

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V 
Sbjct: 449 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSSVP 508

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G +FE AY  YE +A RGEIK  R + A  LWRK+LTMLFETGHPWITFKD CN
Sbjct: 509 DLHDLFGADFEKAYVAYEEKAARGEIKPSRTLQATDLWRKILTMLFETGHPWITFKDACN 568

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANN----QFDYDKLAST 624
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NL+ H  +     + D+ KL  T
Sbjct: 569 VRSPQQHAGVVHSSNLCTEITLNTSDAETAVCNLGSVNLVRHLKDGPNGKELDHAKLRKT 628

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           I TA+R+LDNVIDIN + +EKA+ SN  HR +GLGLM FQ +L+ L IPYAS  AVE AD
Sbjct: 629 ISTAMRMLDNVIDINYYAVEKARNSNMRHRPVGLGLMAFQDSLYELRIPYASQAAVEFAD 688

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSR 743
            SME I ++A  AS ELAQERG YSS+ GSLWD+G+ PID++ LL + R   + ++R + 
Sbjct: 689 RSMEAICYYAYWASTELAQERGKYSSYPGSLWDRGILPIDTLDLLEKARGGYVEVDRATS 748

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD L++++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N
Sbjct: 749 LDWDALRQKIARDGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVIN 808

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK+  LWD+ M+ DLK+  GS+  I+R+P D+K +++TAFE+ P WL+E+ASRR
Sbjct: 809 GYLVRDLKRLGLWDDVMVMDLKHFKGSLHPIDRVPQDVKALYSTAFEVAPTWLVEAASRR 868

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT VE ST+     +L
Sbjct: 869 QKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGLKTTYYLRTQSATHVEMSTVN--TRQL 926

Query: 924 NAV 926
           NAV
Sbjct: 927 NAV 929


>gi|260551038|ref|ZP_05825243.1| ribonucleotide reductase [Acinetobacter sp. RUH2624]
 gi|260405986|gb|EEW99473.1| ribonucleotide reductase [Acinetobacter sp. RUH2624]
          Length = 944

 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/950 (56%), Positives = 687/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLTEMVLNTFKRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASAR-----QQTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DANGQLQPLDLSALKATVNRAAEGLEGIEVEAIIDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L ++L    L  +      A ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA T++TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVRGGVLDREKLARTVKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S EAV  ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGSDEAVNFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W++++ASRRQKW
Sbjct: 777 VRALKDRGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 P---------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                                   + +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 944


>gi|89902116|ref|YP_524587.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodoferax
           ferrireducens T118]
 gi|89346853|gb|ABD71056.1| Ribonucleoside-diphosphate reductase [Rhodoferax ferrireducens
           T118]
          Length = 981

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/908 (58%), Positives = 674/908 (74%), Gaps = 22/908 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P+KI+ A+MKAF+AV G   + S  V++ +  LT+  +  L++   +
Sbjct: 36  QIIRRNGAVVPFEPNKIAVAMMKAFLAVHGTQGAASASVRESVDGLTQGVIHALMRSRPA 95

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+ GHH++ R YVLYRE+R+  RA Q  +   A  AP L ++ 
Sbjct: 96  GGTFHIEDVQDQVELGLMRGGHHEVARAYVLYREKRTQERAQQLIAT--AATAPLLHVV- 152

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G  I  +  RL+ I+E AC+GL  D+  + +L+ET +N+YDG+   ++  A I ++RT
Sbjct: 153 DKGGRIVLDLARLKGIIESACAGLGADIKPEPILAETMRNLYDGVPMEEVYKASILAART 212

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR L   +  EVL       +     +M   Y +YF ++I++G+   L
Sbjct: 213 LIEKDPDYTYATARLLFHTIANEVLG------RDVVQADMAQAYVDYFPQFIKKGIDHEL 266

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E +  FDL  L   LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQAFFMRVAMGL
Sbjct: 267 LDERLQQFDLQRLGAALKAERDLKFDYLGLQTLYDRYFLHVGKARIELPQAFFMRVAMGL 326

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 327 SLGEIDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 386

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LGAHI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 387 ENALLSKFAGGLGNDWTRVRALGAHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 446

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV +   WTLFSP+ V 
Sbjct: 447 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMRRVMEKGQWTLFSPNNVP 506

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHD +G +FE AY  YE +A RGEI+  R + A  LWRKMLTMLFETGHPWITFKD CN
Sbjct: 507 DLHDKFGADFEKAYVAYEEKAARGEIRPARTVQAADLWRKMLTMLFETGHPWITFKDACN 566

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN---------NQFDYD 619
           IRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NLL H  N            D+ 
Sbjct: 567 IRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNLLQHLKNAPAGSADGAKVLDHA 626

Query: 620 KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
           KL  TI TA+R+LDNVIDIN + ++KA+ +N  HR +GLG+M FQ +L+ L IPYAS  A
Sbjct: 627 KLQKTITTAMRMLDNVIDINFYAVKKARDANMRHRPVGLGVMAFQDSLYELRIPYASDAA 686

Query: 680 VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAM 738
           V  AD SME I ++A  AS ELA+ERG Y+S+KGSLWDQG+ PID++ +LA  R   + +
Sbjct: 687 VAFADTSMEAICYYAYWASTELARERGQYTSYKGSLWDQGILPIDTLDMLARERGGYVEV 746

Query: 739 NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
           +R+S L W+ L+K++   GMRNSNC AIAPTATI+NI GV  SI+P + NL VKSN+SG+
Sbjct: 747 DRSSTLDWEALRKKIAKDGMRNSNCTAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGE 806

Query: 799 FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
           FT++NS+LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D+K ++ATAFEI+  WL+E
Sbjct: 807 FTIINSYLVQDLKRLGLWDDVMVMDLKHFDGSLNPIDRVPADVKALYATAFEIETRWLVE 866

Query: 859 SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKG 918
           +A+RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR+ SAT  EKST+  
Sbjct: 867 AAARRQKWIDQAQSLNIYMGGASGKKLDDTYKLAWIRGLKTTYYLRTMSATHAEKSTVTA 926

Query: 919 VDGKLNAV 926
             G++NAV
Sbjct: 927 --GRMNAV 932


>gi|319764327|ref|YP_004128264.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans BC]
 gi|330826375|ref|YP_004389678.1| ribonucleoside-diphosphate reductase subunit alpha [Alicycliphilus
           denitrificans K601]
 gi|317118888|gb|ADV01377.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans BC]
 gi|329311747|gb|AEB86162.1| ribonucleoside-diphosphate reductase, alpha subunit [Alicycliphilus
           denitrificans K601]
          Length = 970

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/947 (57%), Positives = 680/947 (71%), Gaps = 33/947 (3%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+P KI+ A+MKAF+AV G   + S  V++++  LT+  V  L++   S
Sbjct: 35  QIIRRNGAVVPFEPQKIAVAMMKAFLAVHGTQGAASASVREVVDELTQAVVRALMRSRPS 94

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+  HH++ R YVLYRE R+  RA +       P  P L ++ 
Sbjct: 95  GGTFHIEDVQDQVELGLMRGSHHEVARAYVLYRERRAQERAQKKEQL--LPQMPALYVL- 151

Query: 150 DDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D G  I  +  RL+ ++E AC+ L  DV +  + +ET +N+YDG+   ++  A I ++RT
Sbjct: 152 DKGQRIELDILRLQALIESACANLGSDVQAAPIAAETLRNLYDGVPMDEVYKASILAART 211

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P Y   TAR LL  + REVL       Q      M   Y   F ++I +GV   L
Sbjct: 212 LIEKDPGYTYATARLLLHTIVREVLG------QDVAPAGMAAAYAANFPQFIRKGVDNEL 265

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++DFDL  L   LK  RD  F+YLGLQ LYDRYFLH+  +RIE+PQAFFMRVAMGL
Sbjct: 266 LDPRLLDFDLQRLGQALKAGRDLQFDYLGLQTLYDRYFLHVKKTRIELPQAFFMRVAMGL 325

Query: 329 ALKE----TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AL+E    T    RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTVPD+L GI+
Sbjct: 326 ALREGDPKTTGSARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDELGGIY 385

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            +++ENA+L+K++GGLGNDWT VR LGA I GTNG+SQGV+PFLKV NDTAVAVNQGGKR
Sbjct: 386 ESIKENALLSKFAGGLGNDWTRVRALGARIKGTNGESQGVVPFLKVVNDTAVAVNQGGKR 445

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLE+WH+DVEEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV     WTLFSP
Sbjct: 446 KGAVCAYLESWHLDVEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMDKGQWTLFSP 505

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
            +V DLHDLYG+ FE AY  YE + D GE+++F+++ AV LWRKML+MLFETGHPWITFK
Sbjct: 506 SDVPDLHDLYGQAFERAYTAYEAKVDSGELQLFKRVPAVDLWRKMLSMLFETGHPWITFK 565

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DPCNIRSPQQHVGVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  +   D+DKL  T
Sbjct: 566 DPCNIRSPQQHVGVVHSSNLCTEITLNTSDTETAVCNLGSVNLARHLKDGAIDHDKLRKT 625

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TA+R+LDNVIDIN + ++KA+ SN  HR +GLGLMGFQ AL+ L IPY+S  AV  AD
Sbjct: 626 VSTAMRMLDNVIDINYYAVDKARDSNLRHRPVGLGLMGFQDALYELRIPYSSDAAVTFAD 685

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSR 743
           ESME I ++A  AS ELA+ERG YSS++GSLW +G+ P+DS+ LLA+ R   + ++RT+R
Sbjct: 686 ESMEAICYYAYWASTELARERGTYSSYEGSLWSKGILPLDSLELLAKERGGYVEVDRTTR 745

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV+N
Sbjct: 746 LDWDALRSKITQDGMRNSNCIAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTVIN 805

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV +LK+  LWD+ M+ DLK+  GS+  I+R+P ++K ++ATAFE+ P WL+E+A+RR
Sbjct: 806 QYLVRDLKKLGLWDDVMLMDLKHFKGSLHAIDRVPQNVKALYATAFEVAPAWLVEAAARR 865

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLN+Y+   SGKKLD  Y+ AW+ GLKTTYYLR++SAT VE ST+     +L
Sbjct: 866 QKWIDQAQSLNIYMAGASGKKLDETYKLAWVRGLKTTYYLRTQSATHVEMSTVN--TRQL 923

Query: 924 NAVPV-TDPNSSTH---------------SLGIPSSCTSDTECEVCQ 954
           NAV   TD  S                  +  +      D  CE CQ
Sbjct: 924 NAVSAGTDSQSGALNAAAAAAQTQAGALPATDVKFCAIDDPSCEACQ 970


>gi|160896948|ref|YP_001562530.1| ribonucleotide-diphosphate reductase subunit alpha [Delftia
           acidovorans SPH-1]
 gi|160362532|gb|ABX34145.1| ribonucleoside-diphosphate reductase, alpha subunit [Delftia
           acidovorans SPH-1]
          Length = 973

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/896 (58%), Positives = 674/896 (75%), Gaps = 12/896 (1%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHN 87
           G Q+I+R+G V  F P KI+ A+ KAF+AV G   + S  V++ +  LT+  V  LL+  
Sbjct: 30  GYQIIRRSGDVVPFTPQKIAVALTKAFLAVRGAQGAASASVRETVDELTQAVVRALLRSR 89

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
                 HIED+QDQVE  LM+ GHH + R YVLYR+ R+  RA Q  +   A  A     
Sbjct: 90  PGGGTFHIEDVQDQVELGLMRGGHHDVARAYVLYRDRRNQERAEQKKAAEAAAAAAAAPA 149

Query: 148 MM----DDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETAL 202
            +    D+G  +  +  RL  ++E +C  L  D+ +  +++ET +N+YDG+   ++  A 
Sbjct: 150 PVLHVTDNGQRVPLDQARLLALIEASCRNLNADIQAAPIVAETLRNLYDGVPIEEVFKAS 209

Query: 203 IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
           I ++RTLIEK+P+Y  VTAR LL  + REV+    +  Q A   ++Q  Y EYF  +I +
Sbjct: 210 ILAARTLIEKDPDYTYVTARLLLHTIVREVMG---RDVQPA---DIQAAYAEYFPGFIRK 263

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           GV   LL+  ++++DL  LA  +K ERD  F+YLGLQ LYDRYFLH+  +RIE+PQ+FFM
Sbjct: 264 GVDNELLNPELLNYDLPRLAAAIKAERDEQFDYLGLQTLYDRYFLHVRKTRIELPQSFFM 323

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLAL+E ++  RA+EFY LLSSF FM STPTLFNSGT   QLSSC+LTTVPDDL G
Sbjct: 324 RVAMGLALQEEDRNARAIEFYELLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDG 383

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           I+ +++ENA+L+K++GGLGNDWT VR LG+ I GTNG+SQGV+PFLKV NDTAVAVNQGG
Sbjct: 384 IYESIKENALLSKFAGGLGNDWTRVRALGSRIKGTNGESQGVVPFLKVVNDTAVAVNQGG 443

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVC YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKRV +   WTLF
Sbjct: 444 KRKGAVCTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEKGHWTLF 503

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SP +V DLHDL+G  FE AY  YE +AD GE+K+F++I A+ LWRKML+MLFETGHPW+T
Sbjct: 504 SPSDVGDLHDLFGAAFEHAYTAYETKADNGELKLFKRIPAMDLWRKMLSMLFETGHPWVT 563

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
           FKDPCN+RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  +   D+ KL 
Sbjct: 564 FKDPCNVRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLARHIVDGAIDHGKLR 623

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            TI TA+R+LDNVIDIN + ++KAK SN  HR +GLGLMGFQ AL+ + I YAS  AVE 
Sbjct: 624 KTITTAMRMLDNVIDINYYAVQKAKDSNLRHRPVGLGLMGFQDALYEMRIAYASDAAVEF 683

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRT 741
           AD+SME I ++A  AS ELA+ERG YSS+KGSLWDQG+ P+D++ LL + R   + ++R+
Sbjct: 684 ADQSMEAICYYAYWASTELAKERGQYSSYKGSLWDQGILPLDTLNLLEKARGGYVEVDRS 743

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           SRL WD L+ ++   GMRNSNC+AIAPTATI+NI GV  SI+PS+ NL VKSN+SG+FTV
Sbjct: 744 SRLDWDALRAKIGQHGMRNSNCVAIAPTATISNIVGVDASIEPSFGNLSVKSNLSGEFTV 803

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           +N +LV +LK+  LWD+ M+ DLK+ DGS+  I+R+P D+K ++ATAFE++P WL+E+A+
Sbjct: 804 INQYLVRDLKRLGLWDDVMVMDLKHFDGSLRPIDRVPQDVKSLYATAFEVEPTWLVEAAA 863

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           RRQKWIDQAQSLN+Y+   SGKKLD  Y+ AWL GLKTTYYLR+ SAT++EKST++
Sbjct: 864 RRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWLRGLKTTYYLRTTSATNIEKSTVQ 919


>gi|262373380|ref|ZP_06066659.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           junii SH205]
 gi|262313405|gb|EEY94490.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           junii SH205]
          Length = 944

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/950 (56%), Positives = 687/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +   
Sbjct: 11  LQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRISQLTEMVMNTFKRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++ A   P L+I 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATAR-----QQTGANHHPTLQIT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L   +E A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DHNGQLQPLDLDALTATIETASEGLEGIDVQAIVDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L   V T +          E   L P     ++++G++  L
Sbjct: 186 RIEQEPNYTYVTARLLCNEL---VGTGLEFLGLSTDTSENDALEP-----FLKKGIELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +++FDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLNFDLAKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E  
Sbjct: 418 CAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYTHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN+S +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTSQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ L+A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLALERGAYSTFKGSLWDQGILPIDSLELVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVETRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 -------PV--------------TDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                  PV               + +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPASVEAPVVAAQAVEEKKPEAQVEEDGFTTAAPVPMACSIDNPDCEACQ 944


>gi|317402621|gb|EFV83181.1| ribonucleoside-diphosphate reductase subunit alpha [Achromobacter
           xylosoxidans C54]
          Length = 976

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/907 (57%), Positives = 671/907 (73%), Gaps = 19/907 (2%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKSA 90
           +I+RNG V  F+P KI+ A+ KAF+AV G   + S RV+++++ LT Q V  L+++    
Sbjct: 35  IIRRNGSVVGFEPGKIAIAMTKAFLAVNGGQGAASARVRELVEQLTTQAVNALVRNRPGG 94

Query: 91  LIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAA----QSHSKSDAPIAPKLK 146
              HIEDIQDQVE +LM+SG H + R YVLYRE+R+  RAA    +   K DA     + 
Sbjct: 95  GTFHIEDIQDQVELALMRSGQHDVARAYVLYREKRTQERAAAAAAEGQQKVDAVPQENVL 154

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQD-VSSKIVLSETYKNMYDGLSESDLETALIFS 205
            + D G     +   L   +  A  GL + + S+ +L ET KN+YDG+   ++  + I S
Sbjct: 155 HVTDAGVRRPLDIAELRATIVAAGEGLAEFIDSEAILKETVKNLYDGIPVDEVFKSAILS 214

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +R L+EK+P Y++VTAR LL  +R+EVL       ++ +   M   Y EYF  +I  G++
Sbjct: 215 ARALVEKDPAYSQVTARLLLHTIRKEVLG------EEVSQDGMAARYAEYFPTFIARGIE 268

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
             LL   +  +DL  L   L  +RD  F YLGLQ LYDRYFLHI G+RIE+PQ FFMRVA
Sbjct: 269 GGLLSPDLASYDLTKLGKALNAKRDLQFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVA 328

Query: 326 MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
           MGLAL+ET++E RA+EFY +LSSF FM STPTLFNSGT H QLSSC+LTTV DDL GI+ 
Sbjct: 329 MGLALRETDREARAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYD 388

Query: 386 ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
           A++ENA+LAKY+GGLGNDWTPVR L +HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRK
Sbjct: 389 AIKENALLAKYAGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRK 448

Query: 446 GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
           GAVC YLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV +   WTLFSP 
Sbjct: 449 GAVCTYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPS 508

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
           +  DLHD YGK FE AY  YE +   G++K+F+K+ A+ LWRKML+MLFETGHPWITFKD
Sbjct: 509 DCPDLHDKYGKAFEEAYVGYEARVASGDLKLFKKMPALTLWRKMLSMLFETGHPWITFKD 568

Query: 566 PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-----ANNQFDYDK 620
           PCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH         + D++K
Sbjct: 569 PCNIRSPQQHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMKPAAGGGFELDHEK 628

Query: 621 LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
           +  T+  A+R+LDNVIDIN + ++KA+ SN  HR +G+G+MGFQ  L ++ +PYAS  AV
Sbjct: 629 IKRTVSIAMRMLDNVIDINYYAVDKARNSNARHRPVGMGIMGFQDCLQMMRVPYASQAAV 688

Query: 681 EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMN 739
           E AD SME + +HA  AS  LA+ERG Y S++GSLW +G+ P D++ +L + R   + ++
Sbjct: 689 EFADRSMEAVCYHAYWASSLLAEERGRYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVD 748

Query: 740 RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
            +S L WD L+ R+K  GMRNSNC+AIAPTATI+NI GVS  I+P++QNLYVKSN+SG+F
Sbjct: 749 ESSTLDWDALRARIKQHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEF 808

Query: 800 TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
           TVVN +LV +LK+  LWDE M++DLKY DGS+  I+R+P +L++++ATAFE++P WL+E 
Sbjct: 809 TVVNDYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRELYATAFEVEPSWLVEC 868

Query: 860 ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
           ASRRQKWIDQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+  ATS EKST +G 
Sbjct: 869 ASRRQKWIDQAQSLNIYMAGASGKKLDDTYKLAWKRGLKTTYYLRTLGATSAEKSTGRG- 927

Query: 920 DGKLNAV 926
            G+LNAV
Sbjct: 928 -GELNAV 933


>gi|332530700|ref|ZP_08406631.1| ribonucleotide-diphosphate reductase subunit alpha [Hylemonella
           gracilis ATCC 19624]
 gi|332039868|gb|EGI76263.1| ribonucleotide-diphosphate reductase subunit alpha [Hylemonella
           gracilis ATCC 19624]
          Length = 988

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/899 (57%), Positives = 673/899 (74%), Gaps = 13/899 (1%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           Q+I+RNG V  F+PSKI+ A+MKAF+AV G   + S  V++ +  LT+  V  L +    
Sbjct: 41  QIIRRNGAVVPFEPSKIAVALMKAFLAVHGAQGAASASVRETVDGLTQAVVRALTRSRPG 100

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
               HIED+QDQVE  LM+ GHH++ R YVLYR +R++ RA  +   +     P L +  
Sbjct: 101 GGTFHIEDVQDQVELGLMRGGHHEVARAYVLYRAKRAEERAQHAAQAAPQ--TPVLHVT- 157

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           D+G  ++ +  RL+ ++E AC+ L  DV +  +++ET +N+YDG+   ++  A I ++RT
Sbjct: 158 DNGQRVALDLNRLQRLIESACANLSADVKADPIVAETLRNLYDGVPLEEVYKAAILAART 217

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           LIEK+P+Y   TAR L   + +EVL       +     EM+  Y +YF  +I++GV A L
Sbjct: 218 LIEKDPDYTYATARLLFHTIAKEVLG------RDVQPSEMKQAYADYFPGFIKKGVDAEL 271

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  ++ +DL  L   LK ERD  F+YLGLQ LYDRYFLH+  +RIE+PQAFFMRVAMGL
Sbjct: 272 LNPELLQYDLKRLGAALKSERDQQFDYLGLQTLYDRYFLHVKKTRIELPQAFFMRVAMGL 331

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E ++E RA+EFY +LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++
Sbjct: 332 ALNEIDREARAIEFYEVLSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIK 391

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           ENA+L+K++GGLGNDWT VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 392 ENALLSKFAGGLGNDWTRVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAV 451

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           C YLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP +  
Sbjct: 452 CTYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGEWTLFSPSDAP 511

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL+G  FE AY  YE +A RGE+K  + + A+ LWRKML+MLFETGHPWITFKD CN
Sbjct: 512 DLHDLFGSAFEKAYVAYEAKAKRGELKPSKTVPAIDLWRKMLSMLFETGHPWITFKDACN 571

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S  ETAVCNLGS+NL  H  + + D++KL  TI TA
Sbjct: 572 VRSPQQHAGVVHSSNLCTEITLNTSDTETAVCNLGSVNLKQHITDGKLDHEKLKKTISTA 631

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           +R+LDNVIDIN + ++KA+ SN  HR +GLG+M FQ AL+ + IPYAS  AV+ ADESME
Sbjct: 632 MRMLDNVIDINYYAVKKARDSNLRHRPVGLGVMAFQDALYEMRIPYASDAAVQFADESME 691

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWD 747
            I ++A  AS ELA+ERG YSS++GSLW +G+ P D++ LLA  R   + ++R++ L W+
Sbjct: 692 AICYYAYWASTELARERGVYSSYQGSLWSKGILPPDTLELLARERGGYVEVDRSATLDWE 751

Query: 748 ELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLV 807
            L+K++   GMRNSNC+AIAPTATI+NI GV  SI+P + NL VKSN+SG+FT++N +LV
Sbjct: 752 LLRKKIAADGMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTIINGYLV 811

Query: 808 NELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWI 867
            +LK+  LWDE M+ DLK+ DGS+  I+R+P D+K ++ATAFE++P WL+E+A+RRQKWI
Sbjct: 812 KDLKRLGLWDEVMVMDLKHFDGSLLPIDRVPQDIKALYATAFEVEPSWLVEAAARRQKWI 871

Query: 868 DQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           DQAQSLN+Y+   SGKKLD  Y+ AW  GLKTTYYLR+ SAT  EKST+    G+LNAV
Sbjct: 872 DQAQSLNIYMAGASGKKLDDTYKLAWTRGLKTTYYLRTTSATQAEKSTVAA--GRLNAV 928


>gi|226953557|ref|ZP_03824021.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ATCC 27244]
 gi|226835694|gb|EEH68077.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           sp. ATCC 27244]
          Length = 944

 Score = 1095 bits (2831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/950 (56%), Positives = 685/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +   
Sbjct: 11  LQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRITQLTEMVMNTFNRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++ A   P L+I 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATAR-----QQTGANHHPTLQIT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L   +   L   +E A +GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DAKGQLQPLDLDALTATIETASAGLEGIDVQAIVDETVKNLYNGVKESDVATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    L  +              L  +    ++++G++  L
Sbjct: 186 RIEQEPNYTYVTARLLCNELVSTGLEFL--------GLPTDTLEGDALETFLKKGIELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E  
Sbjct: 418 CAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLALERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 -------PV--------------TDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                  PV               + +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPASVEAPVVAAQAVEDKKPEAQVEEDGFTTAAPVPMACSIDNPDCEACQ 944


>gi|294649453|ref|ZP_06726878.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824658|gb|EFF83436.1| ribonucleoside-diphosphate reductase alpha subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 944

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/950 (56%), Positives = 684/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G + +F+  KIS AI KAF+AVEG+  + S R+ D I  LTE  +    +   
Sbjct: 11  LQVIKRTGEIATFNAEKISVAIGKAFLAVEGQQGADSSRIHDRITQLTEMVMNTFNRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++ A   P L+I 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRATAR-----QQTGANHHPTLQIT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L   +   L   +E A +GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DAKGQLQPLDLDALTATIETASAGLEGIDVQAIVDETVKNLYNGVKESDVATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    L  +              L  +    ++++G++  L
Sbjct: 186 RIEQEPNYTYVTARLLCNELVSTGLEFL--------GLPTDTLEGDALETFLKKGIELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEENKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+DVEEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P E  
Sbjct: 418 CAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y +YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAHYEAVAKEQNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+F+GSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLALERGAYSTFEGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 -------PVT--------DPNSSTHSLG------IPSSCTSDT-ECEVCQ 954
                  PV          P +     G      +P +C+ D  +CE CQ
Sbjct: 895 KPASVEAPVVAAQAVEDKKPEAQVEEEGFTTAAPVPMACSIDNPDCEACQ 944


>gi|284032752|ref|YP_003382683.1| ribonucleoside-diphosphate reductase subunit alpha [Kribbella
           flavida DSM 17836]
 gi|283812045|gb|ADB33884.1| ribonucleoside-diphosphate reductase, alpha subunit [Kribbella
           flavida DSM 17836]
          Length = 806

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/800 (62%), Positives = 633/800 (79%), Gaps = 9/800 (1%)

Query: 156 SFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPN 215
           + N +RL ++V EA +GL  V  +++L+ET  + YDG+ + ++E AL+ ++RT +E+EP 
Sbjct: 15  ALNVERLRLMVAEASAGLDAVDPELILTETLGSCYDGIPQHEVELALVMAARTYVEQEPQ 74

Query: 216 YAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD 275
           Y++  AR LL+++RREVL  V+ +P++A+  +M+  Y  YF RY+  G++A LL   +  
Sbjct: 75  YSQAAARLLLDQIRREVLGRVHGEPRQASQADMRTAYAGYFPRYLAVGIEAGLLDHELAS 134

Query: 276 FDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEK 335
           FDL  LA  ++ ERD  F +LGLQ LYDRY LHI+ +R E+PQAFF+RVAMG+ALKE ++
Sbjct: 135 FDLDRLAAAIRPERDLDFTFLGLQTLYDRYLLHIDKTRFELPQAFFLRVAMGMALKEHDR 194

Query: 336 EKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAK 395
           E RA+EFY LLSSF FM STPTLFN+GT  PQLSSCFLTTV DDL GIF  ++ NA+LAK
Sbjct: 195 EARALEFYELLSSFRFMSSTPTLFNAGTTRPQLSSCFLTTVEDDLAGIFTGIRNNALLAK 254

Query: 396 YSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETW 455
           YSGGLGNDWTP+RG+GA I GTNG+SQGV+PFLK+ANDTA+AV+QGGKRKGAVCAYLETW
Sbjct: 255 YSGGLGNDWTPIRGIGATIRGTNGESQGVVPFLKIANDTAIAVHQGGKRKGAVCAYLETW 314

Query: 456 HIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYG 515
           H+DVE+FL+LRKNTGD+RRRTHDMNTANW+PDLF++RV  +AGWTLFSPDEV  LHDLYG
Sbjct: 315 HVDVEQFLELRKNTGDERRRTHDMNTANWVPDLFLQRVEADAGWTLFSPDEVPGLHDLYG 374

Query: 516 KEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQH 575
             F  AYE YER ADRGEI+VFR++ AV LWR+MLT+LFETGHPWITFKD CN+RSPQQH
Sbjct: 375 AAFAAAYEQYERAADRGEIRVFRRVRAVDLWRRMLTVLFETGHPWITFKDACNLRSPQQH 434

Query: 576 VGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNV 635
            GVVHSSNLCTEITLN++ +ETAVCNLGS+NL+AH      D   L  T+RTAVR+LDNV
Sbjct: 435 DGVVHSSNLCTEITLNTTVDETAVCNLGSVNLVAHLTPAGLDAGLLRDTVRTAVRMLDNV 494

Query: 636 IDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAI 695
           ID+N +T  +++++N  HR +GLGLMGF  AL  L +PYAS  AV  AD SME +S+HAI
Sbjct: 495 IDVNFYTTPESERANQRHRPVGLGLMGFADALFALRVPYASDAAVAFADTSMEQLSYHAI 554

Query: 696 SASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVK 754
            AS +LA ERG Y ++ GSLW QG+ PIDS+ LL E R  +L ++ ++ L WD L+ +V+
Sbjct: 555 EASSDLAAERGTYRTYDGSLWSQGILPIDSVELLREARGGDLDVDTSTTLDWDALRAKVR 614

Query: 755 TIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRD 814
             GMRNSN +AIAPTATI+NICGVSQSI+P+Y NL+VKSNMSG+FTV N +LV +LK R 
Sbjct: 615 RDGMRNSNVLAIAPTATISNICGVSQSIEPTYSNLFVKSNMSGEFTVANPYLVADLKARG 674

Query: 815 LWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLN 874
           LWD+ M+ DLKYHDG +  IERIP DL+ ++ATAFEIDP WL+ +ASRRQKWIDQ+QSLN
Sbjct: 675 LWDQRMVDDLKYHDGVLNRIERIPADLRTLYATAFEIDPAWLVAAASRRQKWIDQSQSLN 734

Query: 875 LYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSS 934
           LY+ EPSGK LD +YR AW  GLKTTYYLRS+SAT VEKSTL+G DG+LNAVPV +P ++
Sbjct: 735 LYVSEPSGKALDELYRSAWRHGLKTTYYLRSQSATHVEKSTLRGTDGRLNAVPV-EPVAA 793

Query: 935 THSLGIPSSCTSDTECEVCQ 954
             ++        D +CE CQ
Sbjct: 794 VCAI-------DDQDCEACQ 806


>gi|262376781|ref|ZP_06070009.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           lwoffii SH145]
 gi|262308491|gb|EEY89626.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           lwoffii SH145]
          Length = 945

 Score = 1088 bits (2813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/954 (56%), Positives = 684/954 (71%), Gaps = 47/954 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S R+ D I+ LTE  +    +   
Sbjct: 11  LQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSADSSRIHDRIEQLTEMVLNTFKRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVR---AAQSHSKSDAPIAPKL 145
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+RS+ R    A  H        P L
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARSYVIYREQRSEARKQLGAHHH--------PTL 122

