PSIBLAST alignment of GI: 254780502 and protein with PDB id: 2x3i

>gi|288562861|pdb|2X3I|A Chain A, Ribonucleotide Reductase Y730no2y And Y731a Modified R1 Subunit Of E. Coli Length = 761
>gi|288562862|pdb|2X3I|B Chain B, Ribonucleotide Reductase Y730no2y And Y731a Modified R1 Subunit Of E. Coli Length = 761
 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 191/776 (24%), Positives = 311/776 (40%), Gaps = 71/776 (9%)

Query: 145 LKIMMDDGTLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYKNMYDGLSESDLETALIF 204
           L +   DG+    N  ++  +++ A  GL +VS   V   ++   YDG+  SD+   +I 
Sbjct: 5   LLVTKRDGSTERINLDKIHRVLDWAAEGLHNVSISQVELRSHIQFYDGIKTSDIHETIIK 64

Query: 205 SSRTLIEKE-PNYAKVTARFLLEKLRREVLTTVYKKPQKATHHEMQCLYPEYFCRYIEEG 263
           ++  LI ++ P+Y  + AR  +  LR++                   LY       +E G
Sbjct: 65  AAADLISRDAPDYQYLAARLAIFHLRKKAYGQFEPPA----------LYDHVVKM-VEMG 113

Query: 264 VKARLLHESMMDFDLVYLANDLKYERDFAFEYLGLQILYDRY--FLHINGSRIEMPQAFF 321
                L E   + +   +   + ++RD  F Y  ++ L  +Y     + G   E  Q  +
Sbjct: 114 KYDNHLLEDYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLY 173

Query: 322 MRVAMGLA--LKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHPQLSSCFLTTVPDD 379
           + VA  L        + +    FY+ +S+F     TP +    T   Q SSC L    D 
Sbjct: 174 ILVAACLFSNYPRETRLQYVKRFYDAVSTFKISLPTPIMSGVRTPTRQFSSCVLIECGDS 233

Query: 380 LYGIFGALQENAMLAKYSGGLGNDWTPVRGLGAHIHGTNGKSQGVIPFLKVANDTAVAVN 439
           L  I               G+G +   +R LG+ I G      G IPF K       + +
Sbjct: 234 LDSINATSSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPFYKHFQTAVKSCS 293

Query: 440 QGGKRKGAVCAYLETWHIDVEEFLDLRKNTGDDRRRTHDMNTANWIPDLFMKRVTQNAGW 499
           QGG R GA   +   WH++VE  L L+ N G +  R   M+    I  L   R+ +    
Sbjct: 294 QGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDYGVQINKLMYTRLLKGEDI 353

Query: 500 TLFSPDEVSDLHDLY---GKEFEIAYENYERQADRGEIKVFRKISAVALWRKMLTMLFET 556
           TLFSP +V  L+D +    +EFE  Y  YE+     +    +++ AV L+  M+     T
Sbjct: 354 TLFSPSDVPGLYDAFFADQEEFERLYTKYEKDDSIRK----QRVKAVELFSLMMQERAST 409

Query: 557 GHPWITFKDPCNIRSPQQHV-GVVHSSNLCTEITLNSSSEETAVCNLGSINLLA---HFA 612
           G  +I   D CN  SP       V  SNLC EI L +          G I L        
Sbjct: 410 GRIYIQNVDHCNTHSPFDPAIAPVRQSNLCLEIALPTKPLNDVNDENGEIALCTLSAFNL 469

Query: 613 NNQFDYDKLASTIRTAVRVLDNVIDINCHTIEKAKKSNHTHRAIGLGLMGFQSALHLLHI 672
               + D+L      AVR LD ++D   + I  AK+     R +G+G++ F   L     
Sbjct: 470 GAINNLDELEELAILAVRALDALLDYQDYPIPAAKRGAMGRRTLGIGVINFAYYLAKHGK 529

Query: 673 PYASPEAVEIADESMEFISFHAISASVELAQERGAYSSFKGSLWDQGVFPIDSIGLLAEV 732
            Y+   A  +  ++ E I ++ + AS ELA+E+GA   F  + + +G+ PID+     + 
Sbjct: 530 RYSDGSANNLTHKTFEAIQYYLLKASNELAKEQGACPWFNETTYAKGILPIDTYKKDLDT 589

Query: 733 RDELAMNRTSRLPWDELKKRVKTIGMRNSNCMAIAPTATIANICGVSQSIDPSYQNLYVK 792
                 N      W+ L++ +KT G+RNS   A+ P+ T + I   +  I+P    + +K
Sbjct: 590 IA----NEPLHYDWEALRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIK 645

Query: 793 SNMSGDFTVVNSFLVNELKQRDLWDEAMISDLKYHDGSIGNIERIPDDLKKIHATAFEID 852
           ++  G    V                                    + L   +   +E+ 
Sbjct: 646 ASKDGILRQVVPDY--------------------------------EHLHDAYELLWEMP 673

Query: 853 PMW-LIESASRRQKWIDQAQSLNLYLD-------EPSGKKLDFIYRQAWLMGLKTT 900
                ++     QK+IDQ+ S N   D       +   ++L      A+  G+KT 
Sbjct: 674 GNDGYLQLVGIMQKFIDQSISANTNYDPSRFPSGKVPMQQLLKDLLTAYKFGVKTL 729