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFS 205
           +I   +G L   +   L   V +A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ +
Sbjct: 123 QITDAEGKLKPLDLSALTAHVTKAAEGLEGIDVQAIVDETVKNLYNGVKESDISTTMMMA 182

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +RT IE+EPNY  VTAR L + L    L        K     +  +  +    Y+++G++
Sbjct: 183 TRTRIEQEPNYTYVTARLLRDDLVATGL--------KFLGLPVDTVEGDALETYLKKGIE 234

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
             LL   +++FDL  LA  ++ ER   F YLGLQ L+DRYF+H +G R E+PQ FFMRV+
Sbjct: 235 LELLSPELLNFDLAKLAAAIQPERSNQFTYLGLQTLFDRYFIHSDGVRFELPQLFFMRVS 294

Query: 326 MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFG 385
           MGL+L E  +E RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+G
Sbjct: 295 MGLSLNEENREDRAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIDDDLYDIYG 354

Query: 386 ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRK 445
           A+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRK
Sbjct: 355 AMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRK 414

Query: 446 GAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPD 505
           GAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++A WTLF+P 
Sbjct: 415 GAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDAEWTLFTPS 474

Query: 506 EVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKD 565
           E  DLHDL G EF   Y +YE  A    + + +KI A  LWRKML+MLFETGHPWITFKD
Sbjct: 475 ETPDLHDLTGAEFAERYAHYEAIAKETNM-LHKKIRAKDLWRKMLSMLFETGHPWITFKD 533

Query: 566 PCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTI 625
            CN+RSPQQHVGVVHSSNLCTEITLN+S EE AVCNLGSINL+ H      D +KLA T+
Sbjct: 534 VCNLRSPQQHVGVVHSSNLCTEITLNTSKEEIAVCNLGSINLVQHVQGGVLDREKLARTV 593

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
           +TAVR+LDNVIDIN + + +A+ SN  HR +G+G+MGFQ AL+ +++ Y S  AVE ADE
Sbjct: 594 KTAVRMLDNVIDINYYAVPQARNSNLKHRPVGMGIMGFQDALYEMNVAYGSDAAVEFADE 653

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSR 743
           SME IS++AIS S +LA ERG Y +FKGSLWDQG+ PIDS+ L+A+ R E    ++RT R
Sbjct: 654 SMEVISYYAISTSSDLAVERGTYETFKGSLWDQGILPIDSLDLVAKTRPERMFEVDRTQR 713

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N
Sbjct: 714 LDWDTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVIN 773

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++  W++++ASRR
Sbjct: 774 PYLVRALKERGLWDAVMVNDLKHFEGSVQKISRIPEELKAIFATAFEVETRWIVDAASRR 833

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKL 923
           QKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G L
Sbjct: 834 QKWIDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGAL 891

Query: 924 NAVPVT----------------DPNSSTHSLG------IPSSCTSDT-ECEVCQ 954
           NAV                    P +     G      +P +C+ D  +CE CQ
Sbjct: 892 NAVKPATVAAPVVAAAPVVEAQKPEAPAEEEGFAQAAPVPMACSIDNPDCEACQ 945


>gi|325121076|gb|ADY80599.1| ribonucleoside diphosphate reductase, alpha subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 944

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/950 (56%), Positives = 686/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASAR-----QQTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DTNGQLQPLDLSALQATVSKAAEGLEGIDVQAIVDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    LT +        ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLCNELVSTGLTFLGLSTDTPENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++DFDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLDFDLEKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 ---------------------PVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                                   +    T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAAVAAPVVEAKKPEAAVEEEGFTQAAPVPMACSIDNPDCEACQ 944


>gi|293609144|ref|ZP_06691447.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829717|gb|EFF88079.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 944

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/950 (56%), Positives = 686/950 (72%), Gaps = 40/950 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRASAR-----QQTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DTNGQLQPLDLSALQATVSKAAEGLEGIDVQAIVDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    LT +        ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLCNELVSTGLTFLGLSTDTPENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++DFDL  L+  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLDFDLEKLSAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + I Y S  AV+ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGIAYGSDAAVDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 ---------------------PVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                                   +    T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAAVAAPVVEVKKPEAAVEEEGFTQAAPVPMACSIDNPDCEACQ 944


>gi|255318311|ref|ZP_05359546.1| ribonucleoside-diphosphate reductase subunit alpha [Acinetobacter
           radioresistens SK82]
 gi|262379055|ref|ZP_06072211.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           radioresistens SH164]
 gi|255304623|gb|EET83805.1| ribonucleoside-diphosphate reductase subunit alpha [Acinetobacter
           radioresistens SK82]
 gi|262298512|gb|EEY86425.1| ribonucleoside-diphosphate reductase, alpha subunit [Acinetobacter
           radioresistens SH164]
          Length = 942

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/948 (55%), Positives = 686/948 (72%), Gaps = 38/948 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ ++ S RV D I  LTE  +    +   
Sbjct: 11  LQVIKRTGEVAAFDAEKISVAIGKAFLAVEGQQSADSSRVHDRITQLTEMVMNTFKRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+     Q+  ++ A   P L+I 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRN-----QARQQTGAHHHPTLQIT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G L   +  +L+  +E+A  GL+ +  + ++ ET KN+Y+G+  SD+ T ++ ++RT
Sbjct: 126 DSKGQLQPLDMSKLQTTLEKASEGLEGIDVQAIIDETVKNLYNGVKASDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L ++L    L  +           ++         ++++G++  L
Sbjct: 186 RIEQEPNYTYVTARLLRDELVATGLAFLGLSEDTPESEALEA--------FLKKGIELEL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LDAELLKFDLKKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGIRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E ++E RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 AVQEDDREARAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTISDDLYNIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G  F   Y  YE  A    + + +KI A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGSAFAERYAYYESVAKEQNM-LHKKIRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H    + D +KLA T++TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGKLDREKLARTVKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ L + Y S  AVE ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYELGMAYGSDAAVEFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R +    ++RT RL W
Sbjct: 657 VISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPDRMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           + L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 NTLRTKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIPD+LK I ATAFE++P W++++ASRRQKW
Sbjct: 777 VRALKERGLWDSVMVNDLKHFEGSVQKIARIPDELKAIFATAFEVEPRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDLTYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 -------------------PVTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                               V + +    +  +P +C+ D  +CE CQ
Sbjct: 895 KATAAAPVAAAPVVETKPETVAEEDGFAQAAPVPMACSIDNPDCEACQ 942


>gi|262280151|ref|ZP_06057936.1| ribonucleotide reductase [Acinetobacter calcoaceticus RUH2202]
 gi|262260502|gb|EEY79235.1| ribonucleotide reductase [Acinetobacter calcoaceticus RUH2202]
          Length = 943

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/949 (56%), Positives = 686/949 (72%), Gaps = 39/949 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R  Q++S       P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRTTARQ-QTNSNHH----PTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  + +A  GL+ +  + ++ ET KN+Y+G+ E+D+ T ++ ++RT
Sbjct: 126 DANGQLQPLDLSALQATIAKAAEGLEGIDVQAIVDETVKNLYNGVKETDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    L  +        +  ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLSSELVSTGLAFLGLPTDTPENTALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++DFDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLDFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
            L E  KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 TLNEQNKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ ++I Y S  A++ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNIAYGSDAAIDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S  LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIETSSNLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYIAGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 --------PVTDP------------NSSTHSLGIPSSCTSDT-ECEVCQ 954
                   PV  P            +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAPVAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 943


>gi|299771425|ref|YP_003733451.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. DR1]
 gi|298701513|gb|ADI92078.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           sp. DR1]
          Length = 943

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/949 (56%), Positives = 686/949 (72%), Gaps = 39/949 (4%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKR G V +FD  KIS AI KAF+AVEG+ +S S R+ D I  LTE  +    +   
Sbjct: 11  IQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSSDSSRIHDRITQLTEMVLNTFTRRLP 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R YV+YRE+R+  R      ++++   P L++ 
Sbjct: 71  SGGTIHIEEIQDQVELALMRTGEQKVARAYVIYREQRTTAR-----QQTNSNHHPTLQVT 125

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             +G L   +   L+  V +A  GL+ +  + ++ ET KN+Y+G+ ESD+ T ++ ++RT
Sbjct: 126 DANGQLQPLDLSALQATVAKAAEGLEGIDVQAIVDETVKNLYNGVKESDIATTMMMATRT 185

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EPNY  VTAR L  +L    L  +        ++ ++         ++++GV+  L
Sbjct: 186 RIEQEPNYTYVTARLLSSELVSTGLAFLGLPTDTPENNALEA--------FLKKGVELDL 237

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L   ++DFDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ FFMRV+MGL
Sbjct: 238 LSPDLLDFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQLFFMRVSMGL 297

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           AL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ DDLY I+GA++
Sbjct: 298 ALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGDDLYDIYGAMR 357

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGAV
Sbjct: 358 DNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAV 417

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  WTLF+P E  
Sbjct: 418 CAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGEWTLFTPSETP 477

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGHPWITFKD CN
Sbjct: 478 DLHDLTGAEFAERYAYYESVAKETNM-LHKKVRAKDLWRKMLSMLFETGHPWITFKDVCN 536

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D +KLA TI+TA
Sbjct: 537 LRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVQGGVLDREKLARTIKTA 596

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ ++I Y S  A++ ADESME
Sbjct: 597 VRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMNIAYGSDAAIDFADESME 656

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPW 746
            IS++AI  S  LA ERG+YS+FKGSLWDQG+ PIDS+ ++A+ R E    ++RT RL W
Sbjct: 657 VISYYAIETSSNLAVERGSYSTFKGSLWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDW 716

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
           D L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+SG+FTV+N +L
Sbjct: 717 DTLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYL 776

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V  LK R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE+D  W++++ASRRQKW
Sbjct: 777 VRALKDRGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVDTRWIVDAASRRQKW 836

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           IDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+    G LNAV
Sbjct: 837 IDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTIN--TGALNAV 894

Query: 927 P--------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
                                  + +  T +  +P +C+ D  +CE CQ
Sbjct: 895 KPATVEAAAVAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 943


>gi|149375673|ref|ZP_01893442.1| Ribonucleotide reductase, alpha subunit [Marinobacter algicola
           DG893]
 gi|149360075|gb|EDM48530.1| Ribonucleotide reductase, alpha subunit [Marinobacter algicola
           DG893]
          Length = 921

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/931 (57%), Positives = 676/931 (72%), Gaps = 34/931 (3%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG +  FD SKIS A+ KAF+AVEG  A+ S R+ D ++ +T Q +  + +  K
Sbjct: 20  LQVIKRNGALVGFDASKISVAVTKAFLAVEGDEAAGSARIHDSVERVTHQVMQAISRRLK 79

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA--PKLK 146
           +   VHIEDIQDQVE +LM++   K+ R YVLYRE  +  RA      S AP+   P L 
Sbjct: 80  AGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREAHAQERA------SLAPVEAHPTLT 133

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
           +   +G     +   +++ VE A   L+ +  + ++    +N+YDG++E ++ +ALI ++
Sbjct: 134 VKKANGEAAPLDLGLMKVQVERASQELEGIDGESLVEGALRNLYDGIAEEEVLSALIMTA 193

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
           R  IE+EP+Y+ VTAR LLE+LR E  T + K P      E   +YP+    +IE+G+  
Sbjct: 194 RGRIEQEPDYSAVTARLLLEQLRLETATAL-KLPLSLPLAE---IYPQALSTFIEQGIHY 249

Query: 267 RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAM 326
            LL E+M  FDL  L   LK ERD+ F +LGLQ LYDRYFL+  G R+E+PQ FFMRV+M
Sbjct: 250 ELLDEAMAAFDLERLGAALKPERDYQFGFLGLQTLYDRYFLNWKGDRLELPQVFFMRVSM 309

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL+E +   RA+EFY+LLSSF +M STPTLFNSGTRH QLSSC+LTTV DDL GI+GA
Sbjct: 310 GLALQEDDPNARAIEFYDLLSSFDYMASTPTLFNSGTRHSQLSSCYLTTVQDDLEGIYGA 369

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +++NAML+K++GGLGNDWTPVR LG+HI GTNG SQGV+PFLKV NDTAVAVNQGGKRKG
Sbjct: 370 IRDNAMLSKWAGGLGNDWTPVRALGSHIKGTNGSSQGVVPFLKVVNDTAVAVNQGGKRKG 429

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+  +  WTLFSP++
Sbjct: 430 AVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRSDQDWTLFSPND 489

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
             DLHDLYG  F   Y+ YE  A RGEI +F+ +SA  LWRKMLT+LFETGHPWITFKDP
Sbjct: 490 TPDLHDLYGNAFRERYQEYEAMAARGEITLFKTVSAKQLWRKMLTVLFETGHPWITFKDP 549

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
           CN+RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGSINL AH  N + D  +L  T+ 
Sbjct: 550 CNLRSPQQHRGVVHSSNLCTEITLNTSADEIAVCNLGSINLAAHVHNGELDVQRLERTVN 609

Query: 627 TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
           TAVR+LDNV+DIN + + +A+ SN  HR +GLGLMGFQ AL+ L++PY S EAVE AD +
Sbjct: 610 TAVRMLDNVVDINYYAVPQARNSNFKHRPVGLGLMGFQDALYRLNLPYTSAEAVEFADVA 669

Query: 687 MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
           ME IS+ AI AS  LA ERGAY +++GSLW +G+ PIDSI LL   R E  L++N  + L
Sbjct: 670 MEQISYFAIRASAVLAGERGAYETYEGSLWHEGILPIDSINLLKANRREGDLSLNTDTLL 729

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            W  +++ +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTVVN 
Sbjct: 730 DWTPVRELIARNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVVNP 789

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
            LV +LK   LWD  M++DLKY DGS+  I+RIP  LK  +ATAFEID  WL+E+A+RRQ
Sbjct: 790 SLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPAALKARYATAFEIDARWLVEAAARRQ 849

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           KW+DQAQSLNLY+ EPSGKKLD +Y+ +W  GLKTTYYLRS  AT  EK+          
Sbjct: 850 KWLDQAQSLNLYMAEPSGKKLDELYQLSWERGLKTTYYLRSLGATGAEKT---------- 899

Query: 925 AVPVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
             PV  P         P  C+ D  +CE CQ
Sbjct: 900 -APVAAPQ--------PQVCSIDEPDCEACQ 921


>gi|134097870|ref|YP_001103531.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007411|ref|ZP_06565384.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133910493|emb|CAM00606.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 782

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/782 (65%), Positives = 611/782 (78%), Gaps = 3/782 (0%)

Query: 176 VSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTT 235
           +S+  VL E  +N +DG+S  +L  A I ++R ++E EPNY++VTAR LL++LRRE LT 
Sbjct: 1   MSADAVLDEVRRNSFDGISADELAIAQIMAARIMVEAEPNYSQVTARLLLDRLRREALTY 60

Query: 236 VYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEY 295
           +   P  A   +M+  Y  YF  Y+  GV+   L   +  FDL  L   L  ERD +F +
Sbjct: 61  LAGLPDDADQEQMRERYAPYFRDYVARGVELGQLDPELASFDLDRLGAALLPERDMSFGF 120

Query: 296 LGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCST 355
           LGLQ LYDRYFLH +G+R E+PQAFFMRVAMGLAL+E ++E RAVEFY LLSSF FMCST
Sbjct: 121 LGLQTLYDRYFLHHDGTRYELPQAFFMRVAMGLALREDDREARAVEFYRLLSSFDFMCST 180

Query: 356 PTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIH 415
           PTLFNSGT  PQLSSCFLTTV DDL+GIF ++  NAML+KY+GGLGNDWTPVRG+GAHI 
Sbjct: 181 PTLFNSGTTRPQLSSCFLTTVDDDLHGIFHSISNNAMLSKYAGGLGNDWTPVRGIGAHIR 240

Query: 416 GTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR 475
           GTNG+SQGV+PFLK+ANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR
Sbjct: 241 GTNGQSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR 300

Query: 476 THDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIK 535
           THDMNTANW+PD FM+RV  +  WTLFSPDE  DLHDLYG  F   Y  YER A+RGEIK
Sbjct: 301 THDMNTANWVPDEFMRRVEADGTWTLFSPDETPDLHDLYGTAFAERYRAYERAAERGEIK 360

Query: 536 VFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSE 595
           V+R++ AV LWR+MLTMLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITLN+S +
Sbjct: 361 VYRQVRAVDLWRRMLTMLFETGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSRD 420

Query: 596 ETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           E AVCNLGS+NL  H   +  D+++L  T RTAVR+LDNVIDIN +TI +A++SN  HR 
Sbjct: 421 EVAVCNLGSVNLARHVTADGIDHERLERTTRTAVRMLDNVIDINFYTIPEARRSNLRHRP 480

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           IGLGLMGF  AL    IP +S  AVE AD SME IS+HAISAS +LA ERG Y SF+GSL
Sbjct: 481 IGLGLMGFSDALFAQRIPVSSQAAVEFADRSMEEISYHAISASADLAAERGRYESFEGSL 540

Query: 716 WDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           W QGV PIDS+ LL + RD  + ++RT    W  L++RV+ +GMRNSN MAIAPTATIAN
Sbjct: 541 WSQGVLPIDSLALLEQARDGHVDLDRTMTRDWGALRERVRAVGMRNSNVMAIAPTATIAN 600

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           ICGV QSI+P Y+NLYVKSNMSGDFTVVN  LV +LK   LWDE M++DLK+HDGS+  I
Sbjct: 601 ICGVGQSIEPIYRNLYVKSNMSGDFTVVNPHLVADLKAAGLWDEDMLADLKFHDGSLDPI 660

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
            RIP +LK+++ATAFE++P WL+E+A+RRQKWIDQAQSLNLY+  PSG+KLD +YR AW 
Sbjct: 661 SRIPGELKELYATAFEVEPRWLVEAAARRQKWIDQAQSLNLYVAAPSGRKLDELYRLAWR 720

Query: 895 MGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTD--PNSSTHSLGIPSSCTSDTECEV 952
            GLKTTYYLRS SAT VEKSTL+G DGKLNAVP T   P   T ++   +    D +CE 
Sbjct: 721 QGLKTTYYLRSTSATHVEKSTLRGTDGKLNAVPTTPVAPVVPTAAVDGAACSVDDPDCEA 780

Query: 953 CQ 954
           CQ
Sbjct: 781 CQ 782


>gi|297563528|ref|YP_003682502.1| ribonucleoside-diphosphate reductase, subunit alpha [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|296847976|gb|ADH69996.1| ribonucleoside-diphosphate reductase, alpha subunit [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 882

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/765 (66%), Positives = 606/765 (79%), Gaps = 1/765 (0%)

Query: 161 RLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVT 220
           R+E +V EAC+ L  VS++ VL+E  +  Y G+S++++E AL+ ++R+ +E +P+Y+ V 
Sbjct: 55  RIEHVVAEACARLTGVSAEKVLTEARRGFYPGISDAEVELALVMAARSFVEVDPDYSYVA 114

Query: 221 ARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVY 280
           AR LL+KLRRE LT +   P  A   EM   Y  Y   Y+  G+    L  ++  FDL  
Sbjct: 115 ARLLLDKLRREALTFISGAPDAAGQSEMGERYAAYLAAYVGRGIDLGQLDPALAKFDLAR 174

Query: 281 LANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAV 340
           L   L+ ERD  F +LG+Q LYDRYFLH +  R E+PQAFFMRVAMGLAL E ++E RA+
Sbjct: 175 LGAALRPERDEQFTFLGIQTLYDRYFLHSDEVRYELPQAFFMRVAMGLALNEDDREARAI 234

Query: 341 EFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGL 400
           EFY LLSSF FM STPTLFNSGT   QLSSCFLTTV DDL  IF  +  NAML+KYSGGL
Sbjct: 235 EFYELLSSFDFMASTPTLFNSGTVRAQLSSCFLTTVGDDLQAIFHGISNNAMLSKYSGGL 294

Query: 401 GNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVE 460
           GNDWTPVRGLG+HI GTNGKSQGV+PFLK+ANDTAVAVNQGGKRKGAVCAYLETWHID+E
Sbjct: 295 GNDWTPVRGLGSHIRGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDIE 354

Query: 461 EFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEI 520
           EFLDLRKNTGD+RRRTHDMNTANW+PDLFM+RV Q   WTLFSPDEV DLHD YG EF  
Sbjct: 355 EFLDLRKNTGDERRRTHDMNTANWVPDLFMQRVEQGGSWTLFSPDEVPDLHDKYGAEFAE 414

Query: 521 AYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVH 580
           AY +YE +A  G IKV + + AV LWR+MLTMLFETGHPWITFKDP N+RSPQQHVGVVH
Sbjct: 415 AYAHYEAEAAAGRIKVSKTLPAVDLWRRMLTMLFETGHPWITFKDPSNLRSPQQHVGVVH 474

Query: 581 SSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINC 640
           SSNLCTEITLN+S++E AVCNLGS+NL  H   +  D ++L  T+RTAVR+LDNVID+N 
Sbjct: 475 SSNLCTEITLNTSADEVAVCNLGSVNLAQHVGPDGLDAERLRRTVRTAVRMLDNVIDVNF 534

Query: 641 HTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVE 700
           +TI +A+++N  HR +GLGLMGFQ AL  L  P+AS  AV  ADESME IS++AI AS+E
Sbjct: 535 YTIPEARRANMRHRPVGLGLMGFQDALFKLRTPFASDGAVSFADESMELISYYAIEASME 594

Query: 701 LAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMR 759
           LA ERG+Y SF+GSLW +GV PIDS+ LLAE RD +L M+R   L WD L++RVKT GMR
Sbjct: 595 LAAERGSYESFEGSLWSRGVLPIDSLRLLAESRDGDLDMDRGETLDWDSLRERVKTTGMR 654

Query: 760 NSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEA 819
           NSN MAIAPTATIANI GVSQSI+P Y+NLYVKSNMSGDFTVVN +LV +LK R LWD+ 
Sbjct: 655 NSNVMAIAPTATIANITGVSQSIEPVYRNLYVKSNMSGDFTVVNPYLVRDLKARGLWDDD 714

Query: 820 MISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDE 879
           M+S LK HDGS+G I+R+P DLK ++ATAFE+DP WL+++ SRRQKWIDQAQSLNLY+  
Sbjct: 715 MVSALKMHDGSLGAIDRVPADLKALYATAFEVDPEWLVDAGSRRQKWIDQAQSLNLYMAA 774

Query: 880 PSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLN 924
           PSG+KLD +YR+AW  GLKTTYYLRS+SAT VEKSTLKG DG+LN
Sbjct: 775 PSGRKLDSLYRRAWRSGLKTTYYLRSQSATHVEKSTLKGTDGRLN 819


>gi|126664353|ref|ZP_01735337.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17]
 gi|126630679|gb|EBA01293.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17]
          Length = 929

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/929 (56%), Positives = 673/929 (72%), Gaps = 29/929 (3%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           +QVIKRNG + +F PSKI  A+ KAF+AVEG  A+ S R+ D +  +T+Q V  + +  K
Sbjct: 27  LQVIKRNGNLVNFTPSKIGVAVTKAFLAVEGDQAAGSARINDAVHRVTDQVVQAISRRLK 86

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           +   VHIEDIQDQVE +LM++   K+ R YVLYREE +  RA   H   +A   P L + 
Sbjct: 87  AGGKVHIEDIQDQVELALMRAEEQKVARAYVLYREEHARERAL--HEPVEA--HPTLTVK 142

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
              G  +  +   ++  V+ A  GL  + ++ ++ E+ +N+Y+G+ E+++ +ALI ++R 
Sbjct: 143 QAGGRTVPLDLGLMKQQVDNAAFGLDGIDAESLVEESIRNLYNGIDEAEVLSALIMTARG 202

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EP+Y+ VTAR LLE+LR E +T +    +  T   +  +YP+    +I  G++  L
Sbjct: 203 RIEREPDYSAVTARLLLEQLRLESVTAL----KLDTSLSLADVYPQALSTFINAGIRYEL 258

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L E+M  FD+  L   LK ERD  F +LGLQ LYDRYFLH    R+E+PQ FFMRVAMGL
Sbjct: 259 LDEAMAAFDMERLGAALKPERDLQFGFLGLQTLYDRYFLHWKEDRLELPQVFFMRVAMGL 318

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           +L+E +   RA+EFY+LLSSF +M STPTLFNSGTRH QLSSC+LTTV DDL  I+G+++
Sbjct: 319 SLREDDPNSRAIEFYDLLSSFDYMSSTPTLFNSGTRHSQLSSCYLTTVDDDLEAIYGSIR 378

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR +GA I GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 379 DNAMLSKWAGGLGNDWTPVRAMGARIKGTNGQSQGVVPFLKVVNDTAVAVNQGGKRKGAV 438

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLE+WH+D+EEFL+LRKNTGD+RRRTHDMNTANW+PDL ++R+ Q+  WTLFSP++  
Sbjct: 439 CAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRQDRDWTLFSPNDAP 498

Query: 509 DLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCN 568
           DLHDLYG  F   Y++YE  A  G+I++F+ I A  LWRKMLT+LFETGHPWITFKDPCN
Sbjct: 499 DLHDLYGNAFRERYQHYEALAAEGKIELFKTIPAKQLWRKMLTVLFETGHPWITFKDPCN 558

Query: 569 IRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTA 628
           +RSPQQH GVVHSSNLCTEITLN+S++E AVCNLGS+NL AH  N + D  +L  T+ TA
Sbjct: 559 LRSPQQHKGVVHSSNLCTEITLNTSADEIAVCNLGSVNLAAHINNGELDVKRLERTVDTA 618

Query: 629 VRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESME 688
           VR+LDNVIDIN + + +A+ SN  HR +GLGLMGFQ AL+ L + Y SP+AVE AD +ME
Sbjct: 619 VRMLDNVIDINFYAVPQARNSNLKHRPVGLGLMGFQDALYALRLSYTSPQAVEFADVAME 678

Query: 689 FISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL--AEVRDELAMNRTSRLPW 746
            +S+ AI AS  LA ERGAY S++GSLW Q + PIDSI  L  A +  +L++N  SRL W
Sbjct: 679 QLSYFAIRASARLAAERGAYESYEGSLWSQKILPIDSIERLKAARLEGDLSVNTDSRLDW 738

Query: 747 DELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFL 806
             ++  +   GMRNSN MAIAPTATI+NI GVSQSI+P+YQNL+VKSN+SG+FTVVN  L
Sbjct: 739 APVRDLIAKHGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVVNPSL 798

Query: 807 VNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKW 866
           V +LK   LWD  M++DLKY+DGS+  IERIP +LK  +ATAFEID  WL+E+ASRRQKW
Sbjct: 799 VRDLKAEGLWDNVMVNDLKYYDGSVQQIERIPTELKSRYATAFEIDARWLVEAASRRQKW 858

Query: 867 IDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAV 926
           +DQ QSLNLY+ +PSGKKLD +Y+ AW  GLKTTYYLRS  AT   +           A 
Sbjct: 859 LDQGQSLNLYMAQPSGKKLDELYQLAWERGLKTTYYLRSLGATGANE----------QAA 908

Query: 927 PVTDPNSSTHSLGIPSSCTSD-TECEVCQ 954
            V  P         P  C+ D  +CE CQ
Sbjct: 909 TVAAPQ--------PQVCSIDEPDCEACQ 929


>gi|254449375|ref|ZP_05062817.1| ribonucleoside-diphosphate reductase, alpha subunit [gamma
           proteobacterium HTCC5015]
 gi|198261021|gb|EDY85324.1| ribonucleoside-diphosphate reductase, alpha subunit [gamma
           proteobacterium HTCC5015]
          Length = 839

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/746 (66%), Positives = 608/746 (81%), Gaps = 3/746 (0%)

Query: 172 GLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRRE 231
           GL+DV +  +L++T +N++DG+++ ++ TALI S+RT+IEK+PNY++V+AR LL+ +R E
Sbjct: 2   GLEDVDADKILNDTLRNVFDGVAKKEVATALIMSARTMIEKDPNYSQVSARLLLDSMREE 61

Query: 232 VLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDF 291
            LT +      AT  EMQ  YPEYF  YI   V+  LL   M +FDL  L   L  ERD 
Sbjct: 62  ALTFLGDGAPAATQAEMQERYPEYFKHYIARAVELELLDGEMHNFDLERLGQALLPERDQ 121

Query: 292 AFEYLGLQILYDRYFLHIN-GSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFH 350
            F YLGLQ LYDRYF+H + G R E+PQAFFMRVAMGLA+ E ++E+RA+EFY LLSSF 
Sbjct: 122 GFTYLGLQTLYDRYFIHDDSGVRFELPQAFFMRVAMGLAINEVDREERAIEFYTLLSSFD 181

Query: 351 FMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGL 410
           FM STPTLFNS T  PQLSSC+LTTVPDDL GIF A++++AML+K++GGLGNDWT VR L
Sbjct: 182 FMSSTPTLFNSATLRPQLSSCYLTTVPDDLDGIFSAVKDDAMLSKFAGGLGNDWTRVRAL 241

Query: 411 GAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTG 470
           GAHI GTNGKSQGV+PFLKVANDTAVAVNQGGKRKGA+CAYLE+WH+D+EEFL+LRKNTG
Sbjct: 242 GAHIKGTNGKSQGVVPFLKVANDTAVAVNQGGKRKGAMCAYLESWHLDIEEFLELRKNTG 301

Query: 471 DDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQAD 530
           DDRRRTHDMNTANWIPDLFMKRV ++  WTLFSP++V DLHDL GK+FE AY  YE +AD
Sbjct: 302 DDRRRTHDMNTANWIPDLFMKRVAEDGEWTLFSPNDVDDLHDLVGKKFEKAYTAYEAKAD 361

Query: 531 RGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITL 590
            GEIK+F+++ AV LWRKML MLFETGHPWITFKDPCN+RSPQQH GVVHSSNLCTEITL
Sbjct: 362 SGEIKLFKRVKAVDLWRKMLGMLFETGHPWITFKDPCNLRSPQQHAGVVHSSNLCTEITL 421

Query: 591 NSSSEETAVCNLGSINLLAHFA-NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKS 649
           N+S  E AVCNLGS+N+  H     + D  KL  TI+TA+R+LDNVID N +++ +A++S
Sbjct: 422 NTSDMEIAVCNLGSVNMAQHVTEEGELDVAKLERTIKTAMRMLDNVIDYNYYSVPQARRS 481

Query: 650 NHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYS 709
           N  HR +GLG+MGFQ AL+   + Y S EAVE AD +ME +S++AIS+SV+LA+ERGAYS
Sbjct: 482 NIRHRPVGLGIMGFQDALYKKGVAYQSDEAVEFADRAMEAVSYYAISSSVDLAEERGAYS 541

Query: 710 SFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAP 768
           SF GSLW +G+ PIDSI +LAE R D L ++R+  + WD L++RV+  GMRNSNCMAIAP
Sbjct: 542 SFPGSLWSRGILPIDSIDILAEHRGDFLQVDRSQTMDWDSLRQRVRESGMRNSNCMAIAP 601

Query: 769 TATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHD 828
           TATI+NICGVSQSI+P+YQNL+VKSN+SG+FTV+N +LV ELK R+LWD+ M++DLKY+D
Sbjct: 602 TATISNICGVSQSIEPTYQNLFVKSNLSGEFTVINPYLVKELKARNLWDDVMVNDLKYYD 661

Query: 829 GSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFI 888
           GS+  IERIPDDL++I++TAFEID  WL+E+ SRRQKWIDQ QSLNLY+ EPSGKKLD +
Sbjct: 662 GSVHPIERIPDDLRQIYSTAFEIDARWLVEAGSRRQKWIDQGQSLNLYMSEPSGKKLDNL 721

Query: 889 YRQAWLMGLKTTYYLRSRSATSVEKS 914
           Y+ AW  GLKTTYYLRS  AT VEK+
Sbjct: 722 YKLAWARGLKTTYYLRSMGATHVEKT 747


>gi|257055669|ref|YP_003133501.1| ribonucleotide-diphosphate reductase subunit alpha
           [Saccharomonospora viridis DSM 43017]
 gi|256585541|gb|ACU96674.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Saccharomonospora viridis DSM 43017]
          Length = 815

 Score = 1058 bits (2736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/800 (64%), Positives = 621/800 (77%), Gaps = 5/800 (0%)

Query: 160 KRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKV 219
           +R+  +V EA +GL D S++ VL+E  +N+YDG+   +L  A I ++RTL+E+EPNY+ V
Sbjct: 16  ERVHRVVREAVAGLPDTSAEAVLAELKRNVYDGIRADELALAQIMAARTLVEREPNYSFV 75

Query: 220 TARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLV 279
            AR LL+ LR E  + +  +P++  + EM   Y +YF  Y+  G+  +LL E +  FDL 
Sbjct: 76  AARLLLDLLRGEATSYLADEPRQPDYAEMAAGYADYFRDYLRRGIDLQLLDEELAAFDLD 135

Query: 280 YLANDLKYERDFAFEYLGLQILYDRYFLHI--NGSRIEMPQAFFMRVAMGLALKETEKEK 337
            LA  L+ ERD     LGLQ LYDRY L     G R E+PQAFFMRVAMGLA++E E++ 
Sbjct: 136 ILAAALRPERDLDLGLLGLQTLYDRYLLRDPHAGIRFELPQAFFMRVAMGLAIREPERDT 195

Query: 338 RAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYS 397
           RAVEFY LLS+  FM STPTLFN+GTR PQLSSCFLTTV DDL  IF   + NA+LAKYS
Sbjct: 196 RAVEFYELLSTLRFMTSTPTLFNAGTRRPQLSSCFLTTVSDDLESIFTGYRNNALLAKYS 255

Query: 398 GGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHI 457
           GGLGNDWTPVRGLGAHI GT GKSQGV+PFLK+ANDT VAVNQGGKRKGA CAYLETWHI
Sbjct: 256 GGLGNDWTPVRGLGAHIRGTGGKSQGVVPFLKIANDTTVAVNQGGKRKGAACAYLETWHI 315

Query: 458 DVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKE 517
           D+EEFL+LRKNTGDDRRRTHDMNTANW+PD F++RV  +A WTLFSPDEV DLHDLYG  
Sbjct: 316 DIEEFLELRKNTGDDRRRTHDMNTANWVPDEFLRRVEADAQWTLFSPDEVPDLHDLYGTA 375

Query: 518 FEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVG 577
           F   Y  YE+ AD G+I+VFR++SA  LWR+MLTMLFETGHPWITFKDPCN+RSPQQH G
Sbjct: 376 FAERYRAYEKAADAGQIRVFRRVSATQLWRRMLTMLFETGHPWITFKDPCNLRSPQQHAG 435

Query: 578 VVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVID 637
           VVHSSNLCTEITLN+S +E AVCNLGS+NL  H   +  D + L  T+RTAVR+LDNVID
Sbjct: 436 VVHSSNLCTEITLNTSPDEIAVCNLGSVNLARHIGKDGLDVEALRKTVRTAVRMLDNVID 495

Query: 638 INCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISA 697
           IN +T+ +A++SN  HR +GLGLMGF  AL  L IP AS EAVE AD SME +S+HAISA
Sbjct: 496 INFYTVPEARRSNLRHRPVGLGLMGFTDALFELGIPQASDEAVEFADRSMEVLSYHAISA 555

Query: 698 SVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNRTSRLPWDELKKRVKT 755
           SVELA ERGAY SF GSLW +G+ P+DS+ LLAE R  DEL ++ +S L WD L++RV+T
Sbjct: 556 SVELAGERGAYPSFDGSLWSRGILPLDSLRLLAEARGEDELDIDTSSTLDWDALRERVRT 615

Query: 756 IGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDL 815
           +GMRNSN +AIAPTATI+NICGV QSI+P + NL+VKSNMSG+FTVVN +LV +LK+R L
Sbjct: 616 VGMRNSNVLAIAPTATISNICGVGQSIEPLFSNLFVKSNMSGEFTVVNPYLVRDLKRRGL 675

Query: 816 WDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNL 875
           WDE M+ +LK HDG +G IER+P++LKK++ATAFE D  WL+++A+RRQKWIDQAQSLNL
Sbjct: 676 WDERMVVELKLHDGVLGPIERVPEELKKLYATAFEFDSRWLVDAAARRQKWIDQAQSLNL 735

Query: 876 YLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSST 935
           YL EPSG+ LD +YR AW  GLKTTYYLRSR+AT VEKSTL+G DG+LNAV    P    
Sbjct: 736 YLAEPSGRALDALYRHAWRRGLKTTYYLRSRAATQVEKSTLRGTDGRLNAVAPAVPAVPA 795

Query: 936 HSLGIPSSC-TSDTECEVCQ 954
            + G  ++C   D +CE CQ
Sbjct: 796 DASGAAAACRIDDPDCEACQ 815


>gi|126640805|ref|YP_001083789.1| ribonucleotide-diphosphate reductase subunit alpha [Acinetobacter
           baumannii ATCC 17978]
          Length = 885

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/900 (56%), Positives = 655/900 (72%), Gaps = 43/900 (4%)

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
           T TR L    S   +HIE+IQDQVE +LM++G HK+ R YV+YR++R+  R       ++
Sbjct: 5   TFTRRL---PSGGTIHIEEIQDQVELALMRTGEHKVARAYVIYRDQRASAR-----KDTN 56

Query: 139 APIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDL 198
           +   P L++   +G L   +   L+  V  A  GL+ +  + ++ ET KN+Y+G+ ESD+
Sbjct: 57  SNHHPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETVKNLYNGVKESDI 116

Query: 199 ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
            T ++ ++RT IE+EPNY  VTAR L ++L    L  +      A ++ ++         
Sbjct: 117 ATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAENNALEA-------- 168

Query: 259 YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
           ++++GV+  LL   ++ FDL  LA  ++ ER   F YLGLQ L+DRYF+H NG R E+PQ
Sbjct: 169 FLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGVRFELPQ 228

Query: 319 AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
            FFMRV+MGLAL E +KE+RA+EFYNLLSSF +M STPTLFNSGT  PQLSSC+LTT+ D
Sbjct: 229 LFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSCYLTTIGD 288

Query: 379 DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
           DLY I+GA+++NAML+K++GGLGNDWTPVR L ++I GTNGKSQGV+PFLKVANDTAVAV
Sbjct: 289 DLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKVANDTAVAV 348

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANW+PDLFM+RV ++  
Sbjct: 349 NQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLFMQRVFEDGE 408

Query: 499 WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
           WTLF+P E  DLHDL G EF   Y  YE  A    + + +K+ A  LWRKML+MLFETGH
Sbjct: 409 WTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNM-LHKKVRAKDLWRKMLSMLFETGH 467

Query: 559 PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
           PWITFKD CN+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL+ H      D 
Sbjct: 468 PWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLVQHVKGGVLDR 527

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
           +KLA T++TAVR+LDNVIDIN + + +AK SN  HR +G+G+MGFQ AL+ + + Y S E
Sbjct: 528 EKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDALYEMGMAYGSDE 587

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
           AV  ADESME IS++AI  S +LA ERGAYS+FKGSLWDQG+ PIDS+ ++A+ R E   
Sbjct: 588 AVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSLEIVAKSRPERMF 647

Query: 737 AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
            ++RT RL WD L+ +V+  GMRNSN MAIAPTATI+NICGVSQSI+P++QNLYVKSN+S
Sbjct: 648 EVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIEPTFQNLYVKSNLS 707

Query: 797 GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
           G+FTV+N +LV  LK+R LWD  M++DLK+ +GS+  I RIP++LK I ATAFE++P W+
Sbjct: 708 GEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELKAIFATAFEVEPRWI 767

Query: 857 IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           +++ASRRQKWIDQAQSLNLY+   +GKKLD  Y+ AWL GLKTTYYLR+  ATS EKST+
Sbjct: 768 VDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTYYLRALGATSAEKSTI 827

Query: 917 KGVDGKLNAVP---------------------VTDPNSSTHSLGIPSSCTSDT-ECEVCQ 954
               G LNAV                        + +  T +  +P +C+ D  +CE CQ
Sbjct: 828 N--TGALNAVKPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVPMACSIDNPDCEACQ 885


>gi|221124254|ref|XP_002159508.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase large
           subunit [Hydra magnipapillata]
          Length = 846

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/840 (59%), Positives = 630/840 (75%), Gaps = 14/840 (1%)

Query: 107 MQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDDGTLISFNSKRLEMIV 166
           M+ GHH+I R YVLYRE R+  RA Q    ++AP AP + ++ D+G  +  +  +L+  +
Sbjct: 1   MRGGHHEIARAYVLYRERRTQERAKQV--ATEAPAAPVIHVI-DNGQRVPLDLAQLQFRI 57

Query: 167 EEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLL 225
           E ACSGL  DV +  +L+ET +N+YDG+   ++  A I ++RTLIEK+P+Y   TAR L 
Sbjct: 58  ETACSGLGADVKAAPILAETMRNLYDGVPLDEVYKAAILAARTLIEKDPDYTYATARLLF 117

Query: 226 EKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDL 285
             + REVL       +     +MQ  Y +YF  +I+ G+ A LL E +  FDL  L + L
Sbjct: 118 HTISREVLG------RDVAQADMQEAYADYFPGFIKRGIAAELLDEKLQQFDLKRLGSAL 171

Query: 286 KYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNL 345
           K  RD  F+YLGLQ LYDRYFLH   +RIE+PQAFFMRVAMGL+L E ++E RA+EFY +
Sbjct: 172 KAGRDLQFDYLGLQTLYDRYFLHEGKTRIELPQAFFMRVAMGLSLNEIDREARAIEFYEV 231

Query: 346 LSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWT 405
           LSSF FM STPTLFNSGT   QLSSC+LTTVPDDL GI+ +++ENA+L+K++GGLGNDWT
Sbjct: 232 LSSFDFMSSTPTLFNSGTLRSQLSSCYLTTVPDDLDGIYESIKENALLSKFAGGLGNDWT 291

Query: 406 PVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDL 465
            VR LG+HI GTNG+SQGV+PFLKV NDTAVAVNQGGKRKGAVC YLETWH+D+EEFL+L
Sbjct: 292 RVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWHLDIEEFLEL 351

Query: 466 RKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENY 525
           RKNTGDDRRRTHDMNTANWIPDLFM+RV +   WTLFSP  V DLHDL+G EFE AY  Y
Sbjct: 352 RKNTGDDRRRTHDMNTANWIPDLFMRRVMEKGTWTLFSPSNVPDLHDLFGAEFEKAYVAY 411

Query: 526 ERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLC 585
           E +A RGEIK  R + A  LWRKMLTMLFETGHPWITFKD CN+RSPQQH GVVHSSNLC
Sbjct: 412 EEKAARGEIKPSRTVQASDLWRKMLTMLFETGHPWITFKDACNVRSPQQHAGVVHSSNLC 471

Query: 586 TEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEK 645
           TEITLN+S  ETAVCNLGS+NLL H  +   D++KL  TI TA+R+LDNVIDIN + ++K
Sbjct: 472 TEITLNTSDTETAVCNLGSVNLLQHLKDGALDHNKLKRTISTAMRMLDNVIDINYYAVKK 531

Query: 646 AKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQER 705
           A+ SN  HR +GLGLM FQ +L+ L IPYAS  AVE AD+SME IS++A  AS +LA+ER
Sbjct: 532 ARDSNMRHRPVGLGLMAFQDSLYELRIPYASDAAVEFADQSMEAISYYAYWASTDLARER 591

Query: 706 GAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCM 764
           G Y S+KGSLWD+GV P D++ +LA  R   + ++R+S L W+ L+ ++   GMRNSNC+
Sbjct: 592 GKYHSYKGSLWDKGVLPPDTLDMLANARGGYVEVDRSSTLDWNALRNKIAADGMRNSNCV 651

Query: 765 AIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDL 824
           AIAPTATI+NI GV  SI+P + NL VKSN+SG+FTV+NS+LV +LK+  LWD+ M+ DL
Sbjct: 652 AIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVINSYLVRDLKRLGLWDDVMVMDL 711

Query: 825 KYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKK 884
           K+ DGS+  I+R+P ++K+++ATAFE++  WL+E+A+RRQKWIDQAQSLN+Y+   SGKK
Sbjct: 712 KHFDGSLSPIDRVPQEIKQLYATAFEVETRWLVEAAARRQKWIDQAQSLNIYMAGASGKK 771

Query: 885 LDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSC 944
           LD  Y+ AWL GLKTTYYLR+ SAT  EKST   V   L+A+        +   G PSS 
Sbjct: 772 LDETYKLAWLRGLKTTYYLRTMSATHAEKST---VTAGLDALQFRHRPDQSVEAGKPSSV 828


>gi|241589541|ref|YP_002979566.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
 gi|240868253|gb|ACS65912.1| ribonucleoside-diphosphate reductase, alpha subunit [Ralstonia
           pickettii 12D]
          Length = 949

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/948 (55%), Positives = 670/948 (70%), Gaps = 40/948 (4%)

Query: 26  IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKG-------ASRSIRVQDIIKNLTEQ 78
           +    VI+RNG    FD SKI+ A+ KAF+  +  G        S S   ++ ++ LT+ 
Sbjct: 6   VGAYMVIRRNGETVPFDASKIASALAKAFL-YDAHGNLYRPGVVSLSAAQRERVEQLTQA 64

Query: 79  TVTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD 138
               L +  +S+   HIE +QDQVE +LM++G H++ R YVLYRE  S  RA        
Sbjct: 65  VCDALGRRGESSAF-HIEALQDQVELALMRAGEHEVARGYVLYREMASQKRAP------- 116

Query: 139 APIAPKL----KIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLS 194
           AP+A +        M +G +  F+      IVE   +GL+ VS+  +  E  +N+Y+   
Sbjct: 117 APVAGRYDHIKSYRMRNGGVAPFDPSFWIAIVESVVAGLESVSAADLFEEAVRNLYNNAK 176

Query: 195 ESDLETALIFSSRTLIEKEPNYAKVTARFLLE-KLRREVLTTVYKKPQKATHHEMQCLYP 253
           E ++E ALI ++RT IE EP Y K  AR +L  +L  +V        +  T  E+   Y 
Sbjct: 177 EEEIENALILAARTKIEMEPAYTKAAARLVLALQLGHDVFG------KAITFDELASSYG 230

Query: 254 EYFCRYIEEGVKARLLHESMM-DFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS 312
           E F R I+E V A LL + M   FDL  LAN ++ ERD  ++YLG+Q LYDRY LHI+G 
Sbjct: 231 EAFARGIKEAVSAELLADDMTRGFDLQRLANAIRPERDCLWDYLGMQTLYDRYLLHIDGK 290

Query: 313 RIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCF 372
           RIE+PQAF MRVAMGLA  E E+E RA+EFY +LS+F +M STPTLFN+G+   QLSSC+
Sbjct: 291 RIELPQAFLMRVAMGLARNEVEREVRAIEFYEVLSTFDYMASTPTLFNTGSLRSQLSSCY 350

Query: 373 LTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAN 432
           LTT+ DDL GI+  L+ENA+L+K++GGLGNDWT VR LG++I GTNGKSQG++PFLKV N
Sbjct: 351 LTTISDDLEGIYDGLKENALLSKFAGGLGNDWTRVRALGSYIKGTNGKSQGIVPFLKVVN 410

Query: 433 DTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKR 492
           DTAVAVNQGGKRKGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDMNTANWIPDLFMKR
Sbjct: 411 DTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKR 470

Query: 493 VTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTM 552
           V + A WTLFSP++V DLHDLYG +FE  Y++YE  AD G +K F++  AV LWRKML +
Sbjct: 471 VHEGADWTLFSPNDVPDLHDLYGSKFEERYKHYEALADAGTLKHFKRAPAVDLWRKMLGL 530

Query: 553 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFA 612
           LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLN++  E AVCNLGS+NL+AH  
Sbjct: 531 LFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHLV 590

Query: 613 NN-----QFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSAL 667
                    D+ KL  TIR A+R+LDNVID+N + + KA+ SN  HR +GLG+MG+Q AL
Sbjct: 591 KQADGSVALDHVKLRRTIRIAMRMLDNVIDMNFYAVSKARTSNMRHRPVGLGMMGYQDAL 650

Query: 668 HLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIG 727
           ++L IP+ S  AVE +D SME I ++A  AS +LA ERG Y S+ GSLW +G+ P DSI 
Sbjct: 651 YVLGIPFGSEAAVEFSDRSMEAICYYAYEASSDLAVERGVYPSYNGSLWSKGILPFDSID 710

Query: 728 LLAEVRDE--LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPS 785
           LL + R E  L ++R+S + WD L++++   GMRNSNC+AIAPTATI+NI GVS S +P 
Sbjct: 711 LLVQERGEGYLDVDRSSSMDWDALREKIGRQGMRNSNCVAIAPTATISNIVGVSASNEPQ 770

Query: 786 YQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIH 845
           +QNLYVKSN+SG+FT+VN +LV +LK+  +WDE M+SDLK++DGS+  I+R+P D+K  +
Sbjct: 771 FQNLYVKSNLSGEFTLVNEYLVADLKKLGIWDEVMLSDLKFYDGSVQKIDRVPADIKARY 830

Query: 846 ATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRS 905
           ATAFEI+P W +E+ +RRQKWIDQAQSLN+Y+   SGKKLD +Y+ AWL GLKTTYYLR+
Sbjct: 831 ATAFEIEPSWSVEAGARRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRT 890

Query: 906 RSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVC 953
            +ATSVEKST+    G LNAV    P+S   +     S   D E  VC
Sbjct: 891 IAATSVEKSTVP--LGTLNAVA---PSSQMATQQTTQSSEPDVEGRVC 933


>gi|189219088|ref|YP_001939729.1| Oxygen-sensitive ribonucleotide reductase, alpha subunit fused to
           ATP-cone domains [Methylacidiphilum infernorum V4]
 gi|189185946|gb|ACD83131.1| Oxygen-sensitive ribonucleotide reductase, alpha subunit fused to
           ATP-cone domains [Methylacidiphilum infernorum V4]
          Length = 942

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/947 (54%), Positives = 663/947 (70%), Gaps = 29/947 (3%)

Query: 22  FPEKIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQD--IIKNLTEQT 79
           F   +  + ++KR+G V  FDP +I  A+ KAF A  GK    ++  +D   I+ +T   
Sbjct: 11  FDAHLSALSIVKRDGRVVPFDPHRIRAAVEKAFRADRGKNVGEALSSEDRAAIEEITSAV 70

Query: 80  VTRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDA 139
           V++          + +E IQD VE +LM+ G+H + + Y+LYR +R   R  ++      
Sbjct: 71  VSKSAALAGRGERLEVERIQDLVELTLMELGYHTVAKRYILYRADRGRARTIKNRE---- 126

Query: 140 PIAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSS-KIVLSETYKNMYDGLSESDL 198
                + ++   G  +  +   +   + EAC GL++  S + +  ET + +YD + E D+
Sbjct: 127 --GVSIHMIDKQGRKVPLDLAWIHRTLMEACRGLEESCSWRELAEETVRGLYDEIKEEDV 184

Query: 199 ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
             A+I ++R+ +EKEP Y  V AR +L K+  E L+ V    + A +H+       YF  
Sbjct: 185 VQAMILTARSWVEKEPAYTYVAARLMLGKIYEEALSLVPSIHETAEYHKA------YFPS 238

Query: 259 YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
           YI+ GVK   L   +++F+L  LA  L+ ERD  F YLGLQILYDRY LH    RIE PQ
Sbjct: 239 YIDFGVKIGRLSPRLLEFNLEKLAQALRLERDRQFSYLGLQILYDRYLLHHEERRIETPQ 298

Query: 319 AFFMRVAMGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
            F+MRVAMGLAL E E +E  A+ FY+ LS F FM STPTLFNS T HPQLSSC+L TV 
Sbjct: 299 YFWMRVAMGLALNEKEDRELWAIRFYDTLSRFLFMASTPTLFNSATIHPQLSSCYLLTVE 358

Query: 378 DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
           DDL GIF  + +NA L+K++GGLGNDWT VR  G+ I GTNGKSQGVIPFLKVANDTAVA
Sbjct: 359 DDLDGIFKVISDNARLSKWAGGLGNDWTNVRATGSLIRGTNGKSQGVIPFLKVANDTAVA 418

Query: 438 VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
           VNQGGKRKGA+CAYLETWH+D+E+FL+LRKNTGD+RRRTHDMNTANWIPDLFMKRV QN 
Sbjct: 419 VNQGGKRKGALCAYLETWHLDIEDFLELRKNTGDERRRTHDMNTANWIPDLFMKRVLQNG 478

Query: 498 GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
            WTLFSP +V DLH LYGK+FE  Y  YE+ ADRGEIK+F+++SAV LWRKMLT+LFETG
Sbjct: 479 SWTLFSPSDVPDLHHLYGKDFEKRYVEYEQMADRGEIKLFKRVSAVDLWRKMLTLLFETG 538

Query: 558 HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQF 616
           HPWITFKDP NIRSPQ HVGV++SSNLCTEI LN+S EE AVCNLGSINL AH   + + 
Sbjct: 539 HPWITFKDPSNIRSPQDHVGVINSSNLCTEILLNTSPEEVAVCNLGSINLAAHLDESGEI 598

Query: 617 DYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYAS 676
           D  KL  TIR AVR+LDNVIDIN + I +A+ +N  HR +GLG+MGFQ  L++  IPY S
Sbjct: 599 DEKKLQETIRIAVRMLDNVIDINFYPIPEARNANLRHRPVGLGIMGFQDVLYIKKIPYGS 658

Query: 677 PEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDEL 736
            +AVE+AD  ME +S+HAI +S ELA+ERG+YS+FKGS WD+G+ PID+I LL E R+  
Sbjct: 659 EKAVEVADRLMEMVSYHAILSSCELAKERGSYSTFKGSKWDRGLLPIDTIDLLEEQREGF 718

Query: 737 A-MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNM 795
             ++R+    WD ++K++K  G+RNS  +AIAPTATI+NI GV QSI+PSY+NLYVKSN+
Sbjct: 719 VEVDRSQTKDWDYVRKKIKEQGLRNSCLLAIAPTATISNITGVCQSIEPSYKNLYVKSNL 778

Query: 796 SGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMW 855
           SGDF  +N +LV +LK+ +LWD+ MI DLKY+DGS+  IERIP +LK+++ATAFEIDP +
Sbjct: 779 SGDFISINPYLVADLKKLNLWDQEMIDDLKYYDGSVKPIERIPQELKELYATAFEIDPYF 838

Query: 856 LIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
           +IE ASRRQKWID  QSLNLY+DEPSG K+  +Y   W  GLKTTYYLRSR+AT+VEKST
Sbjct: 839 IIECASRRQKWIDMGQSLNLYVDEPSGWKISQMYILCWKKGLKTTYYLRSRAATTVEKST 898

Query: 916 LKGVDGKLNAVPVTDPNSSTHSLGI--------PSSCTSDTECEVCQ 954
           L   D     +      S + S  I         ++C+ D ECE CQ
Sbjct: 899 L---DVNARGIQPRWMKSKSPSANIRVERNEKEKNACSLDPECESCQ 942


>gi|282890381|ref|ZP_06298909.1| hypothetical protein pah_c016o113 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499763|gb|EFB42054.1| hypothetical protein pah_c016o113 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 921

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/927 (55%), Positives = 661/927 (71%), Gaps = 19/927 (2%)

Query: 40  SFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLLQHNKSALIVHIED 97
           SFD  +I  AI KAF A    GA +++   +Q +   +T   ++ +L   +    V IE 
Sbjct: 2   SFDGERIRLAITKAFRAELLLGADQALPEEIQKVTNGITSAVISSILSLTRDE-PVPIEK 60

Query: 98  IQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPKLKIMMDDGTLIS 156
           IQD VE  LMQ G+H++ R Y+LYREER   RA  ++   ++  +   L +   DGT   
Sbjct: 61  IQDLVEKELMQEGYHQVARGYILYREERKRARAFKETAIPANEQVKSTLYVTYPDGTKSP 120

Query: 157 FNSKRLEMIVEEACSGLQDVSS-KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPN 215
            N+++++  +E AC+  +++ + + ++ E  K++YDG+   +L  + IFS+R+ IEKEP 
Sbjct: 121 LNTQKMQSKMEHACADFKELCNPQELIEEMLKHLYDGVLFKELNESAIFSARSKIEKEPA 180

Query: 216 YAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD 275
           Y  V AR LL+ +  EV        Q+    E+  L+  +F +YI +GV A+ L   +  
Sbjct: 181 YNYVAARLLLQDIYNEVFE------QECHPSEVANLHVSHFEQYIRKGVMAKRLTPELFG 234

Query: 276 FDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETE- 334
           +DL  LA +L   RD  F Y+G+Q LYDRY +H+   RIE PQ F+MRVAMGLAL E E 
Sbjct: 235 YDLEKLAQNLDSSRDKLFTYIGVQTLYDRYLIHVKNDRIETPQYFWMRVAMGLALNEKEN 294

Query: 335 KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLA 394
           +E+RA+EFYN+LS FHF+ STPTLFNSG+ HPQLSSC+L+TV DDL  IF  + +NA L+
Sbjct: 295 REERAIEFYNVLSQFHFISSTPTLFNSGSLHPQLSSCYLSTVQDDLVNIFKVIADNASLS 354

Query: 395 KYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLET 454
           K+SGG+GNDWT +R  GA IHGTNG +QGV+PFLKVANDTAVAVNQGGKRKGAVCAYLET
Sbjct: 355 KWSGGIGNDWTNIRATGATIHGTNGLTQGVVPFLKVANDTAVAVNQGGKRKGAVCAYLET 414

Query: 455 WHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLY 514
           WH+D+E+F++LRKNTGD+RRRTHDMNTANWIPDLFMKRV + + WTLF+P +  DLHDLY
Sbjct: 415 WHLDIEDFVELRKNTGDERRRTHDMNTANWIPDLFMKRVREQSVWTLFNPSDTPDLHDLY 474

Query: 515 GKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQ 574
           G EFE  Y  YER A  G+IK+F+ I A+ LWRKM+TMLFETGHPW+TFKDP NIRSPQ 
Sbjct: 475 GIEFEKRYCEYERLAQEGKIKLFKVIPAMDLWRKMITMLFETGHPWMTFKDPSNIRSPQS 534

Query: 575 HVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDN 634
           H GVVHSSNLCTEI LN+S  ETAVCNLGSINL AH   +  D   LA TIRTA+R+LDN
Sbjct: 535 HAGVVHSSNLCTEILLNTSENETAVCNLGSINLAAHIKGDFLDEQFLAKTIRTAMRMLDN 594

Query: 635 VIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHA 694
           VIDIN +  ++A++SN  HR +GLGLMGFQ AL+   I Y S EAVE AD SME IS+HA
Sbjct: 595 VIDINYYPTKEARESNLRHRPVGLGLMGFQDALYHFRIAYDSQEAVEFADASMEMISYHA 654

Query: 695 ISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL-AEVRDELAMNRTSRLPWDELKKRV 753
           I AS ELA+ERG YSS++GS W QG+ PIDSI LL  E +  L M+RTS+  W  ++K +
Sbjct: 655 ILASTELAKERGVYSSYRGSKWSQGILPIDSIALLDNERKGYLHMDRTSKKDWSVVRKEI 714

Query: 754 KTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQR 813
           +  GMRN N MAIAPTATIA+I G+SQSI+P++  LYVKSN+SG+F V+N +LV +LK+R
Sbjct: 715 QKHGMRNCNTMAIAPTATIAHISGLSQSIEPTFSLLYVKSNLSGEFAVLNEWLVKDLKER 774

Query: 814 DLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSL 873
           DLW++ M+ +LKY+DGS+  IE+ P+DLK ++ TAFEI+P WLIE ASRRQKWID  QSL
Sbjct: 775 DLWNQDMLDELKYYDGSVQEIEQFPEDLKGLYKTAFEIEPKWLIECASRRQKWIDMGQSL 834

Query: 874 NLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL----KGVDGK-LNAVPV 928
           NLY++ P G+KL  +Y  AW  GLKTTYYLRS++AT VEKSTL    KG+  + + +   
Sbjct: 835 NLYVNAPDGRKLSDMYLLAWEKGLKTTYYLRSKAATQVEKSTLDINKKGIQPRWMKSRSA 894

Query: 929 TDPNSSTHSLGIPSSCT-SDTECEVCQ 954
           +          IP SC+ S  ECE CQ
Sbjct: 895 SGSIRVERDSSIPKSCSLSGDECESCQ 921


>gi|268316002|ref|YP_003289721.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhodothermus
           marinus DSM 4252]
 gi|262333536|gb|ACY47333.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhodothermus
           marinus DSM 4252]
          Length = 926

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/935 (56%), Positives = 669/935 (71%), Gaps = 34/935 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVE--GKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           V+KR+G   SFD  +I RA+ KAF A       A  S  + + I+ LT   V    +  +
Sbjct: 15  VVKRDGRRVSFDAERIRRALEKAFRATLELPADAPLSAELSEEIEALTGAVV----RWCR 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
               V +E+IQD+VE +LM++G + + R Y+LYRE R++ R  Q           +L   
Sbjct: 71  DRAEVSVEEIQDEVERTLMRAGRYAVARRYILYREARAEARRRQ-----------QLTYR 119

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DGT   F  + L   +E AC GL DV  ++V  E  + +Y G+ E +L+ ALI ++RT
Sbjct: 120 RADGTEAPFPHEALRARIEAACDGLDDVDPELVREELLRTVYPGIPEDELDRALILAART 179

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
            IE+EP+Y  V AR LL+ L REV    + +P   +     C     F  Y+E GV+   
Sbjct: 180 HIEREPDYTYVAARLLLDALYREV----FGRPIPPSEQAEACR--AGFRAYLEHGVRLGR 233

Query: 269 LHESMM-DFDLVYLANDLKYERDFAFEYLGLQILYDRYFLH-INGSRIEMPQAFFMRVAM 326
           L E ++  FD+  LA  L  ERD  F +LGLQ LYDRY LH   G R E+PQ  +MRVAM
Sbjct: 234 LDERLLRTFDIDRLAAALHPERDRRFTFLGLQTLYDRYLLHEPEGRRFELPQYLWMRVAM 293

Query: 327 GLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
           GLAL E +   RA++FY LLSSF FM STPTLFN+GT HPQLSSC+LTTV DDL  IF A
Sbjct: 294 GLALAEDDPTARAIQFYELLSSFRFMNSTPTLFNAGTPHPQLSSCYLTTVQDDLGAIFKA 353

Query: 387 LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
           +++NA+L+K++GGLGNDWTPVR LGAHI GTNG+SQGVIPFLK+ NDTAVAVNQGGKRKG
Sbjct: 354 IRDNALLSKWAGGLGNDWTPVRALGAHIRGTNGRSQGVIPFLKIVNDTAVAVNQGGKRKG 413

Query: 447 AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
           AVCAYLE WH+D+EEFL+LR+NTGD+RRRTHDMNTA WIPDLFM+RV +   WTLFSPDE
Sbjct: 414 AVCAYLEVWHLDIEEFLELRRNTGDERRRTHDMNTACWIPDLFMQRVRERKHWTLFSPDE 473

Query: 507 VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
           V DLHDLYG+ F   YE+YER+A+ G I+ +R+I AVALWRKML+MLFETGHPW+TFKDP
Sbjct: 474 VPDLHDLYGRAFRERYEHYEREAEAGRIRNWRRIEAVALWRKMLSMLFETGHPWLTFKDP 533

Query: 567 CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQFDYDKLASTI 625
           CNIRSPQ HVGVVHSSNLCTEITLN+S EE AVCNLGSINL+AH     + D +KL  TI
Sbjct: 534 CNIRSPQDHVGVVHSSNLCTEITLNTSPEEVAVCNLGSINLVAHVDEQGELDREKLRDTI 593

Query: 626 RTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADE 685
           RTAVR+LDNVID+N + I +A+ SN  HR IGLGLMGFQ  L+   + YAS  AVE+ADE
Sbjct: 594 RTAVRMLDNVIDLNFYPIPEARTSNLRHRPIGLGLMGFQDVLYRRGLSYASEAAVELADE 653

Query: 686 SMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL-AEVRDELAMNRTSRL 744
            MEFI++ A  AS +LA ERGAY +FKGS WD+G+ P+D++ LL AE  + + + RT+RL
Sbjct: 654 FMEFIAYCAYEASSDLAAERGAYPTFKGSKWDRGLLPLDTLDLLEAERGEPVPVPRTARL 713

Query: 745 PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
            WD L+++++  GMRNSN +AIAPTATIANICGVS SI+P+Y+NLYVKSN+SG+FT +N 
Sbjct: 714 DWDALREKIRRQGMRNSNVLAIAPTATIANICGVSPSIEPTYKNLYVKSNLSGEFTQLNP 773

Query: 805 FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
           +LV +LK R LWD+ M+ DLKY+DGS+  I+RIP +LK  + TAFEI+P WLIE A+RRQ
Sbjct: 774 YLVRDLKARGLWDKEMLDDLKYYDGSVQEIDRIPPELKARYRTAFEIEPRWLIECAARRQ 833

Query: 865 KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL----KGVD 920
           KWIDQ+QSLNLYL EPSG+KL  +Y+ AW +GLKTTYYLR+ +AT +EKSTL    +G+ 
Sbjct: 834 KWIDQSQSLNLYLAEPSGRKLSEMYQLAWQLGLKTTYYLRALAATQIEKSTLDINRRGIQ 893

Query: 921 GKLNAVPVTDPNSSTHSLGIPSSCTSDTE-CEVCQ 954
            +   +    P+S         +C+ D E CE CQ
Sbjct: 894 PRW--MKSRSPSSDIVVRRDGPACSPDDESCEACQ 926


>gi|87311396|ref|ZP_01093516.1| ribonucleotide-diphosphate reductase alpha subunit [Blastopirellula
           marina DSM 3645]
 gi|87285808|gb|EAQ77722.1| ribonucleotide-diphosphate reductase alpha subunit [Blastopirellula
           marina DSM 3645]
          Length = 973

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/948 (53%), Positives = 661/948 (69%), Gaps = 29/948 (3%)

Query: 28  GVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIR--VQDIIKNLTEQTVTRLLQ 85
            ++V KR+G + SFD  +I  AI KAF A  G    + +   ++D +K+++E  + ++  
Sbjct: 34  ALEVRKRDGRIISFDVGRIHYAIGKAFRAEIGVADGQELENSLEDQVKSISEAVIDQIES 93

Query: 86  HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
              S   V +E IQD VE  LM+ GH  + R Y+LYREE + +RA ++       I P++
Sbjct: 94  RPFSRDGVDVESIQDAVEIQLMRHGHFSVARRYILYREEHAKLRALRAADSDGNLIPPRI 153

Query: 146 KIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIF 204
            +  +DG    F++ RL   V  A  GL Q+ S++ ++ ETY+++YDG++  ++  A+I 
Sbjct: 154 NVKQEDGAKEPFDATRLRRRVYSAVRGLEQNCSAEELVEETYRSLYDGITPQEIYRAMIL 213

Query: 205 SSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKA--THHEMQCLYPEYFCRYIEE 262
           +SR+ IE++P+Y KV AR +L  +  E +  ++ K   A  T  E        F  YI  
Sbjct: 214 ASRSRIERDPDYDKVAARLMLMVIYNEAIGRLHPKEDIAEVTRRE--------FSTYIST 265

Query: 263 GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
           G++A  L E + DFDL  ++  L+ ERD AF YLGLQ +YDRY LHI+G RIE PQ F+M
Sbjct: 266 GIEAGRLAERLRDFDLEKISAALRPERDAAFPYLGLQTIYDRYLLHIDGRRIETPQYFWM 325

Query: 323 RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
           RVAMGLA  E  KE+RA+EFYN+LS+F F  +TPTLFNSGT HPQLSSC+L+TV DDL  
Sbjct: 326 RVAMGLAWNEENKEERAIEFYNILSTFRFTSATPTLFNSGTLHPQLSSCYLSTVDDDLEH 385

Query: 383 IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
           IF  + +NAML+K++GGLGNDWT +R   AHI GTNG+SQGVIPFLKV NDTA+AVNQGG
Sbjct: 386 IFKVVSDNAMLSKWAGGLGNDWTNIRATNAHIKGTNGQSQGVIPFLKVVNDTAIAVNQGG 445

Query: 443 KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
           KRKGAVC+YLE+WH+DVEEFLDLRKNTGDDRRRTHDM+TANWIPDLFMKRV +NA WTLF
Sbjct: 446 KRKGAVCSYLESWHLDVEEFLDLRKNTGDDRRRTHDMHTANWIPDLFMKRVRENADWTLF 505

Query: 503 SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
           SPDE  DLHDL G +F+  YE YE+ AD G++++FR++ A  LWRKMLT LFETGHPWIT
Sbjct: 506 SPDETPDLHDLCGSKFQARYEEYEKLADEGKMRLFRRLPANELWRKMLTRLFETGHPWIT 565

Query: 563 FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
           +KDP N+RSPQ HVGVVHSSNLCTEI LN+S +E AVCNLGSINL+AH  N + D +KL 
Sbjct: 566 WKDPSNVRSPQDHVGVVHSSNLCTEILLNTSKDEIAVCNLGSINLVAHIRNGELDLEKLQ 625

Query: 623 STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
            T+ TA R+LDNVIDIN +   +AK SN  HR +G+GLMGFQ AL  L + YAS EAVE 
Sbjct: 626 ETVTTAARMLDNVIDINYYPTGEAKTSNARHRPVGMGLMGFQDALSSLGVSYASQEAVEF 685

Query: 683 ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRT 741
           AD SME IS+ AI AS +LA ERG Y ++ GS WD+G+ PIDS+ +L + R   + ++R+
Sbjct: 686 ADRSMEAISYFAILASSQLAAERGTYETYAGSKWDRGILPIDSLDILEQERGLPIEVDRS 745

Query: 742 SRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTV 801
           S L W  ++  V+  GMRNSN MAIAPTATI+ I GVSQSI+P+Y+NL+VKSN+SG+F  
Sbjct: 746 STLDWQVVRDSVREHGMRNSNVMAIAPTATISTIVGVSQSIEPTYKNLFVKSNLSGEFPQ 805

Query: 802 VNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESAS 861
           +N  +V +LK   LWD  M+  +KY+DG +  I+R+PD LK  + TAFE+D  WLIE  +
Sbjct: 806 LNIRMVQDLKAEGLWDSDMVEAIKYYDGELTEIDRVPDHLKLRYLTAFEVDSKWLIECGA 865

Query: 862 RRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK---- 917
           RRQKWID  QSLNLY+ +PSG+KL  +Y  AW +GLKTTYYLR+ SAT VEKST+     
Sbjct: 866 RRQKWIDMGQSLNLYMAQPSGRKLHDMYMLAWNVGLKTTYYLRTLSATQVEKSTIDVNRF 925

Query: 918 GV------DGKLNAVPVTDPNSSTHSLG-----IPSSCTSDTECEVCQ 954
           G+      +   +A    D   +   L       P +C  D +CE CQ
Sbjct: 926 GIQPRWMKNASASADIRVDRGDAAEILDELPPEQPKACNLDGDCESCQ 973


>gi|325110862|ref|YP_004271930.1| ribonucleoside-diphosphate reductase, subunit alpha [Planctomyces
           brasiliensis DSM 5305]
 gi|324971130|gb|ADY61908.1| ribonucleoside-diphosphate reductase, alpha subunit [Planctomyces
           brasiliensis DSM 5305]
          Length = 953

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/893 (55%), Positives = 648/893 (72%), Gaps = 13/893 (1%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIR--VQDIIKNLTEQTVTRLLQHNK 88
           V KR+G + SFD ++I RA+  AF A      S+ +   V  +I+ ++++   ++     
Sbjct: 10  VRKRDGRIASFDMNRIGRAMENAFRAELNLADSQPLDEDVISVIRQISDEVGNQIAPSAS 69

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHS--KSDAPIAPKLK 146
           S   V +E++QD VE  LM+ GH+++ R Y++YR E + +RA +       + P   +  
Sbjct: 70  SRQGVDVEELQDAVEMLLMKHGHYRVARRYIVYRAEHAKLRALRGEEGFADEGPERVQTN 129

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALIFS 205
           + +DDGTL+ F+  R+   ++ AC GL+D+ S++ +  E  K++YDG++  ++  A+I +
Sbjct: 130 VTLDDGTLVPFDPNRIMTKLQLACRGLEDICSAEDLHEEVLKSIYDGITTKEIYRAMILA 189

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           SR+ IE++P Y KV  R +L+ +  + L +    P+K     +  +Y   F  YI +G+ 
Sbjct: 190 SRSRIERDPAYDKVAGRLMLDVIYHDALGSA-PSPKK-----LASVYRHQFEHYIIDGIA 243

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
           A  L   + DF+L  +A+ L+  RD  F+YLGLQ +YDRY +HI+G RIE PQ F+MRVA
Sbjct: 244 AERLSPGLRDFNLTQIADALEPSRDALFQYLGLQTIYDRYLIHIDGRRIEAPQFFWMRVA 303

Query: 326 MGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           MGLA+ E E KE+RA++FYN+LSSF F  +TPTLFNS T HPQLSSC+L+TV DDL  IF
Sbjct: 304 MGLAVNEGEQKEERAIQFYNMLSSFRFTSATPTLFNSATLHPQLSSCYLSTVSDDLEHIF 363

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
             + +NA L+K++GGLGNDWT +R   AHIHGTNG+SQGVIPFLKV NDTAVAVNQGGKR
Sbjct: 364 KVISDNAKLSKWAGGLGNDWTNIRATNAHIHGTNGQSQGVIPFLKVVNDTAVAVNQGGKR 423

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LRKNTGDDRRRTHDM+TANWIPDLFMKRV  N  WTLFSP
Sbjct: 424 KGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMHTANWIPDLFMKRVEANDEWTLFSP 483

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           DEV DLHDL GKEFE  Y  YE+ A+ GE+ + RK++AV LWRKMLT LFETGHPWIT+K
Sbjct: 484 DEVPDLHDLTGKEFENRYLEYEKMAEDGEMGLTRKVNAVELWRKMLTRLFETGHPWITWK 543

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DP N+RSPQ H GVVHSSNLCTEI LN+S  ETAVCNLGSINL  H  +   +   L  T
Sbjct: 544 DPSNVRSPQDHCGVVHSSNLCTEILLNTSPTETAVCNLGSINLKTHIVDGALNLQMLEET 603

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           + TA+R+LDNVIDIN +  E+A  +N  HR +G+GLMGFQ AL  + + Y  PEAVE AD
Sbjct: 604 VFTAMRMLDNVIDINYYPTEEAANANKRHRPVGMGLMGFQDALLAMDLSYTCPEAVEFAD 663

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSR 743
            SME IS+ AI AS +LA ERG YSS++GS WD+G+ PID++ LL E R + + ++R+S 
Sbjct: 664 RSMEAISYFAILASSQLAAERGRYSSYEGSKWDRGLLPIDTLDLLEEARGQAIEVDRSSS 723

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L WD ++K V   GMRNSNCMAIAPTATI+ I GVSQSI+PSY++LYVKSN+SG+FT VN
Sbjct: 724 LDWDVVRKSVAENGMRNSNCMAIAPTATISTIIGVSQSIEPSYKHLYVKSNLSGEFTQVN 783

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
           S LV ELK R LWD  M+  LKY+DG++ +I+R+P D+K+ + TAFE+DP WL+E A+RR
Sbjct: 784 SVLVTELKSRGLWDSDMLDALKYYDGTLADIDRVPADIKERYQTAFEVDPYWLVECAARR 843

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           QKW+D  QSLNLY+  P+GK+L  +Y  AW  GLKTTYYLR+ +AT VEKST+
Sbjct: 844 QKWLDMGQSLNLYMQAPNGKRLHDMYFDAWKKGLKTTYYLRTLAATQVEKSTV 896


>gi|149173740|ref|ZP_01852369.1| ribonucleotide-diphosphate reductase alpha subunit [Planctomyces
           maris DSM 8797]
 gi|148847270|gb|EDL61604.1| ribonucleotide-diphosphate reductase alpha subunit [Planctomyces
           maris DSM 8797]
          Length = 949

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/949 (53%), Positives = 656/949 (69%), Gaps = 34/949 (3%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMA----VEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
           V KR G    FD S I RAI  AF A     + +     IR++  I  + E     +   
Sbjct: 10  VTKRGGRTAPFDASLIGRAISNAFRAELNLADNQPLDDEIRME--IPEMVESVANEIASA 67

Query: 87  NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS------HSKSDAP 140
             +   V +E IQD VE  LM+ GH++I R Y++YR ER+ +RA +        S+S   
Sbjct: 68  ASTDAGVEVEKIQDVVEMMLMRRGHYRIARRYIVYRAERAKLRALRGSSDLVEESESIKS 127

Query: 141 IAPKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLE 199
             P+  +++ DGT + F+  R+   + +AC GL+ D S++ +L E  ++++DG+S  +L 
Sbjct: 128 TTPRFHVVLTDGTKVPFDEARILARLSDACRGLEGDCSAEALLEEVMRSIFDGISVEELY 187

Query: 200 TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRY 259
            A+I ++RT IE++P Y  V +R +L+ +  + L      P     +E+  LY + F ++
Sbjct: 188 RAMILAARTRIERDPAYDTVASRLMLKIIYNDALGNA---PSDV--NELNQLYVDRFPKF 242

Query: 260 IEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQA 319
           +E+G+ A+ L   +  FDL  +A  L+ +RD  F+YLGLQ ++DRY LHI G RIE PQ 
Sbjct: 243 LEDGIAAKRLTPDLHKFDLNRIALALEPKRDHLFQYLGLQAIFDRYLLHIGGRRIETPQY 302

Query: 320 FFMRVAMGLALKET-EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
           F+MRV+MGLA++E  +   RA+EFYN+LSSF F  +TPTLFNS T HPQLSSC+L+TV D
Sbjct: 303 FWMRVSMGLAIQEEGDATGRAIEFYNILSSFRFTSATPTLFNSATLHPQLSSCYLSTVND 362

Query: 379 DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
           DL  IF  + +NA L+K++GGLGNDWT +R   +HI GTNG+SQGVIPFLKV NDTAVAV
Sbjct: 363 DLDHIFKCVADNAKLSKWAGGLGNDWTQIRATNSHISGTNGQSQGVIPFLKVVNDTAVAV 422

Query: 439 NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
           NQGGKRKGAVC+YLETWH+DVEEFLDLRKNTGDDRRRTHDM+TANWIPDLFM+RV ++A 
Sbjct: 423 NQGGKRKGAVCSYLETWHMDVEEFLDLRKNTGDDRRRTHDMHTANWIPDLFMRRVREDAE 482

Query: 499 WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
           WTLFSP++V DLHDLYG +FE  Y  YER  + GEIK+FR+ISAV LWRKMLT LFETGH
Sbjct: 483 WTLFSPNDVPDLHDLYGHDFEKRYAEYERMTETGEIKLFRRISAVELWRKMLTRLFETGH 542

Query: 559 PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
           PWIT+KD  N+RSPQ HVGVVHSSNLCTEI LN+S +ETAVCNLGS+NL  H  + Q D 
Sbjct: 543 PWITWKDASNLRSPQDHVGVVHSSNLCTEILLNTSRDETAVCNLGSVNLKLHIVDGQLDL 602

Query: 619 DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
             L  T+RTA+R+LDNVIDIN +   +A+ SN  HR +GLG+MGFQ AL    I YAS +
Sbjct: 603 GMLEETVRTAMRMLDNVIDINYYPTPEARNSNTKHRPVGLGIMGFQDALLAQGISYASMQ 662

Query: 679 AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELA 737
           AVE AD SME IS+ AI AS ELA ERG Y S+ GS WD+G+ PID++ L  + R   + 
Sbjct: 663 AVEFADASMEAISYFAILASSELAGERGRYGSYTGSKWDRGLLPIDTLDLYEKERGIPVE 722

Query: 738 MNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSG 797
           ++R +RL W  ++  +   GMRNSN MAIAPTATI+ I GVSQSI+PSY++LYVKSN+SG
Sbjct: 723 VDRQARLDWQVVRNSIAANGMRNSNVMAIAPTATISTIIGVSQSIEPSYKHLYVKSNLSG 782

Query: 798 DFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLI 857
           +FT VN  LV++LK  DLWD  M+  LKY+DGS+  IERIPD+LK  + TAFE++P W I
Sbjct: 783 EFTQVNRQLVDDLKAVDLWDADMLESLKYYDGSVQEIERIPDELKARYLTAFEVEPKWTI 842

Query: 858 ESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK 917
           E A+ RQKWID  QSLNLYL EPSGKKL  +Y  AW  GLKTTYYLR+ +AT VEKST+ 
Sbjct: 843 ECAAHRQKWIDMGQSLNLYLAEPSGKKLHEMYMLAWERGLKTTYYLRTLAATQVEKSTVD 902

Query: 918 ----GVDGKL--NAVPVTD------PNSSTHSLGIPSSCTSDTECEVCQ 954
               G+  +   NA    D      P ++  + G   SC  D +CE CQ
Sbjct: 903 VNKFGIQPRWMKNASASGDIQVDREPAATMVTPG--ESCNLDGDCEACQ 949


>gi|15834834|ref|NP_296593.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Nigg]
 gi|270285000|ref|ZP_06194394.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Nigg]
 gi|270289023|ref|ZP_06195325.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum Weiss]
 gi|301336398|ref|ZP_07224600.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            muridarum MopnTet14]
 gi|14195148|sp|Q9PL93|RIR1_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|7190252|gb|AAF39086.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydia
            muridarum Nigg]
          Length = 1047

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/941 (52%), Positives = 641/941 (68%), Gaps = 22/941 (2%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + VI+R G    F+P KIS A+ KAF A +         V++ +  LT++ V  + + 
Sbjct: 116  QSLSVIRRCGTTVHFNPMKISAALEKAFRATDRIEGMTPDFVREEVNALTQKIVAEIEER 175

Query: 87   -NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSK--SDAPIAP 143
             ++    + IE IQD VE  LM  GH+   + Y+LYRE R+ VR  +   +   +AP   
Sbjct: 176  CSQQDSRIDIEQIQDIVEQQLMVVGHYATAKNYILYREARARVRDNRVEDQIVEEAPSEE 235

Query: 144  KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETAL 202
              +++  DG+       +L   +  ACS   + +   +L++  + N Y G+ ES++  A 
Sbjct: 236  TFEVLSKDGSTYMITHSQLLARLARACSRFPETTDAALLTDMAFSNFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEE 262
            I ++R  IEKEP+YA V A  LL+ + +E L       +     +++ +Y ++F RYI E
Sbjct: 296  IMAARANIEKEPDYAFVAAELLLDVVYKEALD------RSRGDEDLEQVYRDHFKRYIME 349

Query: 263  GVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFM 322
            G   RL  E    FDL  LAN +   RD  F Y+G+Q LYDRYF H +G R+E PQ F+M
Sbjct: 350  GDSYRLNPELKNLFDLDALANAMDLSRDLQFSYMGIQNLYDRYFNHDDGRRLETPQIFWM 409

Query: 323  RVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            RVAMGLALKE +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 410  RVAMGLALKEQDKTYWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVN 469

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT +R  GA I GTNGKSQGVIPF+KV NDTAVAVNQGG
Sbjct: 470  IYKVISDNAMLSKWAGGIGNDWTAIRATGALIKGTNGKSQGVIPFIKVTNDTAVAVNQGG 529

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGAVC YLE WH+D E+FL+LRKNTGDDRRR HD+NTA+WIPDLF KR+ Q   WTLF
Sbjct: 530  KRKGAVCVYLEVWHLDYEDFLELRKNTGDDRRRAHDVNTASWIPDLFFKRLQQKGSWTLF 589

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LHD YG+EFE  YE YER+ D GEI++++K+ A  LWRKML+MLFETGHPW+T
Sbjct: 590  SPDDVPGLHDAYGEEFERLYEEYERKVDSGEIRLYKKVEAEDLWRKMLSMLFETGHPWMT 649

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  ++  D +KL+
Sbjct: 650  FKDPSNIRSAQDHTGVVRCSNLCTEILLNCSETETAVCNLGSVNLVQHILDDGLDEEKLS 709

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE 
Sbjct: 710  ETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEF 769

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DELAMNR 740
            AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R  D L M+ 
Sbjct: 770  ADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGKDNLQMDT 829

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            + R  W+ ++  ++  GMRN   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 830  SVRKDWEPIRSLIREHGMRNCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 889

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+ +LK+  +WD  M+ DLKY DGS+  IER+PD +K I  TAFEI+P W++E A
Sbjct: 890  IPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERVPDHIKHIFLTAFEIEPEWILECA 949

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
            SRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS    VD
Sbjct: 950  SRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF---VD 1006

Query: 921  GKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
                 +      + + S GI          C+ +  CEVCQ
Sbjct: 1007 INKRGIQPRWMKNKSASAGIVVERASKTPVCSLEEGCEVCQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   +++ I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLENSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+YV+YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYINGLQDVARDYVVYRDDRKAHREKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT + FN  ++   +E+A
Sbjct: 118 LSVIRRCGTTVHFNPMKISAALEKA 142


>gi|166154171|ref|YP_001654289.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 434/Bu]
 gi|166155046|ref|YP_001653301.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis L2b/UCH-1/proctitis]
 gi|301335415|ref|ZP_07223659.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis L2tet1]
 gi|165930159|emb|CAP03643.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis 434/Bu]
 gi|165931034|emb|CAP06597.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis L2b/UCH-1/proctitis]
          Length = 1047

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/942 (52%), Positives = 640/942 (67%), Gaps = 24/942 (2%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQH 86
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  + + 
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 87   -NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPIAPK 144
             ++    + IE IQD VE  LM  GH+ I + Y+LYRE R+ VR  +    S +  IA +
Sbjct: 176  CSQQDRRIDIEKIQDIVEQQLMVVGHYAIAKNYILYREARARVRDNREEDGSTEKTIAEE 235

Query: 145  -LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETAL 202
              +++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++  A 
Sbjct: 236  AFEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLAC 295

Query: 203  IFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCRYIE 261
            I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F RYI 
Sbjct: 296  IMAARANIEKEPDYALVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKRYIA 348

Query: 262  EGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFF 321
            EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ F+
Sbjct: 349  EGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQIFW 408

Query: 322  MRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY 381
            MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL 
Sbjct: 409  MRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLV 468

Query: 382  GIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQG 441
             I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAVNQG
Sbjct: 469  NIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQG 528

Query: 442  GKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTL 501
            GKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+NTA+WIPDLF KR+ Q   WTL
Sbjct: 529  GKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNTASWIPDLFFKRLQQKGTWTL 588

Query: 502  FSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWI 561
            FSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+M+FETGHPW+
Sbjct: 589  FSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMVFETGHPWM 648

Query: 562  TFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKL 621
            TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D +KL
Sbjct: 649  TFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKL 708

Query: 622  ASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVE 681
            + TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS EAVE
Sbjct: 709  SETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVE 768

Query: 682  IADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMN 739
             AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L M+
Sbjct: 769  FADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMD 828

Query: 740  RTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDF 799
             +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+F
Sbjct: 829  TSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEF 888

Query: 800  TVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIES 859
            T+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+IE 
Sbjct: 889  TIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIEC 948

Query: 860  ASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGV 919
            ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS    V
Sbjct: 949  ASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF---V 1005

Query: 920  DGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
            D     +      + + S GI          C+ +  CE CQ
Sbjct: 1006 DINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|237798940|ref|ZP_04587401.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|237806193|ref|ZP_04592897.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331021794|gb|EGI01851.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331027306|gb|EGI07361.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 748

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/752 (62%), Positives = 571/752 (75%), Gaps = 22/752 (2%)

Query: 221 ARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVY 280
           AR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  LL+  + +FDL  
Sbjct: 1   ARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFELLNPVLAEFDLEK 59

Query: 281 LANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAV 340
           L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGLA++E  +E RA+
Sbjct: 60  LGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGLAIEEKAREDRAI 119

Query: 341 EFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGL 400
           EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ +NAML+K++GGL
Sbjct: 120 EFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIHDNAMLSKFAGGL 179

Query: 401 GNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVE 460
           GNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAVCAYLETWH+D+E
Sbjct: 180 GNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHMDIE 239

Query: 461 EFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEI 520
           EF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV DLHDL GK F+ 
Sbjct: 240 EFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVPDLHDLTGKAFQE 299

Query: 521 AYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVV 579
            YE YE   +  G++K+F+ I A  LWRKML+MLFETGHPW+TFKDPCN+RSPQQHVGVV
Sbjct: 300 RYEYYEALTEYPGKVKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVV 359

Query: 580 HSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDIN 639
           HSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  AVR+LDNVIDIN
Sbjct: 360 HSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDVAVRMLDNVIDIN 419

Query: 640 CHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASV 699
            +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SME +S++AI AS 
Sbjct: 420 YYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSMEAVSYYAIQASC 479

Query: 700 ELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLPWDELKKRVKTIG 757
           +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L W  ++ RV+  G
Sbjct: 480 DLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLDWAPVRARVQK-G 538

Query: 758 MRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWD 817
           +RNSN MAIAPTATIANI GVSQSI+P+YQNLYVKSN+SG+FTV+N +LV +LK RDLWD
Sbjct: 539 IRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARDLWD 598

Query: 818 EAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYL 877
             MI+DLKY+DGS+  IERIP +LK+++ATAFE+D  W++++ASRRQKWIDQAQSLNLY+
Sbjct: 599 SVMINDLKYYDGSVQQIERIPQELKELYATAFEVDTKWIVDAASRRQKWIDQAQSLNLYI 658

Query: 878 DEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHS 937
              SGKKLD  YR AW  GLKTTYYLR+ +ATS EKST+    GKLNAV          +
Sbjct: 659 AGASGKKLDVTYRMAWYRGLKTTYYLRALAATSTEKSTVN--TGKLNAVSSGGHGPDDSA 716

Query: 938 LGIP--------------SSCTSD-TECEVCQ 954
           +  P               +C  D  +CE CQ
Sbjct: 717 ITAPRPTEAAPAGPAPVPKACAIDEPDCEACQ 748


>gi|297748956|gb|ADI51502.1| Ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis D-EC]
 gi|297749836|gb|ADI52514.1| Ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis D-LC]
          Length = 1053

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/945 (52%), Positives = 640/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 122  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 181

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 182  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 238

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 239  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 298

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F R
Sbjct: 299  LACIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKR 351

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ
Sbjct: 352  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQ 411

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 412  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 471

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 472  NLVNIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 531

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 532  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 591

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 592  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 651

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 652  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 711

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 712  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 771

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 772  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 831

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 832  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 891

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 892  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 951

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 952  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1010

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1011 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1053



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 13  KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 72

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 73  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 123

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 124 LSVVRRCGTVVHFNPMKISAALEKA 148


>gi|296436382|gb|ADH18556.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/9768]
 gi|296438241|gb|ADH20402.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/11074]
 gi|297140742|gb|ADH97500.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/9301]
          Length = 1047

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/945 (52%), Positives = 640/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGVWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|15605562|ref|NP_220348.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis D/UW-3/CX]
 gi|237803259|ref|YP_002888453.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis B/Jali20/OT]
 gi|255311667|ref|ZP_05354237.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 6276]
 gi|255317968|ref|ZP_05359214.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 6276s]
 gi|7388066|sp|O84834|RIR1_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|6578115|gb|AAC68424.2| Ribonucleoside Reductase, Large Chain [Chlamydia trachomatis
            D/UW-3/CX]
 gi|231274493|emb|CAX11289.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis B/Jali20/OT]
 gi|296437313|gb|ADH19483.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis G/11222]
          Length = 1047

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/945 (52%), Positives = 640/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|237805180|ref|YP_002889334.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis B/TZ1A828/OT]
 gi|231273480|emb|CAX10396.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis B/TZ1A828/OT]
          Length = 1047

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/945 (52%), Positives = 640/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAIEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  L++ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLIDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|76789572|ref|YP_328658.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis A/HAR-13]
 gi|76168102|gb|AAX51110.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis A/HAR-13]
          Length = 1047

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/945 (52%), Positives = 640/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  L++ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLIDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H  G R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT +R  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|89898044|ref|YP_515154.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            felis Fe/C-56]
 gi|89331416|dbj|BAE81009.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydophila felis
            Fe/C-56]
          Length = 1045

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/944 (52%), Positives = 641/944 (67%), Gaps = 34/944 (3%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI--------IKNLTEQTV 80
            V V++R+G +  F+P KIS A+ KAF A        ++++ D+        I NLT + V
Sbjct: 118  VSVMRRDGNLVRFNPMKISAALEKAFRA--------TLKITDVLLQEILSEINNLTNKIV 169

Query: 81   TRLLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAP 140
               L        + IE IQD VE  LM +GH+ + + Y+LYRE RS +R  +        
Sbjct: 170  EETLAKCSREQTIDIEAIQDIVETQLMIAGHYDVAKNYILYREARSRIREHKQEIAVQEE 229

Query: 141  IAPKL-KIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDL 198
            I  ++  ++  DGT    N  +L      AC      ++   L++  + N Y G+ ES++
Sbjct: 230  IVEEVYDVVKSDGTTYQINKAQLTEKFVWACRRFPKTTNPHTLADMAFANFYSGIKESEI 289

Query: 199  ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
              A I ++R  IEKEP+YA V A  LL+ + +E +            H+      +YF +
Sbjct: 290  VLACIMAARANIEKEPDYAYVAAELLLDVVCQEAIGKSIMDADLVEAHK------QYFKQ 343

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI +G + RL +  + ++DL  LA  L   RD  F Y+G+Q LYDRY     G R+E  Q
Sbjct: 344  YILDGDQYRL-NPRLKEYDLDALAEALDISRDHQFSYMGVQTLYDRYLNQYEGRRLETTQ 402

Query: 319  AFFMRVAMGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVP 377
             F+MRV+MGLAL E E K   A+ FYNLLSSF +  +TPTLFNSG RH QLSSC+L+TV 
Sbjct: 403  IFWMRVSMGLALNEGEDKTSWAITFYNLLSSFRYTPATPTLFNSGMRHSQLSSCYLSTVQ 462

Query: 378  DDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVA 437
            DDL  I+  + +NAML+K++GG+GNDWT VR  G+ I GTNGKS GVIPF+KVANDTAVA
Sbjct: 463  DDLAHIYKVISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSHGVIPFIKVANDTAVA 522

Query: 438  VNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNA 497
            VNQGGKRKGA C YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q  
Sbjct: 523  VNQGGKRKGATCVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQKG 582

Query: 498  GWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETG 557
             WTLFSPD+V  LH+ YG EF+  YE YER+ D GEIK+++KI A  LWRKML+ML+ETG
Sbjct: 583  TWTLFSPDDVPGLHEAYGFEFDKLYEEYERKVDTGEIKLYKKIPAEDLWRKMLSMLYETG 642

Query: 558  HPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFD 617
            HPWITFKDP NIRS Q H GVV  SNLCTEI LNSS  ETAVCNLGS+NL+ H  N   D
Sbjct: 643  HPWITFKDPSNIRSAQDHAGVVRCSNLCTEILLNSSESETAVCNLGSVNLVEHIKNGDID 702

Query: 618  YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
             + L  TI  A+R+LDNVIDIN +  ++A  +N THRA+GLG+MGFQ AL+ L+I YASP
Sbjct: 703  EEMLGETISIAIRILDNVIDINFYPTQEAANANLTHRAVGLGMMGFQDALYKLNISYASP 762

Query: 678  EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR--DE 735
            EAVE AD+S E I+++A+ +S  LA+ERG YSS+KGS WD+G  PID+I LL E R  D+
Sbjct: 763  EAVEFADKSSELIAYYALLSSSLLAKERGTYSSYKGSKWDRGYLPIDTIELLKEYRGEDK 822

Query: 736  LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNM 795
            L M+ + R  W  +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+
Sbjct: 823  LLMDTSCRKDWAPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNL 882

Query: 796  SGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMW 855
            SG+FT+ N +L+ +LKQ  LWD  M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P W
Sbjct: 883  SGEFTIPNVYLIEKLKQLGLWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEW 942

Query: 856  LIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST 915
            LIE ASRRQKW+D  QS+NLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS 
Sbjct: 943  LIECASRRQKWLDMGQSVNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSF 1002

Query: 916  LKGVDGKLNAVPVTDPNSSTHSLGIPSS-----CTSDTECEVCQ 954
            +      +    + + ++ST S+ +  +     C+ +  CE CQ
Sbjct: 1003 IDINKRGIQPRWMKNKSAST-SIVVERTRETPVCSLEEGCESCQ 1045



 Score = 68.9 bits (167), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 15/173 (8%)

Query: 31  VIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLLQHNK 88
           ++KRNG    F+  +I +A+  AF        +  +   ++  I ++T Q V  ++Q  +
Sbjct: 11  IVKRNGMFVPFNQDRIFQALEAAFRDTRSLEDTSPLPKDLEKSISSITRQVVNEVVQKIR 70

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
              +V +E IQD VE  L  SG   + R Y++YR++  + R    HS S         +M
Sbjct: 71  EGQVVTVERIQDMVENQLYVSGMQDVARNYIIYRDQHKERRKGSWHSVS---------VM 121

Query: 149 MDDGTLISFNSKRLEMIVEEACSG---LQDVSSKIVLSETYKNMYDGLSESDL 198
             DG L+ FN  ++   +E+A      + DV  + +LSE   N+ + + E  L
Sbjct: 122 RRDGNLVRFNPMKISAALEKAFRATLKITDVLLQEILSEI-NNLTNKIVEETL 173


>gi|297621806|ref|YP_003709943.1| ribonucleoside-diphosphate reductase alpha subunit [Waddlia
           chondrophila WSU 86-1044]
 gi|297377107|gb|ADI38937.1| ribonucleoside-diphosphate reductase alpha subunit [Waddlia
           chondrophila WSU 86-1044]
          Length = 918

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/935 (51%), Positives = 638/935 (68%), Gaps = 31/935 (3%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           + + V KR+  +T F+P +I  AI  AF  V    +  ++    Q II  + E  + ++ 
Sbjct: 8   QKISVRKRDKQITPFNPERIKNAISSAFRDVWNLQSYHTLDKAQQVIIGQVFEAVIEKIR 67

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                   + +E IQD VE  LM+  H+K+ + Y+LYRE R+  R  +         AP 
Sbjct: 68  CEKPFDTPIDVERIQDYVELILMRQEHYKVAKSYILYRENRAKARQQKEEE------APA 121

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDV-SSKIVLSETYKNMYDGLSESDLETALI 203
           +++ + +G  ++++ ++L++ ++ +C   + + SS+ ++      ++D +S   +  A I
Sbjct: 122 IRVKLINGDSVAYSQEKLKLSLKRSCQDFEPLCSSEELMKAIEPQLFDRISSEQIRQAAI 181

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            ++++LIEKEP Y KV A  LL+K+ RE+ +  +                  F  YI++G
Sbjct: 182 LAAKSLIEKEPAYDKVAANILLQKIYREIESLPFSN----------------FSSYIQKG 225

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           V+A+ LH  ++ FD   L   +++ERD  F Y GLQ LYDRY + I+    E+PQ F+MR
Sbjct: 226 VEAKRLHSDLLGFDHRLLEEAMEHERDRQFSYQGLQTLYDRYLIRISEQVAELPQFFWMR 285

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           V+MGLAL ET+K  +AVEFY++LSSF ++ STPTLFNSGT HPQLSSC+L+TV DDL  I
Sbjct: 286 VSMGLALNETDKNSKAVEFYHVLSSFDYISSTPTLFNSGTCHPQLSSCYLSTVQDDLNDI 345

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           F  + ++A L+K++GG+GNDWT VR   AHI+GTNGKSQGVIPFLKV NDTAVAVNQGGK
Sbjct: 346 FRVISDDAKLSKWAGGIGNDWTNVRATQAHINGTNGKSQGVIPFLKVVNDTAVAVNQGGK 405

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGA+C YLETWH+D+ EFLDLRKNTGDDRRRTHDM+TANWIPDLFMKRV ++  WTLFS
Sbjct: 406 RKGAICCYLETWHLDLPEFLDLRKNTGDDRRRTHDMHTANWIPDLFMKRVEEDGEWTLFS 465

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           PDEV DLHDLYG+ F+  YE+YER+A  G+IK +R   A+ LWRKML+ LFETGHPWIT+
Sbjct: 466 PDEVPDLHDLYGRAFDKRYEHYEREAKAGKIKQYRTFKAIDLWRKMLSRLFETGHPWITW 525

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAS 623
           KDP NIR  Q+H GV+HSSNLCTEI L +S EETAVCNLGS+NL  H    + D   L  
Sbjct: 526 KDPSNIRGNQKHAGVIHSSNLCTEILLPTSKEETAVCNLGSVNLRNHIKEGKLDVSHLEK 585

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           TI TA+R+LDNVIDIN +   +A++SN  HR IGLG+MGFQ AL+L+ IPY S EA+  A
Sbjct: 586 TIATAIRMLDNVIDINFYPTPEARESNLRHRPIGLGMMGFQDALYLMEIPYCSQEAIAFA 645

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTS 742
           D SME IS+ AI AS  LA+ERG+Y SFKGS WD G+FP  ++ LL E R  ++ +++ S
Sbjct: 646 DSSMETISYFAIKASSLLAKERGSYPSFKGSNWDLGLFPHQTMALLEEERGIKIPIDQCS 705

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
              W  L + ++  GMRNS+ +AIAPTATI+ I GVSQSI+P Y NL+ KSN+SG+FT V
Sbjct: 706 SRDWKTLLEIIRQNGMRNSHVLAIAPTATISQIVGVSQSIEPQYTNLFTKSNLSGEFTSV 765

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV  LK  +LWD+ M+ +LKYHDGS+  I RIP ++++   TAFE+   WLI  A+ 
Sbjct: 766 NHYLVETLKSLNLWDQEMLDELKYHDGSVQAIPRIPQEVRERFRTAFEVGAEWLIRCAAA 825

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWID  QSLNLYL EPSG+KLD +YR AW +GLKTTYYLR+R+AT VEKSTL     K
Sbjct: 826 RQKWIDMGQSLNLYLTEPSGRKLDEMYRLAWKLGLKTTYYLRTRAATQVEKSTLDI--NK 883

Query: 923 LNAVPVTDPNSSTHSLGIP--SSCT-SDTECEVCQ 954
            +  P    N S  S   P    C+  D  CE CQ
Sbjct: 884 FDIQPKWMKNKSASSSIAPRQGQCSIDDPTCEACQ 918


>gi|255507449|ref|ZP_05383088.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis D(s)2923]
 gi|289525873|emb|CBJ15355.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydia
            trachomatis Sweden2]
 gi|296435458|gb|ADH17636.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis E/150]
 gi|296439175|gb|ADH21328.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis E/11023]
          Length = 1047

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/945 (52%), Positives = 639/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H    R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEDCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT VR  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAVRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            AVE AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AVEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|255349231|ref|ZP_05381238.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 70]
 gi|255503768|ref|ZP_05382158.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydia
            trachomatis 70s]
          Length = 1047

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/945 (52%), Positives = 639/945 (67%), Gaps = 30/945 (3%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRL--- 83
            + + V++R G V  F+P KIS A+ KAF A +         V++ I  LT+  V  +   
Sbjct: 116  QSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREEINALTQNIVAEIEEC 175

Query: 84   -LQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKS-DAPI 141
              Q ++    + IE IQD VE  LM  GH+ + + Y+LYRE R+ VR  +    S +  I
Sbjct: 176  CPQQDRR---IDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTI 232

Query: 142  APK-LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLE 199
            A + ++++  DG+  +    +L   +  ACS   + +   +L++  + N Y G+ ES++ 
Sbjct: 233  AEEAVEVLSKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVV 292

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVL-TTVYKKPQKATHHEMQCLYPEYFCR 258
             A I ++R  IEKEP+YA V A  LL+ + +E L  + Y +  +  H +       +F R
Sbjct: 293  LACIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRD-------HFKR 345

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQ 318
            YI EG   RL  E    FDL  LA+ +   RD  F Y+G+Q LYDRYF H    R+E PQ
Sbjct: 346  YIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEDCRLETPQ 405

Query: 319  AFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPD 378
             F+MRVAMGLAL E +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV D
Sbjct: 406  IFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQD 465

Query: 379  DLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            +L  I+  + +NAML+K++GG+GNDWT VR  GA I GTNG+SQGVIPF+KV NDTAVAV
Sbjct: 466  NLVNIYKVIADNAMLSKWAGGIGNDWTAVRATGALIKGTNGRSQGVIPFIKVTNDTAVAV 525

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKRKGAVC YLE WH+D E+FL+LRKNTGD+RRR HD+N A+WIPDLF KR+ Q   
Sbjct: 526  NQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGT 585

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            WTLFSPD+V  LHD YG+EFE  YE YER+ D GEI++F+K+ A  LWRKML+MLFETGH
Sbjct: 586  WTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETGH 645

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDY 618
            PW+TFKDP NIRS Q H GVV  SNLCTEI LN S  ETAVCNLGSINL+ H   +  D 
Sbjct: 646  PWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDE 705

Query: 619  DKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPE 678
            +KL+ TI  AVR+LDNVIDIN +  ++AK++N  HRAIGLG+MGFQ AL+ L I YAS E
Sbjct: 706  EKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQE 765

Query: 679  AVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--L 736
            A+E AD S E IS++AI AS  LA+ERG YSS+KGS WD+G+ PID+I LLA  R E  L
Sbjct: 766  AIEFADYSSELISYYAIQASCLLAKERGTYSSYKGSKWDRGLLPIDTIQLLANYRGEANL 825

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             M+ +SR  W+ ++  VK  GMR+   MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+S
Sbjct: 826  QMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLS 885

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+FT+ N +L+ +LK+  +WD  M+ DLKY DGS+  IERIPD LK I  TAFEI+P W+
Sbjct: 886  GEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWI 945

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            IE ASRRQKWID  QSLNLYL +P GKKL  +Y  AW  GLKTTYYLRS SAT+VEKS  
Sbjct: 946  IECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSF- 1004

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGI-------PSSCTSDTECEVCQ 954
              VD     +      + + S GI          C+ +  CE CQ
Sbjct: 1005 --VDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCEACQ 1047



 Score = 60.8 bits (146), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    FD ++I +A+  AF           +   ++  I+++T Q V  ++
Sbjct: 7   KQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVV 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
           Q      +V +E IQD VE  L  +G   + R+Y++YR++R   R     S         
Sbjct: 67  QKITDGQVVTVERIQDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQS--------- 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           L ++   GT++ FN  ++   +E+A
Sbjct: 118 LSVVRRCGTVVHFNPMKISAALEKA 142


>gi|283779061|ref|YP_003369816.1| ribonucleoside-diphosphate reductase, alpha subunit [Pirellula
           staleyi DSM 6068]
 gi|283437514|gb|ADB15956.1| ribonucleoside-diphosphate reductase, alpha subunit [Pirellula
           staleyi DSM 6068]
          Length = 945

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/937 (52%), Positives = 637/937 (67%), Gaps = 27/937 (2%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLLQHN 87
           QV KR+G +  FD ++I  AI KA  A  G  A+  +   V   I + TE+ V R     
Sbjct: 24  QVRKRDGRLARFDLARIGTAITKAVTAELGAAAAHELPAHVAQSITDYTER-VARWCDLQ 82

Query: 88  KSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKI 147
           +    + +E IQD+VE  LM +G H++ R YVLYRE       +Q+H +     A   ++
Sbjct: 83  EQ---LAVESIQDEVERVLMTAGEHRVARRYVLYRE-------SQAHKRK----ASATQV 128

Query: 148 MMDDGTLISFNSKRLEMIVEEACS-GLQDVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
            +  G L +     LE  + +AC    Q   +  + ++  +++   ++ + L  A I + 
Sbjct: 129 RLASGELTALPINALEHWIAQACELHGQAPQAAAITADIVRSLPTEVTPTQLFDATILAL 188

Query: 207 RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP--QKATHHEMQCLYPEYFCRYIEEGV 264
           R+ +E EP +  V A+ LL++   ++L   +        +  E +  Y  YF  Y+   V
Sbjct: 189 RSRVELEPVFTYVAAKLLLDRSDSQLLQNHHGAAILTPLSPSERRAGYQRYFPEYVRAAV 248

Query: 265 KARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRV 324
               LHESM+D++L  +A  +  ERD    YLG+Q LYDRYFL   G R+E+PQ F+MR+
Sbjct: 249 ARGQLHESMLDYNLEAIAAFIVPERDSLLAYLGVQTLYDRYFLAHEGLRVELPQIFWMRI 308

Query: 325 AMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           AMGLAL E  K +R  EFY+LLS  HF  +TPTLFN+GT HPQLSSC+L+TV DDL GIF
Sbjct: 309 AMGLALGEQNKLERVKEFYDLLSQLHFTSATPTLFNAGTCHPQLSSCYLSTVEDDLVGIF 368

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
            A+Q+NA+L+K++GGLGNDWT +R LGA I GT GKSQG++PFLKV +D AVAVNQGGKR
Sbjct: 369 KAIQDNAILSKWAGGLGNDWTNIRALGATIRGTGGKSQGIVPFLKVVSDAAVAVNQGGKR 428

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGAVCAYLETWH+D+EEFL+LR+ TGD+RRRTHD++TANWIPDLFMKRV     WTLFSP
Sbjct: 429 KGAVCAYLETWHLDIEEFLELRRTTGDERRRTHDLHTANWIPDLFMKRVLARDTWTLFSP 488

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           +EV DLH  YG+ FE  Y +YE+ AD G IK+FR++SAV LWRKMLT+LFETGHPW+T+K
Sbjct: 489 NEVPDLHHTYGRAFEQKYLDYEQAADEGRIKLFRRVSAVDLWRKMLTLLFETGHPWVTWK 548

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DP NIRSPQ HVGVVH+SNLCTEI LN+S+EETAVCNLGS+NL AH  +   D   L  T
Sbjct: 549 DPSNIRSPQDHVGVVHNSNLCTEILLNNSAEETAVCNLGSVNLGAHITDGVLDLAMLERT 608

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           IRTAVR+LDNVID+N +   +A  +N  HR IGLGLMGFQ AL+ + I YAS  AV+ AD
Sbjct: 609 IRTAVRMLDNVIDLNFYPTPEAANANLRHRPIGLGLMGFQDALYAMQISYASDRAVQFAD 668

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSR 743
           ESME IS+ A+ AS ELA+ERG Y+SF GS WD+G  PID+I L+ + R  ++ + RT++
Sbjct: 669 ESMEAISYFALLASSELARERGKYASFAGSKWDRGYLPIDTIDLVEQERGIKIDVPRTAQ 728

Query: 744 LPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVN 803
           L W+ +++ ++  G+RNSN +AIAPTATI+NI GVSQSI+P+Y+NLYVKSN+SG+FT VN
Sbjct: 729 LNWEVVRRAIREQGLRNSNVLAIAPTATISNIAGVSQSIEPTYRNLYVKSNLSGEFTQVN 788

Query: 804 SFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRR 863
            +LV ELK   LW E M+  LKY+DG +  I  IP ++K+ + TAFEI+P WLIE A+RR
Sbjct: 789 EWLVEELKGLGLWSEEMLDQLKYYDGELAPIAEIPAEVKERYRTAFEIEPRWLIECAARR 848

Query: 864 QKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GV 919
           QKWID  QSLNLYL  PSG+KLD +Y  AW +GLKTTYYLR+ +AT VEKST+     G+
Sbjct: 849 QKWIDMGQSLNLYLAAPSGRKLDEMYFLAWKLGLKTTYYLRTLAATQVEKSTIDVNRFGI 908

Query: 920 DGKL--NAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             +   N     D          P  C    +CE CQ
Sbjct: 909 QPRWMKNKSASGDIQIDRTLASAPEVCNLGGDCEACQ 945


>gi|330443802|ref|YP_004376788.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            pecorum E58]
 gi|328806912|gb|AEB41085.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            pecorum E58]
          Length = 1047

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/940 (52%), Positives = 647/940 (68%), Gaps = 20/940 (2%)

Query: 27   KGVQVIKRNGGVTSFDPSKISRAIMKAFMA-VEGKGASRSIRVQDIIKNLTEQTVTRLL- 84
            +GV +I+R+G    F+P KIS A+ KAF A ++  G + S  V +I   LT + V  ++ 
Sbjct: 116  RGVLIIRRDGTSVKFNPMKISAALEKAFRATLQINGITPSPTVLEI-NELTLKIVEEIMA 174

Query: 85   QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQ-SHSKSDAPIAP 143
            QH   A  +HIE IQD VE  LM +G + + + Y+LYRE R   R  + S   S+  +  
Sbjct: 175  QHVGKAHGIHIEAIQDIVEKQLMIAGFYDVAKSYILYREARMRARENKVSEVNSECFVED 234

Query: 144  KL-KIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETA 201
            ++ +++ +D T    N   LE     AC+   +  SSK +    + N++ G+ ES++ +A
Sbjct: 235  EVYRVVREDQTEYLLNKAELEKRFTWACARFPETTSSKTLADMAFANLFSGVKESEVVSA 294

Query: 202  LIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIE 261
             I ++R  IEKEP+YA V A  L E + +E +         A   ++   +  YF +YI 
Sbjct: 295  CIMAARANIEKEPDYAFVAADLLHEVVYQETVGL------SAVSSKLTDAHRRYFKQYIL 348

Query: 262  EGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFF 321
            EG   RL +  + ++DL  LA  L   RD  F Y+G+Q L+DRYF    G R+E  Q F+
Sbjct: 349  EGENYRL-NPQLKEYDLDALAEVLDLTRDRKFSYMGVQNLFDRYFNQHEGKRLETAQIFW 407

Query: 322  MRVAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDL 380
            MRV+MGLAL E  EK   A+ FY+LLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL
Sbjct: 408  MRVSMGLALNEGKEKTSWAITFYHLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDL 467

Query: 381  YGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
              I+  + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTAVAVNQ
Sbjct: 468  QHIYKVISDNALLSKWAGGIGNDWTDVRARGAKIKGTNGKSQGVIPFIKVANDTAVAVNQ 527

Query: 441  GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
            GGKRKGA C YLE+WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WT
Sbjct: 528  GGKRKGAACVYLESWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLKQKGIWT 587

Query: 501  LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
            LFSPD+V  LH+ YG EFE  YE YE++ + GEI+++RK+ A  LWRKML+ML+ETGHPW
Sbjct: 588  LFSPDDVPGLHEAYGLEFEKLYEEYEQKIETGEIQLYRKVEAEVLWRKMLSMLYETGHPW 647

Query: 561  ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDK 620
            +TFKDP NIR+ Q HVGVV  SNLCTEI LNSS  ETAVCNLGS+NL+ H  N + +  K
Sbjct: 648  LTFKDPSNIRAAQDHVGVVRCSNLCTEILLNSSESETAVCNLGSLNLVEHLENGEINEAK 707

Query: 621  LASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAV 680
            LA TIR AVR+LDNVID+N + I +A ++N THRA+GLG MGFQ AL+  +I YAS EAV
Sbjct: 708  LAETIRIAVRILDNVIDLNFYPIPEAAQANLTHRAVGLGCMGFQDALYEKNISYASQEAV 767

Query: 681  EIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAM 738
            E ADE  E I++HAI +S ELA+ERG Y+S+KGS WD+G+ PID+I LL + R E  + M
Sbjct: 768  EFADEVAEIIAYHAILSSTELAKERGVYASYKGSKWDRGLLPIDTIDLLKQARGEQYVLM 827

Query: 739  NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
            + + R  W+ +++ V+  GMRNS+ M IAPTATI+NI G++QSI+P+Y+NL+VKSN+SG+
Sbjct: 828  DTSCRKDWEPVREAVRKYGMRNSHLMTIAPTATISNIIGITQSIEPTYKNLFVKSNLSGE 887

Query: 799  FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
            FT+ N +L+ +LK   LWDE M+ DLKY DGS+  IERIP++LKK+  TAFEI+P WLIE
Sbjct: 888  FTIPNVYLIRKLKSLGLWDEDMLDDLKYFDGSLSEIERIPENLKKVFVTAFEIEPEWLIE 947

Query: 859  SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS---- 914
             ASRRQKWID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS    
Sbjct: 948  CASRRQKWIDMGQSLNLYLAEPNGKKLSTMYLTAWEKGLKTTYYLRSLAATSVEKSFTDI 1007

Query: 915  TLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
              +G+  +         +         + C+ +  CE CQ
Sbjct: 1008 NKRGIQPRWMKNMSASTSIIVERTAKNAVCSMEEGCESCQ 1047



 Score = 56.2 bits (134), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 72/147 (48%), Gaps = 11/147 (7%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEG--KGASRSIRVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +I +A+  AF       + A     ++  I ++T + V  
Sbjct: 5   KEKHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLEEDAPLPKDLEKSISDITSKVVGE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           +++      +V +E IQD VE  L  +G   + R+Y++YR++  + R        ++P  
Sbjct: 65  VIEKISQGQVVTVERIQDIVESQLYVNGLQDVARDYIVYRDQHKEQR--------ESPWR 116

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEA 169
             L I+  DGT + FN  ++   +E+A
Sbjct: 117 GVL-IIRRDGTSVKFNPMKISAALEKA 142


>gi|329943119|ref|ZP_08291893.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci Cal10]
 gi|332287702|ref|YP_004422603.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            psittaci 6BC]
 gi|313848276|emb|CBY17277.1| putative ribonucleotide reductase large subunit [Chlamydophila
            psittaci RD1]
 gi|325507258|gb|ADZ18896.1| ribonucleoside-diphosphate reductase subunit alpha [Chlamydophila
            psittaci 6BC]
 gi|328814666|gb|EGF84656.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci Cal10]
 gi|328914954|gb|AEB55787.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            psittaci 6BC]
          Length = 1045

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/939 (51%), Positives = 641/939 (68%), Gaps = 24/939 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI---IKNLTEQTVTRLLQ 85
            V VI+R+G    F+P KIS A+ KAF A +       + +Q+I   I  LT + V  +L 
Sbjct: 118  VSVIRRDGSTVKFNPMKISAALEKAFRATQ---KITDVSIQEILSEINGLTNKIVEEILG 174

Query: 86   HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRA-AQSHSKSDAPIAPK 144
                   + IE IQD VE  LM  GH+ + + Y+LYRE RS +R   Q       P+   
Sbjct: 175  VCSPEKTIDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRENKQQIDAQKDPVEEV 234

Query: 145  LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETALI 203
              ++  DGT  S N  +L      AC    + +   VL++  + N Y G+ ES++  A I
Sbjct: 235  YDVVKSDGTTYSINKSQLIDKFIWACQRFPETTDPHVLADMAFANFYSGIKESEIALACI 294

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++R  IEKEP+YA V A  L++ + +E +       + AT  ++     + F  YI  G
Sbjct: 295  MAARANIEKEPDYAYVAAELLMDVVYQETMG------KTATDSDLAEAQKQCFKNYILNG 348

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
               RL +  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR
Sbjct: 349  ETYRL-NPRLKEYDLDALAEALDISRDQKFSYMGVQNLYDRYFNQHEGLRVETAQIFWMR 407

Query: 324  VAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            V+MGLAL E  +K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 408  VSMGLALNEGDDKTFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAH 467

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT VR  G+ I GTNGKSQGVIPF+KVANDTA+AVNQGG
Sbjct: 468  IYKVISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGG 527

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGA   YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLF
Sbjct: 528  KRKGATSVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQQGMWTLF 587

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LH+ YG EF+  YE YE + D GEIK+++KI A  LWRKML+ML+ETGHPW+T
Sbjct: 588  SPDDVPGLHEAYGIEFDKLYEEYESKIDTGEIKLYKKIPAADLWRKMLSMLYETGHPWMT 647

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIR+ Q HVGVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KL 
Sbjct: 648  FKDPSNIRAVQDHVGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLG 707

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  A+R+LDNVID+N +  ++A  +N +HRA+GLG+MGFQ AL+ L+I YASPEAVE 
Sbjct: 708  ETISIAIRILDNVIDLNFYPTQEAANANLSHRAVGLGIMGFQDALYKLNISYASPEAVEF 767

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD+S E ++++AI +S  LA+ERG YSS+KGS WD+G  P+D+I LL E R E  + M+ 
Sbjct: 768  ADKSSELVAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTIELLKEYRGEQNVLMDT 827

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            + R  W+ +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 828  SCRKDWNPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 887

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+N+LK+  +WD+ M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE A
Sbjct: 888  IPNVYLINKLKELGIWDDDMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECA 947

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
            SRRQKW+D  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS +    
Sbjct: 948  SRRQKWVDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFIDINK 1007

Query: 921  GKLNAVPVTDPNSSTHSLGIPSS-----CTSDTECEVCQ 954
              +    + + ++ST S+ +  +     C+ +  CE CQ
Sbjct: 1008 RGIQPRWMKNKSAST-SIVVDRAKKTPVCSFEEGCESCQ 1045



 Score = 65.9 bits (159), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 86/183 (46%), Gaps = 19/183 (10%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +I +A+  AF           +   +++ I ++T + V  
Sbjct: 5   KEKHYTIVKRNGMFVPFNQERIFQALEAAFRDTRSLENDSPLPKDLENAISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
            +Q  +   +V +E IQD VE  L  +G   + R+Y++YR++  + R    H  S     
Sbjct: 65  AVQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIIYRDQHKEQREGSWHCVS----- 119

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ---DVSSKIVLSETYKNMYDGLSESDLE 199
               ++  DG+ + FN  ++   +E+A    Q   DVS + +LSE      +GL+   +E
Sbjct: 120 ----VIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEI-----NGLTNKIVE 170

Query: 200 TAL 202
             L
Sbjct: 171 EIL 173


>gi|29840534|ref|NP_829640.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            caviae GPIC]
 gi|29834883|gb|AAP05518.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            caviae GPIC]
          Length = 1044

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/934 (51%), Positives = 626/934 (67%), Gaps = 15/934 (1%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            V V +R+G    F+P KIS A+ KAF A +    +        I +LT + V  +L    
Sbjct: 118  VLVRRRDGNAVKFNPMKISAALEKAFRATQKNTDTPFQETLAEINDLTNKIVEEILVVCS 177

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
                V IE IQD VE  LM  GH+ + + Y+LYRE RS +R ++ +  +   I     ++
Sbjct: 178  QEKTVDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRESKENVATQESIEEVYDVV 237

Query: 149  MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVL-SETYKNMYDGLSESDLETALIFSSR 207
             +DG+    N  +L      AC    + ++   L S  + N Y G+ E+++  A I ++R
Sbjct: 238  REDGSTYQINKAQLTDKFIWACQRFPETTNPQTLASMAFANFYSGIKEAEIVKACIMAAR 297

Query: 208  TLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKAR 267
              IEKEP+YA V A  L + + +E +       + AT  ++     + F  YI  G + R
Sbjct: 298  ANIEKEPDYAYVAAELLTDVVYQETMG------KSATDSDLAEAQKQCFKNYILNGEEYR 351

Query: 268  LLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMG 327
            L +  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR++MG
Sbjct: 352  L-NPRLKEYDLDALAEALDISRDRQFSYMGVQNLYDRYFNQHEGRRLETAQIFWMRISMG 410

Query: 328  LALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGA 386
            LAL E E K   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+  
Sbjct: 411  LALNEGEDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAHIYKV 470

Query: 387  LQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKG 446
            + +NAML+K++GG+GNDWT VR +G+ I GTNGKSQGVIPF+KVANDTA+AVNQGGKRKG
Sbjct: 471  ISDNAMLSKWAGGIGNDWTGVRAIGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKG 530

Query: 447  AVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDE 506
            A+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLFSPD+
Sbjct: 531  AMCVYLEIWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLDQKGTWTLFSPDD 590

Query: 507  VSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDP 566
            V  LH+ YG EF+  YE YER+ D GEIK+++KI A  LWRKML+ML+ETGHPW+TFKDP
Sbjct: 591  VPGLHEAYGFEFDKLYEEYERKIDNGEIKLYKKIPAEDLWRKMLSMLYETGHPWLTFKDP 650

Query: 567  CNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIR 626
             NIR  Q H GVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KLA TI 
Sbjct: 651  SNIRGAQDHAGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLAETIS 710

Query: 627  TAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADES 686
             A+R+LDN+ID+N +   +A  +N +HRA+GLG MGFQ AL+ L+I YAS EAVE AD+S
Sbjct: 711  IAIRILDNIIDLNFYPTPEAANANLSHRAVGLGQMGFQDALYKLNISYASQEAVEFADKS 770

Query: 687  MEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRL 744
             E I+++AI +S  LA+ERG YSS+KGS WD+G  P+D++ LL E R E  + M+ + R 
Sbjct: 771  AELIAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTVELLKEYRGEENVLMDTSCRK 830

Query: 745  PWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNS 804
             W  +++ +K  GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT+ N 
Sbjct: 831  DWTPVREAIKAYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPNV 890

Query: 805  FLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQ 864
            +L+ +LK+  +WD  M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE ASRRQ
Sbjct: 891  YLIEQLKKLGIWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQ 950

Query: 865  KWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS----TLKGVD 920
            KWID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS      +G+ 
Sbjct: 951  KWIDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFTDVNKRGIQ 1010

Query: 921  GKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
             +         +           C+ +  CE CQ
Sbjct: 1011 PRWMKNKSASTSIVVERTKSTPVCSLEEGCESCQ 1044



 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 72/152 (47%), Gaps = 11/152 (7%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTR 82
           K K   ++KRNG    F+  +IS+A+  AF        +  +   +++ I ++T + V  
Sbjct: 5   KEKNYTIVKRNGMFVPFNQDRISQALEAAFRDTRSLENNSPLPEDLENSISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           ++Q  +   +V +E IQD VE  L  +G   + R+Y++YR++  + R    H        
Sbjct: 65  VMQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIVYRDQHKEQREGSWHC------- 117

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ 174
             + +   DG  + FN  ++   +E+A    Q
Sbjct: 118 --VLVRRRDGNAVKFNPMKISAALEKAFRATQ 147


>gi|298243908|ref|ZP_06967715.1| ribonucleoside-diphosphate reductase, alpha subunit [Ktedonobacter
           racemifer DSM 44963]
 gi|297556962|gb|EFH90826.1| ribonucleoside-diphosphate reductase, alpha subunit [Ktedonobacter
           racemifer DSM 44963]
          Length = 846

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/819 (56%), Positives = 590/819 (72%), Gaps = 24/819 (2%)

Query: 158 NSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNY 216
           +S+ +  I+EE C G   +V+   +        Y G+S+++L  ALI ++RT IE EP Y
Sbjct: 30  DSQAVLRILEEVCQGFGPEVNVDQLFQSVNATTYAGISDAELWQALIMATRTNIEFEPAY 89

Query: 217 AKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDF 276
             V AR LL  L  E L+T   +  +   ++   +Y  Y   Y+E GV    L     ++
Sbjct: 90  TFVAARLLLISLYNEALSTT--QATRVGLNDAASIYKNYLSDYVEFGVSKGYLDPRFQEY 147

Query: 277 DLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKE 336
           DL+ LA+ +  ERD  F Y GLQILYDRYFL  N  R E+PQ  +MRVAMGLA  E  KE
Sbjct: 148 DLIELASAIHPERDQLFAYQGLQILYDRYFLQDNNRRFELPQLLWMRVAMGLAFNEEHKE 207

Query: 337 KRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKY 396
            RA+EFY LLS F+F  +TPTLFN+GT HPQLSSC+LTTV DDL+ IF  +Q+NA+L+K+
Sbjct: 208 ARAIEFYELLSQFYFTSATPTLFNAGTTHPQLSSCYLTTVDDDLFHIFKCIQDNALLSKW 267

Query: 397 SGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWH 456
           +GGLGNDWT VR LGAHI GTNG SQG+IPFLKV NDTAVAVNQGGKRKGAVCAY+E WH
Sbjct: 268 AGGLGNDWTRVRALGAHIKGTNGISQGIIPFLKVVNDTAVAVNQGGKRKGAVCAYIENWH 327

Query: 457 IDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGK 516
           +D+EEFLDLRKNTGDDRRRTHDM+TA WI DLFMKRV +N  WTLFSPD VSDLHDLYGK
Sbjct: 328 LDIEEFLDLRKNTGDDRRRTHDMHTACWISDLFMKRVERNEQWTLFSPDVVSDLHDLYGK 387

Query: 517 EFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHV 576
            FE  YE YER  + G+I  +R++SA+ LWRKMLT LFETGHPWITFKDP N+RSPQ H 
Sbjct: 388 AFEQRYEEYERMVEAGQITHYRRVSALDLWRKMLTRLFETGHPWITFKDPSNVRSPQDHA 447

Query: 577 GVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVI 636
           GVVHSSNLCTEI LN+S++ETAVCNLGSINL AH  + + ++++L  T+RTAVR+LDNVI
Sbjct: 448 GVVHSSNLCTEILLNTSNDETAVCNLGSINLAAHIIDGKLNHERLQKTVRTAVRMLDNVI 507

Query: 637 DINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAIS 696
           DIN +  ++A+ +N  HR +GLGLM FQ AL+ L + YAS  A+E AD SME IS++AI 
Sbjct: 508 DINYYPTDEARNANLRHRPVGLGLMAFQDALYKLGVSYASEAAIEFADRSMEAISYYAIL 567

Query: 697 ASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKT 755
           AS ELA E G Y S++GS WD+G+ PIDSI +L E R + + M+R+  L WD+++  VK 
Sbjct: 568 ASSELATEHGTYGSYQGSKWDRGILPIDSIAILEEERGQKIDMDRSMTLDWDKVRTAVKQ 627

Query: 756 IGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDL 815
            GMRNSN MAIAPTATI++I GVSQSI+PSY+NLYVKSN+SG+FT++NSFLV++LK+ ++
Sbjct: 628 NGMRNSNVMAIAPTATISSIVGVSQSIEPSYKNLYVKSNLSGEFTIINSFLVDDLKRLEI 687

Query: 816 WDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNL 875
           WD   +  LKY+DGS+  +  +P+++++ + TAF+I+P WLI  ASRRQKWID  QS++L
Sbjct: 688 WDRNTLEALKYYDGSLQEMTFLPEEIRQRYLTAFDIEPRWLIACASRRQKWIDMGQSIDL 747

Query: 876 YLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GVDGKL--NAVPVT 929
           YL  PSGKKL  +Y+ AW  GLKTTYYLR+ +AT VEKST+     G+  +   N+ P +
Sbjct: 748 YLYNPSGKKLSDVYQLAWNSGLKTTYYLRTLAATQVEKSTVDINRFGIQPRWMKNSSPSS 807

Query: 930 D-----------PNSSTHSL---GIPSSCTSDTECEVCQ 954
           +           P  +   L   G  + C    +CE CQ
Sbjct: 808 NIQVERENQAQQPKPTPIPLELSGEGAVCNLGDDCEACQ 846


>gi|62185357|ref|YP_220142.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            abortus S26/3]
 gi|62148424|emb|CAH64192.1| putative ribonucleotide reductase large subunit [Chlamydophila
            abortus S26/3]
          Length = 1045

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/938 (51%), Positives = 636/938 (67%), Gaps = 22/938 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDI---IKNLTEQTVTRLLQ 85
            V VI+R+G    F+P KIS A+ KAF A +       + +Q+I   I  LT + V  +L 
Sbjct: 118  VSVIRRDGSTVKFNPMKISAALEKAFRATQ---KITDVSIQEILSEINGLTNKIVEEILG 174

Query: 86   HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKL 145
                   + IE IQD VE  LM  GH+ + + Y+LYRE RS +R  +    +   +  ++
Sbjct: 175  VCSPEKTIDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRENKQQIDAQKDLVEEV 234

Query: 146  -KIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSE-TYKNMYDGLSESDLETALI 203
              ++  DGT  S N  +L      AC    + +   VL++  + N Y G+ ES++  A I
Sbjct: 235  YDVVKSDGTTYSINKSQLIDKFIWACQRFPETTDPQVLADMAFANFYSGIKESEIALACI 294

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++R  IEKEP+YA V A  L++ + +E +       + AT  ++     + F  YI  G
Sbjct: 295  MAARANIEKEPDYAYVAAELLMDVVYQEAMG------KTATDSDLAEAQKQCFKNYILNG 348

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
               RL +  + ++DL  LA  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR
Sbjct: 349  ETYRL-NPRLKEYDLDALAEALDISRDQKFSYMGVQNLYDRYFNQHEGLRVETAQIFWMR 407

Query: 324  VAMGLALKE-TEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            V+MGLAL E  +K   A+ FYNLLS+F +  +TPTLFNSGTRH QLSSC+L+T+ DDL  
Sbjct: 408  VSMGLALNEGDDKTFWAITFYNLLSTFRYTPATPTLFNSGTRHSQLSSCYLSTIQDDLAH 467

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NAML+K++GG+GNDWT VR  G+ I GTNGKSQGVIPF+KVANDTA+AVNQGG
Sbjct: 468  IYKVISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGG 527

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGA   YLETWH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ Q   WTLF
Sbjct: 528  KRKGATSVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQQGMWTLF 587

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LH+ YG EF+  YE YE + D GEIK+++KI A  LWRKML+ML+ETGHPW+T
Sbjct: 588  SPDDVPGLHEAYGTEFDKLYEEYESKIDTGEIKLYKKIPAADLWRKMLSMLYETGHPWMT 647

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIR+ Q HVGVV  SNLCTEI LN S  ETAVCNLGS+NL+ H  N   +  KL 
Sbjct: 648  FKDPSNIRAVQDHVGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLE 707

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  A+R+LDNVID+N +  ++A  +N +HRAIGLG+MGFQ AL+ L+I YASPEAVE 
Sbjct: 708  ETISIAIRILDNVIDLNFYPTQEAANANLSHRAIGLGIMGFQDALYKLNISYASPEAVEF 767

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            AD+S E ++++AI +S  LA+ERG YSS+KGS WD+G  P+D+I LL E R E  + M+ 
Sbjct: 768  ADKSSELVAYYAILSSSLLAKERGTYSSYKGSKWDRGYLPLDTIELLKEYRGEENVLMDT 827

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            + R  W  +++ +K+ GMRNS+ MAIAPTATI+NI GV+QSI+P+Y++L+VKSN+SG+FT
Sbjct: 828  SCRKDWTPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFT 887

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N +L+++LK+  LWD+ M+ DLKY DGS+  IERIPDDLKKI  TAFEI+P WLIE A
Sbjct: 888  IPNVYLISKLKELGLWDDDMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECA 947

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKS----TL 916
            SRRQKWID  QSLNLYL EP+GKKL  +Y  AW  GLKTTYYLRS +ATSVEKS      
Sbjct: 948  SRRQKWIDMGQSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSSAATSVEKSFTDINK 1007

Query: 917  KGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            +G+  +         +           C+ +  CE CQ
Sbjct: 1008 RGIQPRWMKNKSASTSIVVDRAKKTPVCSFEEGCESCQ 1045



 Score = 66.6 bits (161), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 86/183 (46%), Gaps = 19/183 (10%)

Query: 25  KIKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTR 82
           K K   V+KRNG    F+  +I +A+  AF           +   +++ I ++T + V  
Sbjct: 5   KEKHYTVVKRNGMFVPFNQERIFQALEAAFRDTRSLENDSPLPKDLENAISDITHRVVNE 64

Query: 83  LLQHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA 142
           ++Q  +   +V +E IQD VE  L  +G   + R+Y++YR+   + R    H  S     
Sbjct: 65  VIQKIREGQVVTVERIQDMVENQLYVNGLQDVARDYIIYRDHHKEQREGSWHCVS----- 119

Query: 143 PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ---DVSSKIVLSETYKNMYDGLSESDLE 199
               ++  DG+ + FN  ++   +E+A    Q   DVS + +LSE      +GL+   +E
Sbjct: 120 ----VIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSEI-----NGLTNKIVE 170

Query: 200 TAL 202
             L
Sbjct: 171 EIL 173


>gi|269839639|ref|YP_003324331.1| ribonucleoside-diphosphate reductase, subunit alpha [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269791369|gb|ACZ43509.1| ribonucleoside-diphosphate reductase, alpha subunit [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 819

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/816 (55%), Positives = 587/816 (71%), Gaps = 13/816 (1%)

Query: 144 KLKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALI 203
           +++++  +G L+  +  R+   ++ AC GL +     + +E  +++YD ++   + +A+I
Sbjct: 12  RVRVVSPEGGLVPLDPDRVRRHLQHACRGLPECDPDELANEVVRSLYDRVTPEQIRSAMI 71

Query: 204 FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
            ++R  IE++P Y KV +R +LE++ +E    V   P +A   E+   Y E F RY+   
Sbjct: 72  LAARARIERDPAYDKVASRLMLEQIYQESWGWV---PSEA---ELAATYREMFPRYVHAC 125

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
           + A  L E +  FDL  LA+ L+ ERD    Y+GLQ LYDRY L + G R+E PQ F+MR
Sbjct: 126 ISAGRLSEELARFDLARLASALRPERDEKLRYIGLQTLYDRYLLDVEGRRLEAPQYFWMR 185

Query: 324 VAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGI 383
           VAMGLAL+E +   RA +FY+LLSS  F+ +TPTLFNSGT HPQLSSC+L+TV DDL  I
Sbjct: 186 VAMGLALREDDPNARAAQFYDLLSSLRFVSATPTLFNSGTPHPQLSSCYLSTVEDDLEHI 245

Query: 384 FGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGK 443
           F  + +NA L+K++GGLGNDWT VR  GA I GT+GKSQGVIPFLK+ NDTAVAVNQGGK
Sbjct: 246 FKVIGDNAKLSKWAGGLGNDWTRVRATGALIRGTHGKSQGVIPFLKIVNDTAVAVNQGGK 305

Query: 444 RKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFS 503
           RKGAVC YLE WH+D EEFL+LRKNTGD+RRRTHDM+TA+W+PDLFM+RV +   WTLFS
Sbjct: 306 RKGAVCCYLEPWHLDFEEFLELRKNTGDERRRTHDMHTASWVPDLFMRRVQEGGTWTLFS 365

Query: 504 PDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITF 563
           P+EV DLH+LYG+ FE  Y  YER A+ G+++  +++ A  LWRKML+ML+ETGHPWI F
Sbjct: 366 PNEVPDLHELYGRAFERRYVEYERMAEEGKLRQHKRVDAKMLWRKMLSMLWETGHPWIAF 425

Query: 564 KDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAS 623
           KDP NIRS Q HVGV+HSSNLCTEI L +S EETAVCNLGSINL+ H + +  D  KLA 
Sbjct: 426 KDPSNIRSAQDHVGVIHSSNLCTEILLPTSREETAVCNLGSINLVEHLSGDGLDEAKLAE 485

Query: 624 TIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIA 683
           T+RTAVR+LDNVIDIN +   +A++SN  HR IGLG+MGF  AL  L IPYASP+AVE +
Sbjct: 486 TVRTAVRMLDNVIDINFYPTPEARRSNLRHRPIGLGIMGFHDALLALRIPYASPQAVEFS 545

Query: 684 DESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAMNRTS 742
           D++ME IS+HAI AS ELA ERG Y S++GS W +G+ PID+I LL   R  +L M+RT+
Sbjct: 546 DQTMELISWHAIMASSELAAERGRYPSYQGSKWSRGLLPIDTIELLERERGGDLEMDRTA 605

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
           RL W  +++ V   G+RNS  MAIAPTATI+NI GVSQSI+P Y+NL+VKSN+SGDFT+V
Sbjct: 606 RLDWGPVREAVARWGVRNSQIMAIAPTATISNIAGVSQSIEPHYRNLFVKSNLSGDFTIV 665

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N +LV +LK+  LW + M+  +KY+DGSI  IE IPD++K ++ TA EIDP+WLIE ASR
Sbjct: 666 NPYLVEDLKRLGLWSQEMLDRIKYYDGSILPIEEIPDEVKHLYLTAHEIDPLWLIECASR 725

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----G 918
           RQKW+D  QSLN+Y+ EPSGKKL  IY  AW  GLKTTYYLR+  AT+VEK+++     G
Sbjct: 726 RQKWVDMGQSLNIYVAEPSGKKLHEIYFAAWRKGLKTTYYLRAVGATNVEKASMDINRFG 785

Query: 919 VDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
           V  +                G  S+C    +CE CQ
Sbjct: 786 VQPRWMRSRSASSRVRIVREG--STCQLGEDCEACQ 819


>gi|15618892|ref|NP_225178.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae CWL029]
 gi|15836515|ref|NP_301039.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae J138]
 gi|16752044|ref|NP_445410.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae AR39]
 gi|33242352|ref|NP_877293.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila
            pneumoniae TW-183]
 gi|7388068|sp|Q9Z6S5|RIR1_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;
            AltName: Full=Ribonucleotide reductase
 gi|4377312|gb|AAD19121.1| Ribonucleoside Reductase, Large Chain [Chlamydophila pneumoniae
            CWL029]
 gi|7189784|gb|AAF38661.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila
            pneumoniae AR39]
 gi|8979357|dbj|BAA99191.1| ribonucleoside reductase, large chain [Chlamydophila pneumoniae J138]
 gi|33236863|gb|AAP98950.1| ribonucleoside reductase large chain [Chlamydophila pneumoniae
            TW-183]
          Length = 1044

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/937 (50%), Positives = 638/937 (68%), Gaps = 21/937 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMA-VEGKGASRSIRVQDIIKNLTEQTVTRLLQ-H 86
            + +I+R+GG   F+P KIS A+ KAF A ++  G +    + +I  +LT + V  +L  H
Sbjct: 118  IAIIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSEI-NDLTLRIVEDVLSLH 176

Query: 87   NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD--APIAPK 144
             + A  +++E+IQD VE  LM +G++ + + Y+LYRE R+  RA +     +   P    
Sbjct: 177  GEEA--INLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQDGQEEFVPQEET 234

Query: 145  LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALI 203
              +  +DGT        LE     AC    +   S+++    + N+Y G+ E ++ TA I
Sbjct: 235  YVVQKEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEDEVTTACI 294

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++R  IE+EP+YA + A  L   L  E L    + P  +  H+      ++F  YI  G
Sbjct: 295  MAARANIEREPDYAFIAAELLTSSLYEETLGCSSQDPNLSEIHK------KHFKEYILNG 348

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
             + RL +  + D+DL  L+  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR
Sbjct: 349  EEYRL-NPQLKDYDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRRLETAQIFWMR 407

Query: 324  VAMGLALKETEKEK-RAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            V+MGLAL E E++   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 408  VSMGLALNEGEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSH 467

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTA+AVNQGG
Sbjct: 468  IYKVISDNALLSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGG 527

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGA+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ +   WTLF
Sbjct: 528  KRKGAMCVYLENWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEKKGMWTLF 587

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LH+ YG EFE  YE YER+ + GEI++++K+ A  LWRKML+ML+ETGHPWIT
Sbjct: 588  SPDDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSMLYETGHPWIT 647

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q HVGVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N++ D +KL 
Sbjct: 648  FKDPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNDKLDEEKLK 707

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  A+R+LDNVID+N +   +AK++N THRA+GLG+MGFQ  L+ L+I YAS EAVE 
Sbjct: 708  ETISIAIRILDNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEF 767

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            +DE  E I+++AI AS  LA+ERG Y+S+ GS WD+G  P+D+I LL E R E  + ++ 
Sbjct: 768  SDECSEIIAYYAILASSLLAKERGTYASYSGSKWDRGYLPLDTIELLKETRGEHNVLVDT 827

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +S+  W  ++  ++  GMRNS  MAIAPTATI+NI GV+QSI+P Y++L+VKSN+SG+FT
Sbjct: 828  SSKKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFT 887

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N++L+ +LK+  LWD  M+ DLKY DGS+  IERIP+ LKK+  TAFEI+P W+IE  
Sbjct: 888  IPNTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECT 947

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
            SRRQKWID   SLNLYL EP GKKL  +Y  AW  GLKTTYYLRS++ATSVEKS +    
Sbjct: 948  SRRQKWIDMGVSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSQAATSVEKSFIDINK 1007

Query: 921  GKLNAVPVTDPNSSTHSL---GIPSSCTSDTECEVCQ 954
              +    + + ++ST  +        C+ +  CE CQ
Sbjct: 1008 RGIQPRWMKNKSASTSIVVERKTTPVCSMEEGCESCQ 1044



 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    F+  +I +A+  AF        S  +   +++ I  +T + V  +L
Sbjct: 7   KHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVL 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                  +V +E IQD VE  L  SG   + R+Y++YR++R   +A + +S S       
Sbjct: 67  AKISEGQVVTVERIQDLVESQLYISGLQDVARDYIVYRDQR---KAERGNSSS------I 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           + I+  DG    FN  ++   +E+A
Sbjct: 118 IAIIRRDGGSAKFNPMKISAALEKA 142


>gi|269302785|gb|ACZ32885.1| ribonucleoside-diphosphate reductase alpha subunit [Chlamydophila
            pneumoniae LPCoLN]
          Length = 1044

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/937 (50%), Positives = 637/937 (67%), Gaps = 21/937 (2%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMA-VEGKGASRSIRVQDIIKNLTEQTVTRLLQ-H 86
            + +I+R+GG   F+P KIS A+ KAF A ++  G +    + +I  +LT + V  +L  H
Sbjct: 118  IAIIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSEI-NDLTLRIVEDVLSLH 176

Query: 87   NKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD--APIAPK 144
             + A  +++E+IQD VE  LM +G++ + + Y+LYRE R+  RA +     +   P    
Sbjct: 177  GEGA--INLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQDGQEEFVPQEET 234

Query: 145  LKIMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALI 203
              +  +DGT        LE     AC    +   S+++    + N+Y G+ E ++ TA I
Sbjct: 235  YVVQKEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEEEVTTACI 294

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++R  IE+EP+YA + A  L   L  E L    + P  +  H+      ++F  YI  G
Sbjct: 295  MAARANIEREPDYAFIAAELLTSSLYEETLGCNSQDPNLSEIHK------KHFKEYILNG 348

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMR 323
             + RL +  + D+DL  L+  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MR
Sbjct: 349  EEYRL-NPQLKDYDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRRLETAQIFWMR 407

Query: 324  VAMGLALKETEKEK-RAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYG 382
            V+MGLAL E E++   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  
Sbjct: 408  VSMGLALNEGEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSH 467

Query: 383  IFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGG 442
            I+  + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTA+AVNQGG
Sbjct: 468  IYKVISDNALLSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGG 527

Query: 443  KRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLF 502
            KRKGA+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ +   WTLF
Sbjct: 528  KRKGAMCVYLENWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEKKGMWTLF 587

Query: 503  SPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWIT 562
            SPD+V  LH+ YG EFE  YE YER+ + GEI++++K+ A  LWRKML+ML+ETGHPWIT
Sbjct: 588  SPDDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSMLYETGHPWIT 647

Query: 563  FKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLA 622
            FKDP NIRS Q HVGVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N + D +KL 
Sbjct: 648  FKDPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNGKLDEEKLK 707

Query: 623  STIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEI 682
             TI  A+R+LDNVID+N +   +AK++N THRA+GLG+MGFQ  L+ L+I YAS EAVE 
Sbjct: 708  ETISIAIRILDNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEF 767

Query: 683  ADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNR 740
            +DE  E I+++AI AS  LA+ERG Y+S+ GS WD+G  P+D+I LL E R E  + ++ 
Sbjct: 768  SDECSEIIAYYAILASSLLAKERGTYASYSGSKWDRGYLPLDTIELLKETRGEHNVLVDT 827

Query: 741  TSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFT 800
            +S+  W  ++  ++  GMRNS  MAIAPTATI+NI GV+QSI+P Y++L+VKSN+SG+FT
Sbjct: 828  SSKKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFT 887

Query: 801  VVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESA 860
            + N++L+ +LK+  LWD  M+ DLKY DGS+  IERIP+ LKK+  TAFEI+P W+IE  
Sbjct: 888  IPNTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECT 947

Query: 861  SRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVD 920
            SRRQKWID   SLNLYL EP GKKL  +Y  AW  GLKTTYYLRS++ATSVEKS +    
Sbjct: 948  SRRQKWIDMGVSLNLYLAEPDGKKLSNMYLMAWKKGLKTTYYLRSQAATSVEKSFIDINK 1007

Query: 921  GKLNAVPVTDPNSSTHSL---GIPSSCTSDTECEVCQ 954
              +    + + ++ST  +        C+ +  CE CQ
Sbjct: 1008 RGIQPRWMKNKSASTSIVVERKTTPVCSMEEGCESCQ 1044



 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 27  KGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSI--RVQDIIKNLTEQTVTRLL 84
           K   ++KRNG    F+  +I +A+  AF        S  +   +++ I  +T + V  +L
Sbjct: 7   KHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVL 66

Query: 85  QHNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPK 144
                  +V +E IQD VE  L  SG   + R+Y++YR++R   +A + +S S       
Sbjct: 67  AKISEGQVVTVERIQDLVESQLYISGLQDVARDYIVYRDQR---KAERGNSSS------I 117

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEA 169
           + I+  DG    FN  ++   +E+A
Sbjct: 118 IAIIRRDGGSAKFNPMKISAALEKA 142


>gi|159899094|ref|YP_001545341.1| ribonucleoside-diphosphate reductase subunit alpha [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892133|gb|ABX05213.1| ribonucleoside-diphosphate reductase, alpha subunit [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 806

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/793 (55%), Positives = 558/793 (70%), Gaps = 7/793 (0%)

Query: 163 EMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTAR 222
           ++IVE   +  Q   +  +        Y  ++ ++   A   ++R+ IE+EP+Y+ V A 
Sbjct: 20  QLIVEACAAYPQTTDANTLWQAASLGFYPNMAVAEQLQACCLTARSWIEQEPDYSFVAAA 79

Query: 223 FLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLA 282
            L  +L  EVL      P           Y   F  YI+ G+   LL   +  FDL  LA
Sbjct: 80  LLASQLHFEVLGEYLATPAVVPR------YASAFVDYIQAGIAQGLLDPKLASFDLARLA 133

Query: 283 NDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKETEKEKRAVEF 342
             +  ERD    Y GLQ LYDRYF+   G R E+PQ F+MRVAMGLAL E ++E + + F
Sbjct: 134 AAIVPERDALLAYPGLQTLYDRYFIQWQGLRRELPQIFWMRVAMGLALNEADREAQTLRF 193

Query: 343 YNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGN 402
           Y +LS FHF  +TPTLFN+ T HPQLSSC+L+TV DDL  IFGA+ +NAML+K++GGLGN
Sbjct: 194 YEVLSQFHFTSATPTLFNAATTHPQLSSCYLSTVGDDLEAIFGAISDNAMLSKWAGGLGN 253

Query: 403 DWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEF 462
           DWTPVR LGA IHGTNG SQGVIPFLK+ NDTA+AVNQGGKRKGAVCAYLE WH D+E+F
Sbjct: 254 DWTPVRALGAPIHGTNGVSQGVIPFLKIVNDTAIAVNQGGKRKGAVCAYLEAWHADLEDF 313

Query: 463 LDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAY 522
           LDLRK TGD+RRRTHDM+TA W+PDL M+RV  N  W+LFSPDEV DLHDLYG++F + Y
Sbjct: 314 LDLRKPTGDERRRTHDMHTALWVPDLLMERVLSNGSWSLFSPDEVPDLHDLYGQDFAVRY 373

Query: 523 ENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSS 582
             YE  A +G ++  R++ AVALWRK+LT LFETGHPWIT+KD  N+RSPQ HVGV+HSS
Sbjct: 374 AEYEALAAQGLMRSARQVEAVALWRKVLTRLFETGHPWITWKDAANVRSPQDHVGVIHSS 433

Query: 583 NLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHT 642
           NLCTEI LN+S++E AVCNLGSINL AH  +   D +KL +T+ TAVR+LDNVIDIN + 
Sbjct: 434 NLCTEILLNTSADEIAVCNLGSINLAAHIRDGSLDLEKLRTTVTTAVRMLDNVIDINFYP 493

Query: 643 IEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELA 702
             +A ++N  HR IGLGLMGFQ AL+ L I YAS  AVE +D SME I++ A++AS+ELA
Sbjct: 494 RPQAAQANARHRPIGLGLMGFQDALYALKIGYASQAAVEFSDRSMEAIAYFAVAASIELA 553

Query: 703 QERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNS 761
           +ERGAY SF+GS WD+G+ PIDS+ +LAE RD +  ++ +S   W  L++ +   G+RNS
Sbjct: 554 RERGAYPSFRGSKWDRGMLPIDSLAILAEQRDSKPELDHSSHYDWQPLREALAQYGIRNS 613

Query: 762 NCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMI 821
           N +AIAPTATIANI G SQSI+P+Y++LYVKSN+SGDFT VN  LV+ LK R LWD  ++
Sbjct: 614 NLLAIAPTATIANIVGTSQSIEPTYRHLYVKSNLSGDFTTVNRALVDALKARGLWDVDLL 673

Query: 822 SDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPS 881
           ++LKY+DG+I  IERIP +LK    TAFEI P WLI  A+RRQKWID  QSLNLY+ E S
Sbjct: 674 AELKYYDGAISQIERIPAELKTQFLTAFEIAPEWLIACAARRQKWIDMGQSLNLYVAETS 733

Query: 882 GKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGKLNAVPVTDPNSSTHSLGIP 941
           GK+L+ IY  AW MGLKTTYYLR+ +AT +EKSTL      +    + + + S   L   
Sbjct: 734 GKRLNEIYLTAWRMGLKTTYYLRTLAATQIEKSTLDINRFGVQPRWMRNRSESASVLSDN 793

Query: 942 SSCTSDTECEVCQ 954
                D  CE C+
Sbjct: 794 VCPIDDPSCEACE 806


>gi|289677033|ref|ZP_06497923.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. syringae FF5]
          Length = 762

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/734 (58%), Positives = 543/734 (73%), Gaps = 6/734 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEEQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
             DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 RADGSFAPLDMGRLNTIVTEACEGLAEVDADLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVTAGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  + + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVDGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTSRLP 745
           E +S++AI AS +LA ERGAY +F+GSLW +G+ P+DS  +L E R E  ++++    L 
Sbjct: 690 EAVSYYAIQASCDLADERGAYETFQGSLWSKGILPLDSQQILIEQRGEKYISVDLKETLD 749

Query: 746 WDELKKRVKTIGMR 759
           W  ++ RV+  G+R
Sbjct: 750 WAPVRARVQK-GIR 762


>gi|269302770|gb|ACZ32870.1| ribonucleoside-diphosphate reductase, alpha subunit, truncated
           [Chlamydophila pneumoniae LPCoLN]
          Length = 815

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/815 (53%), Positives = 569/815 (69%), Gaps = 14/815 (1%)

Query: 147 IMMDDGTLISFNSKRLEMIVEEACSGL-QDVSSKIVLSETYKNMYDGLSESDLETALIFS 205
           +  +DGT        LE     AC    +   S+++    + N+Y G+ E ++ TA I +
Sbjct: 8   VQKEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEEEVTTACIMA 67

Query: 206 SRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVK 265
           +R  IE+EP+YA + A  L   L  E L    + P  +  H+      ++F  YI  G +
Sbjct: 68  ARANIEREPDYAFIAAELLTSSLYEETLGCNSQDPNLSEIHK------KHFKEYILNGEE 121

Query: 266 ARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVA 325
            RL +  + D+DL  L+  L   RD  F Y+G+Q LYDRYF    G R+E  Q F+MRV+
Sbjct: 122 YRL-NPQLKDYDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRRLETAQIFWMRVS 180

Query: 326 MGLALKETEKEK-RAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIF 384
           MGLAL E E++   A+ FYNLLS+F +  +TPTLFNSG RH QLSSC+L+TV DDL  I+
Sbjct: 181 MGLALNEGEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIY 240

Query: 385 GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKR 444
             + +NA+L+K++GG+GNDWT VR  GA I GTNGKSQGVIPF+KVANDTA+AVNQGGKR
Sbjct: 241 KVISDNALLSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKR 300

Query: 445 KGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSP 504
           KGA+C YLE WH+D E+FL+LRKNTGD+RRRTHD+NTA+WIPDLF KR+ +   WTLFSP
Sbjct: 301 KGAMCVYLENWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEKKGMWTLFSP 360

Query: 505 DEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFK 564
           D+V  LH+ YG EFE  YE YER+ + GEI++++K+ A  LWRKML+ML+ETGHPWITFK
Sbjct: 361 DDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSMLYETGHPWITFK 420

Query: 565 DPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLAST 624
           DP NIRS Q HVGVV  SNLCTEI LN S  ETAVCNLGSINL+ H  N + D +KL  T
Sbjct: 421 DPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNGKLDEEKLKET 480

Query: 625 IRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIAD 684
           I  A+R+LDNVID+N +   +AK++N THRA+GLG+MGFQ  L+ L+I YAS EAVE +D
Sbjct: 481 ISIAIRILDNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSD 540

Query: 685 ESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRDE--LAMNRTS 742
           E  E I+++AI AS  LA+ERG Y+S+ GS WD+G  P+D+I LL E R E  + ++ +S
Sbjct: 541 ECSEIIAYYAILASSLLAKERGTYASYSGSKWDRGYLPLDTIELLKETRGEHNVLVDTSS 600

Query: 743 RLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVV 802
           +  W  ++  ++  GMRNS  MAIAPTATI+NI GV+QSI+P Y++L+VKSN+SG+FT+ 
Sbjct: 601 KKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFTIP 660

Query: 803 NSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASR 862
           N++L+ +LK+  LWD  M+ DLKY DGS+  IERIP+ LKK+  TAFEI+P W+IE  SR
Sbjct: 661 NTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSR 720

Query: 863 RQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLKGVDGK 922
           RQKWID   SLNLYL EP GKKL  +Y  AW  GLKTTYYLRS++ATSVEKS +      
Sbjct: 721 RQKWIDMGVSLNLYLAEPDGKKLSNMYLMAWKKGLKTTYYLRSQAATSVEKSFIDINKRG 780

Query: 923 LNAVPVTDPNSSTHSL---GIPSSCTSDTECEVCQ 954
           +    + + ++ST  +        C+ +  CE CQ
Sbjct: 781 IQPRWMKNKSASTSIVVERKTTPVCSMEEGCESCQ 815


>gi|330889422|gb|EGH22083.1| ribonucleotide-diphosphate reductase subunit alpha [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 706

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/675 (59%), Positives = 506/675 (74%), Gaps = 3/675 (0%)

Query: 29  VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
           ++VIKRNG V  +   KI+ AI KAF+AVEG  A+ S R+ D +  LTEQ      +   
Sbjct: 32  LRVIKRNGTVVPYTDDKITVAITKAFLAVEGGNAAASSRIHDTVARLTEQVSATFKRRMP 91

Query: 89  SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
           S   +HIE+IQDQVE +LM++G  K+ R+YV+YR+ R+  RA ++  +      P ++I 
Sbjct: 92  SGGTIHIEEIQDQVELALMRAGEQKVARDYVIYRDSRAKERAVRA-PEDQVQAHPSIRIT 150

Query: 149 MDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRT 208
           + DG+    +  RL  IV EAC GL +V + ++ +ET KN+YDG++  D+ TAL+ ++RT
Sbjct: 151 LADGSFAPLDMGRLNTIVTEACEGLAEVDANLIQTETLKNLYDGVALKDVNTALVMTART 210

Query: 209 LIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARL 268
           L+E+EPNY+ VTAR L++ LR E L  +      ATHHEM  LY +    Y+  G+K  L
Sbjct: 211 LVEREPNYSFVTARLLMDTLRAEGLGFL-GVADSATHHEMADLYAKALPAYVATGIKFEL 269

Query: 269 LHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGL 328
           L+  + +FDL  L   + +ERD  F YLGLQ LYDRYF+H +G R E+PQ FFMRVAMGL
Sbjct: 270 LNPVLAEFDLEKLGKAINHERDQQFTYLGLQTLYDRYFIHKDGVRFELPQIFFMRVAMGL 329

Query: 329 ALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQ 388
           A++E  +E RA+EFYNLLSSF +M STPTLFN+GT  PQLSSC+LTTVPDDL GI+ A+ 
Sbjct: 330 AIEEKAREDRAIEFYNLLSSFDYMSSTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYHAIH 389

Query: 389 ENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAV 448
           +NAML+K++GGLGNDWTPVR LG++I GTNGKSQGV+PFLKV NDTAVAVNQGGKRKGAV
Sbjct: 390 DNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAV 449

Query: 449 CAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVS 508
           CAYLETWH+D+EEF++LRKNTGDDRRRTHDMNTANWIPDLFMKRV  +  WTLFSP EV 
Sbjct: 450 CAYLETWHMDIEEFIELRKNTGDDRRRTHDMNTANWIPDLFMKRVFDDGPWTLFSPSEVP 509

Query: 509 DLHDLYGKEFEIAYENYERQADR-GEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPC 567
           DLHDL GK F+  YE YE   +  G+IK+F+ I A  LWRKML+MLFETGHPW+TFKDPC
Sbjct: 510 DLHDLTGKAFQERYEYYEALTEYPGKIKLFKTIQAKDLWRKMLSMLFETGHPWLTFKDPC 569

Query: 568 NIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRT 627
           N+RSPQQHVGVVHSSNLCTEITLN++ +E AVCNLGSINL  H  N + D DKL  T+  
Sbjct: 570 NLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSINLPNHIVNGKLDTDKLKRTVDV 629

Query: 628 AVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESM 687
           AVR+LDNVIDIN +++ +AK SN  HR +GLG+MGFQ AL+L HIPY S  AV+ AD SM
Sbjct: 630 AVRMLDNVIDINYYSVPQAKNSNLRHRPVGLGIMGFQDALYLQHIPYGSDAAVQFADTSM 689

Query: 688 EFISFHAISASVELA 702
           E +S++AI AS +LA
Sbjct: 690 EAVSYYAIQASCDLA 704


>gi|294055009|ref|YP_003548667.1| ribonucleoside-diphosphate reductase, alpha subunit [Coraliomargarita
            akajimensis DSM 45221]
 gi|293614342|gb|ADE54497.1| ribonucleoside-diphosphate reductase, alpha subunit [Coraliomargarita
            akajimensis DSM 45221]
          Length = 1080

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/944 (46%), Positives = 609/944 (64%), Gaps = 35/944 (3%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            +++I+RNG V  +  SKI  A+ K+F+++            D+ + +T++       +N 
Sbjct: 154  IRLIRRNGQVVPWSESKIEIAVRKSFLSLHLDSGP----AMDVARAVTDRL------NNS 203

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIM 148
                ++IED+QD V+  LM+ GH K+   Y+LYR  R+ +R     ++ D      + ++
Sbjct: 204  GQAFINIEDVQDTVQEELMRQGHFKVAESYILYRAHRTRLRDESGETEVDETQQESMIVV 263

Query: 149  MDDGTLISF-NSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALIFSS 206
             ++    +F +   L+  +E A  GL+  +S+  + +E  +++Y  +   DL+  +I ++
Sbjct: 264  TEENGENTFWDGVDLKRRIEFATIGLELTLSNDEIETELRRSLYPEMKREDLQKTIILNA 323

Query: 207  RTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKA 266
            + LIE++ ++A+   R LL  +  EVL     +       +++  +      Y++  V+ 
Sbjct: 324  KALIERDADFARFAGRVLLSYIYEEVLDWDIVRDGV---EQLKEAHRRGLKTYLKRAVEI 380

Query: 267  RLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFLHINGS----RIEMPQAFFM 322
              +H  ++++DL  L+  L    D  F+YLG+Q LYDRY +    +    R+E+PQ F++
Sbjct: 381  ERVHPKLLEYDLKRLSEALDPSADLDFDYLGVQTLYDRYLIVDKTAKKHRRLEVPQFFWI 440

Query: 323  RVAMGLALKETE-KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLY 381
            RVAMGL   E E +E   +  YNL  S  F  STPTLFNSGT H QLSSC+L  V D + 
Sbjct: 441  RVAMGLFHAEKEDREGYVISLYNLYKSRRFCSSTPTLFNSGTLHSQLSSCYLYKVDDSIE 500

Query: 382  GIFG-ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQ 440
             I    + +NA L+K++GGLG  WT VRG G  I GTNG+SQGVIPFLK+ ND  VAVNQ
Sbjct: 501  SIMHRGIADNAFLSKWAGGLGGSWTAVRGTGGFIKGTNGESQGVIPFLKLHNDQLVAVNQ 560

Query: 441  GGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWT 500
            GGKR+G+ CAYLETWH D+ +FL+LRKNTGDDRRRTHDMNTANWIPDLFMKR+     WT
Sbjct: 561  GGKRRGSGCAYLETWHNDIHDFLELRKNTGDDRRRTHDMNTANWIPDLFMKRMEARQDWT 620

Query: 501  LFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPW 560
            LF  +E  DLHDLYGK FE  Y  YE  A+RGE+   +K+ A+ LW+ ML M+FETGHPW
Sbjct: 621  LFRSNETPDLHDLYGKAFEDRYCEYEAMAERGEL-FGKKVPAIELWKSMLRMIFETGHPW 679

Query: 561  ITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQFDYD 619
            ITFKDPCN+RSPQ H GV+HSSNLCTEITLN+S EETAVCNLGS+ L +H   +   D++
Sbjct: 680  ITFKDPCNVRSPQDHAGVIHSSNLCTEITLNTSDEETAVCNLGSVVLDSHLDKDGNLDHE 739

Query: 620  KLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEA 679
            KL  T+  AVR LDNVIDIN +  E AK +N  HR IGLG+MG Q+AL +  I +AS  A
Sbjct: 740  KLRETVSIAVRALDNVIDINFYPTEAAKTANSRHRPIGLGVMGLQNALFVKDIAFASQAA 799

Query: 680  VEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVR-DELAM 738
            VE  DE ME I+++A  AS +LA E G YS++KGS WD+G+ P D++ +L   R +E+ +
Sbjct: 800  VEFNDEFMEAIAYYAYEASSDLAAEHGTYSTYKGSKWDRGLMPQDTLDMLQSERGEEVVV 859

Query: 739  NRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGD 798
             R  ++ W+ L+ ++   GMRNSN +AIAPTATI+NI G S  I+P+Y+NL+VKSN+SGD
Sbjct: 860  PRAGKMDWNPLRAKIAKQGMRNSNVLAIAPTATISNIMGTSPCIEPTYKNLFVKSNLSGD 919

Query: 799  FTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIE 858
            F V+N  LV +LK R LWD+ M+  LKY DG +  I+ IP DL++ + TAF I+  + I+
Sbjct: 920  FIVLNGHLVRDLKSRGLWDQDMLDQLKYFDGELNAIDGIPADLREKYKTAFTIEYQYFID 979

Query: 859  SASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL-- 916
            +A+RRQKWIDQ+QS+NL+L EP  K L  +YR AW  GLKTTYYLR+  A+++EK+T+  
Sbjct: 980  AAARRQKWIDQSQSVNLFLAEPDIKTLSHMYRDAWRKGLKTTYYLRTLGASNIEKATVSV 1039

Query: 917  -KGVDGKL-NAVPV----TDPNSSTHSLGIPSSCTSDTECEVCQ 954
             K V G+  +A P     TD      SL    +  +  ECE CQ
Sbjct: 1040 KKEVRGRAGDATPAKKEYTDAEVKACSL---EAMMNGGECEACQ 1080


>gi|254444373|ref|ZP_05057849.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
            [Verrucomicrobiae bacterium DG1235]
 gi|198258681|gb|EDY82989.1| ribonucleoside-diphosphate reductase, alpha subunit, putative
            [Verrucomicrobiae bacterium DG1235]
          Length = 1062

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/917 (47%), Positives = 598/917 (65%), Gaps = 29/917 (3%)

Query: 26   IKGVQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQ 85
            +K V++I+R+  V  +   KI  A+ +AF+++E + +  ++ V  I        VT  +Q
Sbjct: 151  LKNVRLIRRDRKVVPWKQEKIEIAVRRAFLSLE-QNSDPAVEVAAI--------VTERIQ 201

Query: 86   HNKSALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQS-HSKSDAPIAPK 144
                A  V IE++QD V+  LM+ GH K+   YVLYRE+R   R  ++    +D      
Sbjct: 202  ATGQAF-VEIEEVQDIVQEELMKQGHFKVAAHYVLYREQRRAHREQEALQLATDTEQDSM 260

Query: 145  LKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLETALI 203
            + +   DG+   ++   L+  +E A  GL   ++   +  E  ++++D +SE+DLE  + 
Sbjct: 261  VVVKKTDGSTYFWDGIDLKKRIEFASIGLDLCLNHDEIEIELRRSIFDEISEADLEKTIT 320

Query: 204  FSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
             ++RTLIE++ ++AK  AR  L  + +E L     +        ++  + + F  Y+  G
Sbjct: 321  LNARTLIEQDADFAKFAARIKLSYMYQETLGWDIVRDGIGA---IKTFHQKKFKEYVRHG 377

Query: 264  VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL----HINGSRIEMPQA 319
            +    L+  + ++D+  LA  L    D  F+YLG+Q LYDRY +         RIE PQ 
Sbjct: 378  IMIGRLNPKLKEYDINKLAKQLDPSADLEFDYLGIQTLYDRYLIIDKTQKQQRRIETPQF 437

Query: 320  FFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
            F+MRVAMGL   E E+E +A   Y L  S  F  STPTLFN+GT H QLSSC+L  V D 
Sbjct: 438  FWMRVAMGLFHAEEERELKAKTLYKLYKSRRFCSSTPTLFNAGTCHSQLSSCYLYYVDDS 497

Query: 380  LYGIFG-ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAV 438
            + GI    + +NA L+K++GGLG  WT VRG G++I GTNG+SQG++PFLK+ ND  +AV
Sbjct: 498  IEGIMQRGIADNAYLSKWAGGLGGSWTSVRGTGSYIKGTNGESQGIVPFLKLHNDLLIAV 557

Query: 439  NQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAG 498
            NQGGKR+G+ CAYLETWH D+ +FL+LRKNTGDDRRR HDMNTANW+PDLFMKR+     
Sbjct: 558  NQGGKRRGSGCAYLETWHNDLYDFLELRKNTGDDRRRCHDMNTANWVPDLFMKRMEARQM 617

Query: 499  WTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGH 558
            W+ F   EV DLHD YG +FE  Y  YE +A +GEI   +++ A+ +W++ML+M+FETGH
Sbjct: 618  WSFFRTSEVPDLHDSYGADFEKKYTEYEAKAAKGEI-WSKEVPAIEVWKRMLSMIFETGH 676

Query: 559  PWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHF-ANNQFD 617
            PWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+S EETAVCNLGSI L  H   +   D
Sbjct: 677  PWITFKDPCNVRSPQDHCGVVHSSNLCTEITLNTSKEETAVCNLGSIVLDQHLDKDGNID 736

Query: 618  YDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASP 677
            +DKL  T++TA+R LDNVIDIN +  E AK +N  HR IGLG+MG Q+ L+L   P+AS 
Sbjct: 737  HDKLRETVQTAIRALDNVIDINFYPTEAAKLANSRHRPIGLGIMGLQNCLYLRDTPFASQ 796

Query: 678  EAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-EL 736
            EAVE  DE ME ++++AI AS +LA ERG Y S+KGS WD+G+ P D++ LL + R  E+
Sbjct: 797  EAVEFNDEIMEAVAYYAIEASSDLAAERGTYKSYKGSKWDRGLLPQDTVDLLEKERGVEV 856

Query: 737  AMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMS 796
             + R  +L W  ++++V   GMRNSN MAIAPTATI+NI G S  I+P Y+NL+VKSN+S
Sbjct: 857  DVPRGGKLDWTPIREKVTKHGMRNSNVMAIAPTATISNITGTSPCIEPGYKNLFVKSNLS 916

Query: 797  GDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWL 856
            G+F ++N  LV +LK R LW+  M  +LKY DG +  I+ IP DLK  + TAF +D  WL
Sbjct: 917  GEFIILNQHLVRDLKARGLWNAEMRDNLKYFDGELEEIDSIPADLKAKYKTAFSVDYSWL 976

Query: 857  IESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKST- 915
            + +A+RRQKWIDQ+QS+NL+L  P  K L  +YR AW  GLKTTYYLR+  A+++EK+T 
Sbjct: 977  VLAAARRQKWIDQSQSVNLFLASPDMKTLSHMYRAAWKHGLKTTYYLRTLGASNIEKATV 1036

Query: 916  -----LKGVDGKLNAVP 927
                 L+G+ G   A P
Sbjct: 1037 GAKKELRGIVGGKAAPP 1053


>gi|284043178|ref|YP_003393518.1| ribonucleoside-diphosphate reductase, subunit alpha [Conexibacter
            woesei DSM 14684]
 gi|283947399|gb|ADB50143.1| ribonucleoside-diphosphate reductase, alpha subunit [Conexibacter
            woesei DSM 14684]
          Length = 1091

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/951 (44%), Positives = 592/951 (62%), Gaps = 47/951 (4%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
            +++I+R+G VT+++P+KI  AI KAF++++      S     +   ++E+       H  
Sbjct: 163  LRLIRRSGHVTAWEPAKIEVAIRKAFLSLQAD----SEPAVALAARVSERA------HAL 212

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIA------ 142
                V IE +QD V+  L+ +GH +    Y++YR ERS +RA       DAP+       
Sbjct: 213  GMAYVPIETVQDIVQEELVLAGHMRAAERYIVYRAERSLLRA------QDAPVPGAPGSG 266

Query: 143  --PKLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDLE 199
              P + ++  DGT   +  + L   +  A  GL   ++ + +  E  + +  G+  +DL 
Sbjct: 267  AQPPVPVIELDGTESLWGGEDLRARIAFAAIGLDLPLAPEELERELRRAIRPGIKRADLR 326

Query: 200  TALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRY 259
               + +++ L+E++ ++++   R LL  +  E L     +        ++  +       
Sbjct: 327  RLTVLNAKALVERDSDFSRFAGRILLSHVYEEALAWDIVRDGVGA---LKAAHERGLRAL 383

Query: 260  IEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL----HINGSRIE 315
            +E GV    +  ++ D+D+  LA  L    D  F++LGLQ LYDRY +         RIE
Sbjct: 384  LEHGVAIGRIDPALHDYDVARLAAALDPTADLDFDFLGLQTLYDRYLIVDKKAAEPRRIE 443

Query: 316  MPQAFFMRVAMGLALKETE-----KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSS 370
             PQ F+MRVAMG+ L   +     +E+RA++ Y +     F  STPTLFN+GT H QLSS
Sbjct: 444  TPQLFWMRVAMGVCLTARDGDPAAREERAIDLYTMYKQRRFCSSTPTLFNAGTPHSQLSS 503

Query: 371  CFLTTVPDDLYGIFG-ALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLK 429
            C+L  + D L  I G  + ENAM +K++GGLG  WT VRG G+HI  TNG+SQGV+PFLK
Sbjct: 504  CYLYKIEDTLSSIVGRGIAENAMCSKWAGGLGGSWTAVRGTGSHIESTNGESQGVVPFLK 563

Query: 430  VANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLF 489
            + ND  VAVNQGGKR G+ CAYLE WH D+ EFL+LR+NTGD+RRRTHDMNTANWIPDLF
Sbjct: 564  MHNDQLVAVNQGGKRAGSGCAYLEVWHNDIREFLELRRNTGDERRRTHDMNTANWIPDLF 623

Query: 490  MKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKM 549
            MKRV     WTLF  ++V DLH+ YG++FE  YE YE + D GE+   R I A+ LW++M
Sbjct: 624  MKRVEAREQWTLFRSNDVPDLHETYGRDFEARYEAYEARVDAGELHGER-IPAIELWKQM 682

Query: 550  LTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLA 609
            L +LFETGHPWITFKDPCN+RSPQ H GVVHSSNLCTEITLN+  +ETAVCNLGS+ +  
Sbjct: 683  LKLLFETGHPWITFKDPCNVRSPQDHAGVVHSSNLCTEITLNTGPDETAVCNLGSVVIDQ 742

Query: 610  HF-ANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALH 668
            H  A  + D+ KL +TIR AVR LD+VID+N +  E A+ +N  HR +GLG+MG Q AL+
Sbjct: 743  HLDAAGEIDHAKLRATIRVAVRALDDVIDVNFYPTEPARTANGRHRPVGLGVMGLQYALY 802

Query: 669  LLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGL 728
               + + SPEA+   DE ME I+F+A  AS +LA ERG Y S+ GS WD+G+ P D++ L
Sbjct: 803  RKGLAFGSPEALAFGDEMMEAIAFYAYEASSDLAAERGTYQSYAGSKWDRGLLPQDTLDL 862

Query: 729  LAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQ 787
            L E R + + + R  R+ W  L+ ++   GMRNSN +AIAPTATIANI G S  I+P Y+
Sbjct: 863  LEEERGQPIEVERGGRMDWTPLRAKIAAQGMRNSNVLAIAPTATIANIMGTSPCIEPMYK 922

Query: 788  NLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHAT 847
            NL+ KSN+SGDFT++N FLV +LK   +W  A+   LK  +G +  +  +P  L+ ++ T
Sbjct: 923  NLFAKSNLSGDFTILNPFLVRDLKAAGVWSGALAERLKVVEGDLEQVPEVPAALRALYRT 982

Query: 848  AFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRS 907
            AF+I+P  LI++A+RRQKWIDQ+QSLNL+L  P  K +  +YR+AW  GLKTTYYLR+  
Sbjct: 983  AFQIEPERLIDAAARRQKWIDQSQSLNLFLAAPDLKAMSHMYRRAWHAGLKTTYYLRTLG 1042

Query: 908  ATSVEK----STLKGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVCQ 954
            A+++EK    +           +P T P++   +  I  +  +  ECE CQ
Sbjct: 1043 ASAIEKATVAAPAAATVPAAAGMP-TAPDAEALACSI-EAMRNGEECEACQ 1091


>gi|171913277|ref|ZP_02928747.1| ribonucleotide-diphosphate reductase subunit alpha [Verrucomicrobium
            spinosum DSM 4136]
          Length = 1109

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/904 (45%), Positives = 585/904 (64%), Gaps = 31/904 (3%)

Query: 29   VQVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNK 88
             ++I+RNG V S++P+KI  A+ KAF++VE      +   + + + LT Q +    Q   
Sbjct: 170  TKIIRRNGQVVSWNPNKIELAVSKAFVSVEMG----TTHAKAVAEALTHQMIEEAKQ--- 222

Query: 89   SALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSD--APIAP--- 143
                +HIE +QD VE  LM+ GH K  + Y+LYR  R+D R   + S +D  AP  P   
Sbjct: 223  ---FIHIEQVQDLVEEQLMRQGHFKAAKAYMLYRALRADSRERDAKSAADISAPELPVDD 279

Query: 144  ----KLKIMMDDGTLISFNSKRLEMIVEEACSGLQ-DVSSKIVLSETYKNMYDGLSESDL 198
                 + + + D   I ++   L+  ++ A  GL   +S   + S   +++   +S   L
Sbjct: 280  GQQEMIMVRISDKETILWDGLDLQRRIDFAMMGLDLCISRAEIESSLRRSLATDISLDHL 339

Query: 199  ETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCR 258
            +  +I +++ L+ ++ ++A+  AR LL  +  EVL     +    +   +Q  +   F R
Sbjct: 340  KQTIILNAKALMARDADFARFAARILLSYIYEEVLGWDIVRDGIGS---LQTFHRRAFRR 396

Query: 259  YIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRYFL----HINGSRI 314
             ++ GV+   ++  ++DFDL  LA+ L    D  F+YLG+  LYDRY +         R+
Sbjct: 397  NLQRGVEIDRINAKLLDFDLDKLADALDPAADMDFDYLGIHTLYDRYLIIDKKTKPAKRL 456

Query: 315  EMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLT 374
            E PQ F+MRVAMGL ++E +  ++ +  Y +  S  F  STPTLFNSGT H QLSSC+L 
Sbjct: 457  ETPQLFWMRVAMGLFVREEDPTEKVIALYRMYKSRRFCSSTPTLFNSGTLHSQLSSCYLY 516

Query: 375  TVPDDLYGIF-GALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVAND 433
             V D++  I    + ENA L+K++GGLG  WT VRG G++I GTNG+SQGVIPFLK+ ND
Sbjct: 517  KVDDNIESIMIRGIAENAFLSKWAGGLGGSWTAVRGTGSYIKGTNGESQGVIPFLKLHND 576

Query: 434  TAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRV 493
              VAVNQGGKR+G+ CAYLETWH D+ +FLDLRKN GD+RRRTHDMNTANW+PDLFMKR+
Sbjct: 577  QLVAVNQGGKRRGSGCAYLETWHNDIVDFLDLRKNVGDERRRTHDMNTANWVPDLFMKRM 636

Query: 494  TQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTML 553
               + WTLF  +E  DLH+LYG+ FE  Y  YE  A  G++ + ++I A+ LW+ ML  +
Sbjct: 637  EARSHWTLFRANETPDLHELYGQAFEKRYLEYEAMAAEGKV-LGKQIPAIDLWKSMLKAI 695

Query: 554  FETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFAN 613
            FETGHPWITFKDPCN+RSPQ H GV+HSSNLCTEITLN+S +ETAVCNLGS+ L  H   
Sbjct: 696  FETGHPWITFKDPCNVRSPQDHAGVIHSSNLCTEITLNTSKDETAVCNLGSVILENHLDE 755

Query: 614  -NQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
                D+ KL  T+R AVR LDNVIDIN +  + AK +N  HR IGLG+MG Q +L+   +
Sbjct: 756  AGNIDHTKLRETVRMAVRALDNVIDINFYPTDAAKTANTRHRPIGLGVMGLQYSLYRKGL 815

Query: 673  PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
            P+AS EAV+  DE ME ++++A  AS +LA E G YS++ GS W +G+ P D++ LL + 
Sbjct: 816  PFASKEAVDFNDEVMEAVAYYAYEASSDLAAELGKYSTYPGSKWSRGLLPQDTVDLLEKE 875

Query: 733  RDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYV 791
            R E + + R  ++ W  +++++   GMRNSN +AIAPTATI+NI G S  I+P + N + 
Sbjct: 876  RGEPVDVVRGGKMDWSPVREKIAKQGMRNSNVLAIAPTATISNIMGSSPCIEPLFTNNFT 935

Query: 792  KSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEI 851
            KSN+ G++ V+N +LV +LK+RDLW   +   LKY DG +  ++ IP DLK+ +ATAF +
Sbjct: 936  KSNLGGNYVVLNPYLVKDLKKRDLWTNEVAERLKYFDGELAAMDEIPADLKRKYATAFSV 995

Query: 852  DPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSV 911
            D  +++++A+RRQKWIDQ+QS+NL+  +   + L  +YR AW  GLKTTYYLR++ A+S+
Sbjct: 996  DWAYVLDAAARRQKWIDQSQSVNLWCPDTDMRTLSHMYRAAWRKGLKTTYYLRTKGASSI 1055

Query: 912  EKST 915
            E ST
Sbjct: 1056 EGST 1059


>gi|289582311|ref|YP_003480777.1| ribonucleoside-diphosphate reductase, subunit alpha [Natrialba
           magadii ATCC 43099]
 gi|289531864|gb|ADD06215.1| ribonucleoside-diphosphate reductase, alpha subunit [Natrialba
           magadii ATCC 43099]
          Length = 836

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/763 (51%), Positives = 530/763 (69%), Gaps = 14/763 (1%)

Query: 162 LEMIVEEACSGLQDVSSKI----VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYA 217
           +E +++ A +G ++V S      + +E  +N+YDG S  +   A++ +    IE+EP Y 
Sbjct: 15  IESVLDRAQTGTEEVLSPAERDQLATEIERNLYDGASPDECYQAILQALTARIEREPTYK 74

Query: 218 KVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD-F 276
           ++ A    ++  R VL       +  T   ++  Y + F   +E  V+  LL E +++ F
Sbjct: 75  QLAAAVFRQRYYRTVLG------EDLTGAALETAYRDTFVTNLERAVELDLLDERLLERF 128

Query: 277 DLVYLANDLKYERDFAFEYLGLQILYDRYFLHI--NGSRIEMPQAFFMRVAMGLALKETE 334
           DL  LA  L+ ERD  FEY+ ++ L  RYFL    NG  +E+PQAF+MRVAMGLAL+E +
Sbjct: 129 DLEKLAAALELERDEQFEYMAMETLTQRYFLKTEENGEHLELPQAFWMRVAMGLALEEDD 188

Query: 335 KEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLA 394
            ++RA+EFY++LS+  F  STPTLF+SG+ HPQLSSC+LTTV D L  IF + + +A L+
Sbjct: 189 PQQRALEFYDVLSALEFTPSTPTLFHSGSTHPQLSSCYLTTVQDSLENIFDSYKHHAQLS 248

Query: 395 KYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLET 454
           K+SGGLGNDWT +R  GA I  T  +S GV+PFL+++ND   A+N+ GKR+GA CAYL  
Sbjct: 249 KWSGGLGNDWTNLRSAGALIESTGVESTGVVPFLRISNDVTSAINRSGKRRGAACAYLAC 308

Query: 455 WHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLY 514
           WH+D   F DL++NTGD+RRRT DMNTA WIPDLFMKRV  +  WTLFSPDEV +LHDL 
Sbjct: 309 WHLDFPAFTDLKRNTGDERRRTPDMNTAAWIPDLFMKRVEADEEWTLFSPDEVPELHDLS 368

Query: 515 GKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQ 574
           G+ FE  Y  YERQAD GE++ + ++ A  LWR MLT LFETGHPW+TFKDPCN+RSPQ 
Sbjct: 369 GEAFEERYCEYERQADNGELRQYERVDAAELWRTMLTRLFETGHPWLTFKDPCNVRSPQD 428

Query: 575 HVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDN 634
           HVG VHSSNLCTEITLN+S++E AVCNLGS+NL  H ++ + D + LA TI TA+R+LDN
Sbjct: 429 HVGTVHSSNLCTEITLNTSADEHAVCNLGSVNLATHVSDGELDREHLADTIETAMRMLDN 488

Query: 635 VIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHA 694
           V+D+  +  E+AK+SN  HR +GLG MGF  AL  L IP  S +AVE A+   EF+S+HA
Sbjct: 489 VVDLCFYPTEEAKRSNMRHRPVGLGTMGFHDALMELGIPMDSEDAVEAANRWQEFVSYHA 548

Query: 695 ISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRV 753
           I  S +LA ERGAY S++GS WD+G+ P D++ LL + RD E+  +R   L W  +++ V
Sbjct: 549 ILNSSKLAGERGAYPSYEGSKWDRGLLPQDTVDLLEDERDREIPTDREETLEWATVREHV 608

Query: 754 KTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQR 813
              GMRNSN MAIAPTAT++ I G + SI+P Y NLYVKSNMSGDFTV+N  LV +LK R
Sbjct: 609 AEHGMRNSNTMAIAPTATVSTINGTTPSIEPIYSNLYVKSNMSGDFTVINDKLVADLKAR 668

Query: 814 DLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSL 873
           D WD+ M+  LK+HDGS+  I+ +PDDL++++  AFEIDP   +   + RQ WIDQ+ S 
Sbjct: 669 DRWDDEMVDRLKFHDGSVQEIDTVPDDLQELYRGAFEIDPRHQLRLTAHRQTWIDQSVSH 728

Query: 874 NLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
           N++     G  LD +YR AW +GLKTTYYLR+  A+ +EKSTL
Sbjct: 729 NVFFPSTDGSLLDDVYRTAWELGLKTTYYLRTLGASQIEKSTL 771


>gi|257053404|ref|YP_003131237.1| ribonucleoside-diphosphate reductase, alpha subunit [Halorhabdus
           utahensis DSM 12940]
 gi|256692167|gb|ACV12504.1| ribonucleoside-diphosphate reductase, alpha subunit [Halorhabdus
           utahensis DSM 12940]
          Length = 815

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/764 (51%), Positives = 511/764 (66%), Gaps = 12/764 (1%)

Query: 159 SKRLEMIVEEACSGLQDV--SSKIVLSETY-KNMYDGLSESDLETALIFSSRTLIEKEPN 215
           + R+  I++ A  G   V  S +  L     +N Y G   +++  A++ +    IE +P 
Sbjct: 9   TDRIASILDRATDGEPTVTESDRTALRRAIDENCYAGADRAEVYEAILGTLSARIEAKPA 68

Query: 216 YAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD 275
           Y +V AR   ++   EV+       +  T  E+   Y   F   IE GV   LL   ++D
Sbjct: 69  YKRVAARVFRQRYYHEVIG------EDLTGTELDRAYRTIFRENIERGVATDLLDTRLVD 122

Query: 276 -FDLVYLANDLKYERDFAFEYLGLQILYDRYFLHIN-GSRIEMPQAFFMRVAMGLALKET 333
            FDL  LA  L  ERD  FEYL ++ LY RYFL  N G  +E+PQAF+MRVAMGLA++E 
Sbjct: 123 RFDLDALAEYLAPERDEHFEYLAMETLYQRYFLRTNDGEHLELPQAFWMRVAMGLAVEED 182

Query: 334 EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAML 393
           +   RA EFY++LS   F  STPTLF+SGT HPQLSSC+LTTVPDDL GIF A + +A L
Sbjct: 183 DPNARAKEFYDVLSKLEFTPSTPTLFHSGTTHPQLSSCYLTTVPDDLEGIFDAYKHHAQL 242

Query: 394 AKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLE 453
           +K+SGGLGNDWTP+R  GA I  T  +S GV+PFL+++ND   A+N+ GKR+GA CAYL 
Sbjct: 243 SKWSGGLGNDWTPLRAEGALIESTGVESTGVVPFLRISNDVTAAINRSGKRRGAACAYLA 302

Query: 454 TWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDL 513
            WH+D   F+DL++ TGD+RRRT DMNTA WIPDLFM+RV     WTLFSPDEV DLH+ 
Sbjct: 303 IWHLDFPAFVDLKRATGDERRRTPDMNTAAWIPDLFMERVQAGESWTLFSPDEVGDLHEA 362

Query: 514 YGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQ 573
            G+ F   Y  YE+ A+ G+I+ F  + A  LWR +LT LFETGHPW+TFKDPCNI SPQ
Sbjct: 363 TGEAFAEKYREYEQAAENGDIENFETVEAAELWRTLLTRLFETGHPWVTFKDPCNIGSPQ 422

Query: 574 QHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLD 633
            H G + SSNLCTEITLN+S++E AVCNLGS+N   H  + + D D L  T+ TA+R+LD
Sbjct: 423 DHEGTIRSSNLCTEITLNTSTDEHAVCNLGSVNFATHMRDGELDRDYLEDTVETAMRMLD 482

Query: 634 NVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFH 693
           NV+D+  +  E+A+ SN  HR +GLG MGF  AL  + +P  S EAVE A+   EF+++H
Sbjct: 483 NVVDLCFYPTEEAEDSNMRHRPVGLGTMGFHEALMEIGVPMNSNEAVEKANRWQEFVAYH 542

Query: 694 AISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKR 752
           AI  S ELA ERGAY SF+GS WD+ + P D++ LL E R  E+   RT  L WD ++K 
Sbjct: 543 AIRTSSELAGERGAYPSFEGSKWDRDILPQDTVDLLEEERGREIPTERTETLEWDAVRKS 602

Query: 753 VKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQ 812
           +   GMRNSN MAIAPTAT++ I G + SI+P Y NLYVKSNMSGDFT+VN  LV +L++
Sbjct: 603 IAEHGMRNSNTMAIAPTATVSTINGTTASIEPQYSNLYVKSNMSGDFTIVNDHLVADLRE 662

Query: 813 RDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQS 872
           RDLWD+ M   +KYHDGSI  IE IP+DL++++  AFEIDP   +   + RQ WIDQ+ S
Sbjct: 663 RDLWDDEMRDRIKYHDGSIQEIEAIPEDLRELYRGAFEIDPRHQLRLTAHRQTWIDQSVS 722

Query: 873 LNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL 916
            N++     G  LD IY  AW +GLKTTYYLR+  A+ VEKSTL
Sbjct: 723 HNVFFPSTDGTLLDDIYTTAWELGLKTTYYLRTLGASQVEKSTL 766


>gi|313117006|ref|YP_004038130.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Halogeometricum borinquense DSM 11551]
 gi|312294958|gb|ADQ68994.1| ribonucleoside-diphosphate reductase, alpha subunit
           [Halogeometricum borinquense DSM 11551]
          Length = 845

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/801 (48%), Positives = 534/801 (66%), Gaps = 16/801 (1%)

Query: 162 LEMIVEEACSGLQDVSSKIVL----SETYKNMYDGLSESDLETALIFSSRTLIEKEPNYA 217
           +  I+ +A +G +DV +  V+    +ET +N+YDG S  ++  AL   +   IE++P Y 
Sbjct: 12  VRTILNQARTGYEDVLTDEVMDRLVTETERNLYDGASIDEVYEALEGVTTARIERDPAYK 71

Query: 218 KVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD-- 275
            V A     +  R V     ++  +    +    Y E F   +E GV   LL E ++D  
Sbjct: 72  YVAADIHRRRYFRRV---TGEQLSETADDDTATTYRETFAANLERGVDEDLLDERLLDGR 128

Query: 276 FDLVYLANDLKYERDFAFEYLGLQILYDRYFL--HINGSRIEMPQAFFMRVAMGLALKET 333
           FD+  LA+ L  ERD  F+Y+ +  L  RYF+   ++G  +E+PQAF+MRVAMGLA++E 
Sbjct: 129 FDIDELADALVLERDDKFDYIAMSTLTQRYFIKTEVDGDPLELPQAFWMRVAMGLAIEED 188

Query: 334 EKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAML 393
           + + RA+EFY++LS   F  STPTLF+SGT HPQLSSC+LTTV DDL  IF + + +A L
Sbjct: 189 DPQARALEFYDVLSRLLFTPSTPTLFHSGTTHPQLSSCYLTTVEDDLEHIFDSYKHHAQL 248

Query: 394 AKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLE 453
           +K+SGGLGNDWT +R  GA I  T  +S G +PFLK++ND   A+N+ GKR+GA C YLE
Sbjct: 249 SKWSGGLGNDWTNLRAEGALIESTGVESTGTVPFLKISNDVTAAINRSGKRRGAACGYLE 308

Query: 454 TWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDL 513
            WH+D   FLDLR+NTGD+RRRTHDMNTA W+PDLFM+RV  +  WTLFSPDEV +LH+ 
Sbjct: 309 AWHMDFPAFLDLRRNTGDERRRTHDMNTAAWVPDLFMERVENDETWTLFSPDEVPELHET 368

Query: 514 YGKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQ 573
           YG+EF   Y  YE +A+ GE++ +  + A  LWR MLT LFETGHPWITFKDPCN+RSPQ
Sbjct: 369 YGEEFAELYREYEEKAEAGELRQYETVDAADLWRTMLTRLFETGHPWITFKDPCNVRSPQ 428

Query: 574 QHVGVVHSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLD 633
            HVG VHSSNLCTEITLN+S+EE AVCNLGS+NL  H A+++ D + LA TI TA R+LD
Sbjct: 429 DHVGTVHSSNLCTEITLNTSAEEHAVCNLGSVNLSNHVADSELDREALADTIETATRMLD 488

Query: 634 NVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFH 693
           NV+D+  +  ++A+ SN  HR +GLG+MGF  AL  +    AS EAVE A+   EF+S+H
Sbjct: 489 NVVDLCFYPTDEAEYSNMRHRPVGLGVMGFHDALMQVGTSMASEEAVEAANRWQEFVSYH 548

Query: 694 AISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLL-AEVRDELAMNRTSRLPWDELKKR 752
            I  S  LA+ERGAY +F+GS WD+G+ P D++  L AE   E+  +R+  + WD ++  
Sbjct: 549 TILNSSRLAKERGAYETFEGSKWDRGILPHDTVDRLEAERGREIPTDRSETMDWDRVRDH 608

Query: 753 VKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQ 812
           +   GMRNSN MAIAPTATI+ I G + SI+P Y NLYVKSNMSGDFTV+N  LV++LK 
Sbjct: 609 IAEHGMRNSNTMAIAPTATISTINGTTPSIEPIYSNLYVKSNMSGDFTVINEQLVDDLKA 668

Query: 813 RDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQS 872
             LWD+ M+  +K+ DGSI  +  IP+++++++ +AFEIDP   +   + R +WIDQ+ S
Sbjct: 669 EGLWDDEMVDQIKFFDGSIQEVSAIPEEMRELYRSAFEIDPRHQLRLTAHRGQWIDQSIS 728

Query: 873 LNLYLDEPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTLK----GVDGKLNAVPV 928
            N++     G  LD +Y+ AW +G+KTTYYLR+  A+ +EKSTL     G   + N    
Sbjct: 729 HNVFFPSTDGSLLDDVYKTAWRLGVKTTYYLRTLGASQIEKSTLDMAEYGRTQRRNESEA 788

Query: 929 TDPNSSTHSLGIPSSCTSDTE 949
           T    S  + G  ++   DT+
Sbjct: 789 TADRDSNDNGGNVTAADGDTD 809


>gi|300709534|ref|YP_003735348.1| ribonucleoside-diphosphate reductase alpha subunit [Halalkalicoccus
           jeotgali B3]
 gi|299123217|gb|ADJ13556.1| ribonucleoside-diphosphate reductase alpha subunit [Halalkalicoccus
           jeotgali B3]
          Length = 797

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/799 (50%), Positives = 530/799 (66%), Gaps = 18/799 (2%)

Query: 162 LEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTA 221
           +E I+E+A     + S   +     ++ Y+G S  ++  A+I +    I++ P Y  V A
Sbjct: 11  IEAILEQAWDDRAEGSPDDIARAARRDCYEGASREEVYEAIIGALTARIDRVPEYRTVAA 70

Query: 222 RFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYL 281
           R      RR     V   P      + +  Y + F   IE GV+A LL E M ++DL  L
Sbjct: 71  RVFR---RRYFEERVGVAPD-----DHEAAYRDSFVASIERGVEADLLDERMGEYDLSRL 122

Query: 282 ANDLKYERDFAFEYLGLQILYDRYFLHINGSRIEMPQAFFMRVAMGLALKET--EKEKRA 339
           A  L+  RD   +Y+ ++ L  RYFL      IE+PQ F+MRVAMG+AL+E   E+EK A
Sbjct: 123 AEALEPTRDDRLDYMAMETLSQRYFLREGDEPIELPQTFWMRVAMGIALREAPEEREKYA 182

Query: 340 VEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGG 399
            EFY+LLS+  F+ STPTLF++GT HPQLSSC+LTTVPDDL GIF A +E+A L+K+SGG
Sbjct: 183 KEFYDLLSTLRFVHSTPTLFHAGTTHPQLSSCYLTTVPDDLEGIFDAYKEHAKLSKWSGG 242

Query: 400 LGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDV 459
           LGNDWTP+R  GA I  T  +S G +PFLK+AND   A+N+ GKR+GA CAYLE WH+D 
Sbjct: 243 LGNDWTPLRASGARISSTGVESTGTVPFLKIANDVTGAINRSGKRRGAACAYLEAWHMDF 302

Query: 460 EEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFE 519
             FLDLR+NTGD+RRRTHDMNTA W+PDLFMKRV  +  W LFSP+EV DLH  YG+EFE
Sbjct: 303 PAFLDLRRNTGDERRRTHDMNTAAWVPDLFMKRVQNDEKWMLFSPEEVPDLHGTYGREFE 362

Query: 520 IAYENYERQADRGEIKVFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVV 579
             YE YER+A+ GE+  + +  A  LWR+ LT LFETGHPWITFKDPCN+RSPQ H GV+
Sbjct: 363 ERYEEYERRAEAGELDQYERCEAAELWRRTLTRLFETGHPWITFKDPCNVRSPQDHAGVI 422

Query: 580 HSSNLCTEITLNSSSEETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDIN 639
           +SSNLCTEITLN+S EETAVCNLGS+NL  H   +  D + LA T+ TA+R+LDNV+D+N
Sbjct: 423 NSSNLCTEITLNTSEEETAVCNLGSVNLSRHVIEDGLDREALAETVNTAMRMLDNVVDLN 482

Query: 640 CHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASV 699
            +  EKA++SN  HR +GLG MGF  AL    IP  S +AVE AD + E +S+HAI  S 
Sbjct: 483 FYPTEKAERSNMRHRPVGLGTMGFHDALLEQDIPMNSEKAVEFADRTQELVSYHAILGSS 542

Query: 700 ELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGM 758
           ELA ERGAY S++GS WD+ +FP D++ +L E R  E+ ++   RL W  +++ V   GM
Sbjct: 543 ELAAERGAYGSYEGSKWDRDLFPQDTVSILEEERGREIPIDVEERLDWGRVREHVSEHGM 602

Query: 759 RNSNCMAIAPTATIANICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDE 818
           RNSN MA+APTATI+ I G + SI+P Y NLYVKSNMSGDFTV+N  LV++L++R LW +
Sbjct: 603 RNSNTMAVAPTATISTIAGTTPSIEPIYSNLYVKSNMSGDFTVINDHLVSDLRERGLWTD 662

Query: 819 AMISDLKYHDGSIGNIERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLD 878
            +   + YHDGSI  I+ IP+D+ ++H  AFEIDP   +  ++ R  WIDQ QS N++  
Sbjct: 663 EIRDRITYHDGSIQEIDAIPEDVTELHRGAFEIDPRHQLRLSAERATWIDQGQSHNVFFP 722

Query: 879 EPSGKKLDFIYRQAWLMGLKTTYYLRSRSATSVEKSTL---KGVDGKLNAVPVTDPNSST 935
              G  L  +Y  AW +GLKTTYYLR+  A+ VEK+TL   +  D +       D     
Sbjct: 723 STDGSLLAGVYETAWELGLKTTYYLRTLGASQVEKTTLDMREYDDTQFRDSDDDDDEDEG 782

Query: 936 HSLGIPSSCTSDTECEVCQ 954
           +  G+PS    D  CE CQ
Sbjct: 783 N--GLPS--VEDPTCEACQ 797


>gi|15791174|ref|NP_280998.1| ribonucleotide-diphosphate reductase alpha subunit [Halobacterium
           sp. NRC-1]
 gi|169236930|ref|YP_001690130.1| ribonucleoside-diphosphate reductase alpha subunit [Halobacterium
           salinarum R1]
 gi|10581792|gb|AAG20478.1| ribonucleoside reductase large chain [Halobacterium sp. NRC-1]
 gi|167727996|emb|CAP14784.1| ribonucleoside-diphosphate reductase alpha subunit [Halobacterium
           salinarum R1]
          Length = 804

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/781 (49%), Positives = 524/781 (67%), Gaps = 18/781 (2%)

Query: 181 VLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYKKP 240
           +L+E  +N YD  +  +   AL+ +    I++ P Y  V  R L E+L R ++       
Sbjct: 35  ILTEATRNAYDDATTDERYDALLGALTGRIDRHPAYKTVAGRVLRERLERRLVDDYDPAT 94

Query: 241 QKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQI 300
           + A   +        F   I+ G+ A LL E M D+DL  LA+ +   RD   +Y+ +  
Sbjct: 95  RDAATRQA-------FRDGIQRGLDADLLDERMGDYDLNRLADAITPARDDRLDYMAMDT 147

Query: 301 LYDRYFLH-INGSRIEMPQAFFMRVAMGLALKE--TEKEKRAVEFYNLLSSFHFMCSTPT 357
           L  RYFL   +    E+PQ F+MRVAMG+AL+E   ++E+ A+EFY+ LS+  F+ STPT
Sbjct: 148 LRQRYFLREPDADPFELPQPFWMRVAMGVALREDPADREEYAIEFYDALSTLRFVHSTPT 207

Query: 358 LFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGT 417
           LF++GT H QLSSC+LTTVPDDL GIF A +E+A L+K+SGGLGNDWTP+R  G+ I  T
Sbjct: 208 LFHAGTTHAQLSSCYLTTVPDDLDGIFDAYKEHAKLSKWSGGLGNDWTPLRAAGSLIEST 267

Query: 418 NGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTH 477
             +S G +PFLK++ND   A+N+ GKR+GA  AYL  WH+D   F DLR+NTGD+RRRTH
Sbjct: 268 GVESTGTVPFLKISNDVTAAINRSGKRRGAAAAYLACWHLDFPAFCDLRRNTGDERRRTH 327

Query: 478 DMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKVF 537
           DMNTA WIPDLFM+RV  +  WTLFSP E  DL++LYG +F   Y  YE  AD G+I+ F
Sbjct: 328 DMNTAAWIPDLFMERVRADKQWTLFSPKETGDLYELYGSDFAERYREYEAMADDGDIQRF 387

Query: 538 RKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEET 597
            ++ A  LWR MLT LFETGHPW+TFKDPCN+RSPQ H G V SSNLCTEITLN+S EET
Sbjct: 388 ERVDATDLWRTMLTRLFETGHPWLTFKDPCNVRSPQDHAGTVRSSNLCTEITLNTSEEET 447

Query: 598 AVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIG 657
           AVCNLGS+NL  H  +   D ++L+ T+ TA+R+LDNV+D+N +  E A++SN  HR +G
Sbjct: 448 AVCNLGSVNLARHLDDGDIDREQLSETVETAMRMLDNVVDLNFYPTENAERSNMRHRPVG 507

Query: 658 LGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWD 717
           LG+MGF  AL  + +P AS +A++ AD   E++++HAI AS +LA ERG Y S++GS WD
Sbjct: 508 LGVMGFHDALQQMRVPMASDDALDRADALQEYVAYHAIGASADLAAERGTYESYEGSKWD 567

Query: 718 QGVFPIDSIGLLAEVRD-ELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANIC 776
           + VFP D++  L   R  E+ + R  RL W ++++RV T GMRNSN MA+APTATI+ I 
Sbjct: 568 RDVFPQDTVDRLESERGREIPVPREERLDWSDVRQRVATHGMRNSNTMAVAPTATISTIA 627

Query: 777 GVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIER 836
           G + SI+P Y NLYVKSNMSGDFTVVN  LV +L++RDLW E +   L YHDGS+  ++ 
Sbjct: 628 GTTPSIEPVYSNLYVKSNMSGDFTVVNDRLVADLEERDLWTEELRDKLTYHDGSVQELDA 687

Query: 837 IPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLMG 896
           +P+D+++++ TAFEIDP   +  A+RR  WIDQ+QS+N++  E  G KL  +Y+ AW +G
Sbjct: 688 VPEDVQELYRTAFEIDPRHQLRLAARRGVWIDQSQSVNVFFPETDGSKLSEVYQTAWELG 747

Query: 897 LKTTYYLRSRSATSVEKSTL---KGVDGKLNAVPVTDPNSSTHSLGIPSSCTSDTECEVC 953
           LKTTYYLR+  A+ +EK+TL   +  D +       +       L  PS    D  CEVC
Sbjct: 748 LKTTYYLRTLGASQIEKTTLDMDEYDDTQFRGDDDGEDADGDGDL--PS--VEDPTCEVC 803

Query: 954 Q 954
           Q
Sbjct: 804 Q 804


>gi|322368526|ref|ZP_08043094.1| ribonucleoside-diphosphate reductase, alpha subunit [Haladaptatus
           paucihalophilus DX253]
 gi|320551810|gb|EFW93456.1| ribonucleoside-diphosphate reductase, alpha subunit [Haladaptatus
           paucihalophilus DX253]
          Length = 815

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/742 (50%), Positives = 506/742 (68%), Gaps = 10/742 (1%)

Query: 179 KIVLSETYKNMYDGLSESDLETALIFSSRTLIEKEPNYAKVTARFLLEKLRREVLTTVYK 238
           + + SE  + +YDG S  ++  A+  +    +E+EP + ++ A    +    EV+     
Sbjct: 33  ETLASEIERTLYDGASTDEVYQAVTQAFSARVEREPAFKRIAAAAFRQGYYHEVIG---- 88

Query: 239 KPQKATHHEMQCLYPEYFCRYIEEGVKARLLHESMMD-FDLVYLANDLKYERDFAFEYLG 297
             +    +E+   Y   F   +E  V+   L E + + FDL  LA+ L+ +RD  FEY+ 
Sbjct: 89  --ENLRGYELDREYRATFIENLERAVEIGRLDERLPERFDLDDLASYLEPDRDERFEYMA 146

Query: 298 LQILYDRYFLHI--NGSRIEMPQAFFMRVAMGLALKETEKEKRAVEFYNLLSSFHFMCST 355
           ++ L  RYFL    NG R+E+PQAF+MRVAMGLA++E + ++RA EFY++LS   F  ST
Sbjct: 147 METLAQRYFLKTEENGERLELPQAFWMRVAMGLAVEEDDPQRRAKEFYDVLSKLEFTPST 206

Query: 356 PTLFNSGTRHPQLSSCFLTTVPDDLYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIH 415
           PTLF+SG+ HPQLSSC+LTTV DDL  IF +   +A L+K+SGGLGNDWT +R  GA I 
Sbjct: 207 PTLFHSGSTHPQLSSCYLTTVSDDLEHIFDSYNHHAHLSKWSGGLGNDWTNLRASGALIE 266

Query: 416 GTNGKSQGVIPFLKVANDTAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRR 475
            T  +S GV+PFL+++ND   A+N+ GKR+GA CAYL  WH+D   F+DL++NTGD+RRR
Sbjct: 267 STGVESTGVVPFLRISNDVTAAINRSGKRRGAACAYLACWHLDFPAFIDLKRNTGDERRR 326

Query: 476 THDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIK 535
           T DMNTA WIPDLFMKRV     WTLFSPDEV DLHDL G+ F   Y  YE+QA+ GE +
Sbjct: 327 TPDMNTAAWIPDLFMKRVEAGEEWTLFSPDEVPDLHDLSGEAFAEKYREYEKQAEAGEFR 386

Query: 536 VFRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSE 595
            + ++ A  LWRK LT LFETGHPW+TFKDPCN+RSPQ H G VHSSNLCTEITLN+S +
Sbjct: 387 QYERVDAEELWRKTLTRLFETGHPWLTFKDPCNVRSPQDHAGTVHSSNLCTEITLNTSED 446

Query: 596 ETAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRA 655
           E AVCNLGS+N   H +  + ++D LA TI TA+R+LDNV+D+  +  ++A+ SN  HR 
Sbjct: 447 EHAVCNLGSVNFATHVSGGELNHDHLAETIETAMRMLDNVVDLCFYPTDEAEHSNMQHRP 506

Query: 656 IGLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSL 715
           +GLG MGF  AL  L IP  S +A+E A+   EF+S+HAI  S +LA ERG Y S++GS 
Sbjct: 507 VGLGTMGFHDALMELGIPMDSEDAIEKANRWQEFVSYHAIHNSSKLAAERGTYPSYEGSK 566

Query: 716 WDQGVFPIDSIGLL-AEVRDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIAN 774
           WD+G+ P D++  L AE   E+   R   L W  +++ V+  GMRNSN MAIAPTAT++ 
Sbjct: 567 WDRGMLPQDTVDTLEAERGREIPTEREETLDWYVVREHVEEHGMRNSNTMAIAPTATVST 626

Query: 775 ICGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNI 834
           I G + SI+P Y NLYVKSNMSG+FTVVN  LV++LK  +LWDE M+  +KYHDG+I  I
Sbjct: 627 INGTTPSIEPMYSNLYVKSNMSGEFTVVNDHLVDDLKALELWDEEMVDRIKYHDGTIQEI 686

Query: 835 ERIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWL 894
           + +PDDLK+++  AFEIDP   +   + RQ WIDQ+ S N++     G  LD +Y+ AW 
Sbjct: 687 DAVPDDLKELYRGAFEIDPRHQLRLTAHRQTWIDQSVSHNVFFPSTDGTLLDDVYKTAWR 746

Query: 895 MGLKTTYYLRSRSATSVEKSTL 916
           +GLKTTYYLR+  A+ +EKSTL
Sbjct: 747 LGLKTTYYLRTLGASGIEKSTL 768


>gi|300113308|ref|YP_003759883.1| ribonucleoside-diphosphate reductase subunit alpha [Nitrosococcus
            watsonii C-113]
 gi|299539245|gb|ADJ27562.1| ribonucleoside-diphosphate reductase, alpha subunit [Nitrosococcus
            watsonii C-113]
          Length = 1336

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/541 (65%), Positives = 422/541 (78%), Gaps = 15/541 (2%)

Query: 425  IPF---LKVAND-----TAVAVNQGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRT 476
            +PF   LKV  D     T   V+ GGKRKGAVCAYLETWHID+EEFLDLRKNTGDDRRRT
Sbjct: 800  LPFVYDLKVEGDPSYMTTTALVHNGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDDRRRT 859

Query: 477  HDMNTANWIPDLFMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAYENYERQADRGEIKV 536
            HDMNTANW+PDLFMKRV +N GWTLFSPDE  DLHDL G+ FE AY  YE +A RGEIK 
Sbjct: 860  HDMNTANWVPDLFMKRVAENGGWTLFSPDETPDLHDLVGQAFEAAYLGYEGKASRGEIKN 919

Query: 537  FRKISAVALWRKMLTMLFETGHPWITFKDPCNIRSPQQHVGVVHSSNLCTEITLNSSSEE 596
            F+K  AV LWRKML+MLFETGHPWI FKDPCN+RSPQQH GVVHSSNLCTEITLN+S +E
Sbjct: 920  FKKRRAVDLWRKMLSMLFETGHPWIAFKDPCNLRSPQQHAGVVHSSNLCTEITLNTSDDE 979

Query: 597  TAVCNLGSINLLAHFANNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAI 656
             AVCNLGSINL  H   +  +  KL  TI TA+R+LDNVID N +++  A++SN  HR +
Sbjct: 980  IAVCNLGSINLPQHLDEDGLNLPKLEKTITTAMRMLDNVIDYNYYSVPTARRSNLRHRPV 1039

Query: 657  GLGLMGFQSALHLLHIPYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLW 716
            GLGLMGFQ AL+   IPYAS  AVE AD SME IS++AI AS +LA ERG+Y +FK SLW
Sbjct: 1040 GLGLMGFQDALYKRRIPYASEAAVEFADHSMEAISYYAIKASSDLAAERGSYPTFKDSLW 1099

Query: 717  DQGVFPIDSIGLLAEVRDE-LAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANI 775
             QG+ PIDSI LL E R      +R+  L WD L+++VKT+GMRNSNCMAIAPTATI+NI
Sbjct: 1100 SQGILPIDSISLLEENRGGYFQQDRSRTLDWDSLREQVKTVGMRNSNCMAIAPTATISNI 1159

Query: 776  CGVSQSIDPSYQNLYVKSNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIE 835
            CGVSQSI+P+YQNL+VKSN+SG+FTV+N +LV +LK ++LWDE M++DLKY DGS   I+
Sbjct: 1160 CGVSQSIEPTYQNLFVKSNLSGEFTVINPYLVRDLKAQNLWDEVMVNDLKYFDGSAQPID 1219

Query: 836  RIPDDLKKIHATAFEIDPMWLIESASRRQKWIDQAQSLNLYLDEPSGKKLDFIYRQAWLM 895
            RIPD+LK ++ATAFEIDP WL+E+ASRRQKW+DQAQSLNLY+ EPSGKKLD +Y+ AW+ 
Sbjct: 1220 RIPDELKTLYATAFEIDPRWLVEAASRRQKWLDQAQSLNLYMAEPSGKKLDNLYKLAWVR 1279

Query: 896  GLKTTYYLRSRSATSVEKSTL-KGVDGKLNAVPVTDPNSSTHSLGIPSSCTS-DTECEVC 953
            GLKTTYYLRS  AT VEKST+  G   KLNAV     +S   +   P +C+  D +CE C
Sbjct: 1280 GLKTTYYLRSLGATHVEKSTMTSGQANKLNAV----QSSYIQTSEAPQACSILDPDCEAC 1335

Query: 954  Q 954
            Q
Sbjct: 1336 Q 1336



 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/411 (56%), Positives = 298/411 (72%)

Query: 30  QVIKRNGGVTSFDPSKISRAIMKAFMAVEGKGASRSIRVQDIIKNLTEQTVTRLLQHNKS 89
           +VI+RNG VT FDPSKI+ A+ KAF+A+EG GA+ S R+   +++L EQ V    +  ++
Sbjct: 34  RVIRRNGKVTGFDPSKIAVAMTKAFLALEGNGAAMSKRIHQTVEDLAEQVVEACTRRLET 93

Query: 90  ALIVHIEDIQDQVECSLMQSGHHKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMM 149
              VHIE IQDQVE +LM+ GHHKI R YVLYREER+  RA  +         P +++ +
Sbjct: 94  GGTVHIEGIQDQVELALMRGGHHKIARAYVLYREERARERAQGAAKNKKKATEPPIQVTL 153

Query: 150 DDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIFSSRTL 209
            DG     +  RL  I+EEAC  L +   + +L+ET +N++DG++E D+E ALI S+R